Protein motif that contains a 33-amino acid long sequence that often occurs in tandem arrays. This repeating sequence of 33-amino acids was discovered in ANKYRIN where it is involved in interaction with the anion exchanger (ANION EXCHANGE PROTEIN 1, ERYTHROCYTE). Ankyrin repeats cooperatively fold into domains that mediate molecular recognition via protein-protein interactions.
A family of membrane-associated proteins responsible for the attachment of the cytoskeleton. Erythrocyte-related isoforms of ankyrin attach the SPECTRIN cytoskeleton to a transmembrane protein (ANION EXCHANGE PROTEIN 1, ERYTHROCYTE) in the erythrocyte plasma membrane. Brain-related isoforms of ankyrin also exist.
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
The genetic complement of an organism, including all of its GENES, as represented in its DNA, or in some cases, its RNA.
The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.
The addition of descriptive information about the function or structure of a molecular sequence to its MOLECULAR SEQUENCE DATA record.
A multistage process that includes cloning, physical mapping, subcloning, determination of the DNA SEQUENCE, and information analysis.
A class of plants within the Bryophyta comprising the mosses, which are found in both damp (including freshwater) and drier situations. Mosses possess erect or prostrate leafless stems, which give rise to leafless stalks bearing capsules. Spores formed in the capsules are released and grow to produce new plants. (Concise Dictionary of Biology, 1990). Many small plants bearing the name moss are in fact not mosses. The "moss" found on the north side of trees is actually a green alga (CHLOROPHYTA). Irish moss is really a red alga (RHODOPHYTA). Beard lichen (beard moss), Iceland moss, oak moss, and reindeer moss are actually LICHENS. Spanish moss is a common name for both LICHENS and an air plant (TILLANDSIA usneoides) of the pineapple family. Club moss is an evergreen herb of the family LYCOPODIACEAE.
A publication issued at stated, more or less regular, intervals.
Individual's rights to obtain and use information collected or generated by others.
A quantitative measure of the frequency on average with which articles in a journal have been cited in a given period of time.
The use of statistical methods in the analysis of a body of literature to reveal the historical development of subject fields and patterns of authorship, publication, and use. Formerly called statistical bibliography. (from The ALA Glossary of Library and Information Science, 1983)
"The business or profession of the commercial production and issuance of literature" (Webster's 3d). It includes the publisher, publication processes, editing and editors. Production may be by conventional printing methods or by electronic publishing.
STRIATED MUSCLE cell components which anchor the MYOFIBRILS from the Z-bands to the SARCOLEMMA and EXTRACELLULAR MATRIX. Costameric proteins include the proteins of FOCAL ADHESIONS.
Substances used to destroy or inhibit the action of rats, mice, or other rodents.
The reduction or regulation of the population of noxious, destructive, or dangerous rodents through chemical, biological, or other means.
The lipid- and protein-containing, selectively permeable membrane that surrounds the cytoplasm in prokaryotic and eukaryotic cells.
Diseases of rodents of the order RODENTIA. This term includes diseases of Sciuridae (squirrels), Geomyidae (gophers), Heteromyidae (pouched mice), Castoridae (beavers), Cricetidae (rats and mice), Muridae (Old World rats and mice), Erethizontidae (porcupines), and Caviidae (guinea pigs).
Substances found in many plants, containing the 4-hydroxycoumarin radical. They interfere with vitamin K and the blood clotting mechanism, are tightly protein-bound, inhibit mitochondrial and microsomal enzymes, and are used as oral anticoagulants.
Lists of words, usually in alphabetical order, giving information about form, pronunciation, etymology, grammar, and meaning.
A major integral transmembrane protein of the ERYTHROCYTE MEMBRANE. It is the anion exchanger responsible for electroneutral transporting in CHLORIDE IONS in exchange of BICARBONATE IONS allowing CO2 uptake and transport from tissues to lungs by the red blood cells. Genetic mutations that result in a loss of the protein function have been associated with type 4 HEREDITARY SPHEROCYTOSIS.
Bicarbonate transporters that move BICARBONATE IONS in exchange of CHLORIDE IONS or SODIUM IONS across membranes. They regulate acid-base HOMEOSTASIS, cell volume and intracellular pH. Members include CHLORIDE-BICARBONATE ANTIPORTERS (SLC4A1, 2, 3, and 9); SODIUM-COUPLED BICARBONATE TRANSPORTERS (SLC4A4 and 5, 7, 8 and 10); and a sodium borate cotransporter (SLC4A11 protein).
A congenital cardiomyopathy that is characterized by infiltration of adipose and fibrous tissue into the RIGHT VENTRICLE wall and loss of myocardial cells. Primary injuries usually are at the free wall of right ventricular and right atria resulting in ventricular and supraventricular arrhythmias.
The transmission of traits encoded in GENES from parent to offspring.
Any disturbances of the normal rhythmic beating of the heart or MYOCARDIAL CONTRACTION. Cardiac arrhythmias can be classified by the abnormalities in HEART RATE, disorders of electrical impulse generation, or impulse conduction.
Unexpected rapid natural death due to cardiovascular collapse within one hour of initial symptoms. It is usually caused by the worsening of existing heart diseases. The sudden onset of symptoms, such as CHEST PAIN and CARDIAC ARRHYTHMIAS, particularly VENTRICULAR TACHYCARDIA, can lead to the loss of consciousness and cardiac arrest followed by biological death. (from Braunwald's Heart Disease: A Textbook of Cardiovascular Medicine, 7th ed., 2005)
A form of CARDIAC MUSCLE disease that is characterized by ventricular dilation, VENTRICULAR DYSFUNCTION, and HEART FAILURE. Risk factors include SMOKING; ALCOHOL DRINKING; HYPERTENSION; INFECTION; PREGNANCY; and mutations in the LMNA gene encoding LAMIN TYPE A, a NUCLEAR LAMINA protein.
A voltage-gated sodium channel subtype that mediates the sodium ion PERMEABILITY of CARDIOMYOCYTES. Defects in the SCN5A gene, which codes for the alpha subunit of this sodium channel, are associated with a variety of CARDIAC DISEASES that result from loss of sodium channel function.
A condition that is characterized by episodes of fainting (SYNCOPE) and varying degree of ventricular arrhythmia as indicated by the prolonged QT interval. The inherited forms are caused by mutation of genes encoding cardiac ion channel proteins. The two major forms are ROMANO-WARD SYNDROME and JERVELL-LANGE NIELSEN SYNDROME.
The level of protein structure in which combinations of secondary protein structures (alpha helices, beta sheets, loop regions, and motifs) pack together to form folded shapes called domains. Disulfide bridges between cysteines in two different parts of the polypeptide chain along with other interactions between the chains play a role in the formation and stabilization of tertiary structure. Small proteins usually consist of only one domain but larger proteins may contain a number of domains connected by segments of polypeptide chain which lack regular secondary structure.
The process in which substances, either endogenous or exogenous, bind to proteins, peptides, enzymes, protein precursors, or allied compounds. Specific protein-binding measures are often used as assays in diagnostic assessments.
A family of inhibitory proteins which bind to the REL PROTO-ONCOGENE PROTEINS and modulate their activity. In the CYTOPLASM, I-kappa B proteins bind to the transcription factor NF-KAPPA B. Cell stimulation causes its dissociation and translocation of active NF-kappa B to the nucleus.
A high molecular weight (220-250 kDa) water-soluble protein which can be extracted from erythrocyte ghosts in low ionic strength buffers. The protein contains no lipids or carbohydrates, is the predominant species of peripheral erythrocyte membrane proteins, and exists as a fibrous coating on the inner, cytoplasmic surface of the membrane.
A plant genus of the family ERICACEAE known for species with edible fruits.
All of the divisions of the natural sciences dealing with the various aspects of the phenomena of life and vital processes. The concept includes anatomy and physiology, biochemistry and biophysics, and the biology of animals, plants, and microorganisms. It should be differentiated from BIOLOGY, one of its subdivisions, concerned specifically with the origin and life processes of living organisms.
The study of the origin, structure, development, growth, function, genetics, and reproduction of plants.
The teaching staff and members of the administrative staff having academic rank in a medical school.

The LIM-only protein PINCH directly interacts with integrin-linked kinase and is recruited to integrin-rich sites in spreading cells. (1/741)

PINCH is a widely expressed and evolutionarily conserved protein comprising primarily five LIM domains, which are cysteine-rich consensus sequences implicated in mediating protein-protein interactions. We report here that PINCH is a binding protein for integrin-linked kinase (ILK), an intracellular serine/threonine protein kinase that plays important roles in the cell adhesion, growth factor, and Wnt signaling pathways. The interaction between ILK and PINCH has been consistently observed under a variety of experimental conditions. They have interacted in yeast two-hybrid assays, in solution, and in solid-phase-based binding assays. Furthermore, ILK, but not vinculin or focal adhesion kinase, has been coisolated with PINCH from mammalian cells by immunoaffinity chromatography, indicating that PINCH and ILK associate with each other in vivo. The PINCH-ILK interaction is mediated by the N-terminal-most LIM domain (LIM1, residues 1 to 70) of PINCH and multiple ankyrin (ANK) repeats located within the N-terminal domain (residues 1 to 163) of ILK. Additionally, biochemical studies indicate that ILK, through the interaction with PINCH, is capable of forming a ternary complex with Nck-2, an SH2/SH3-containing adapter protein implicated in growth factor receptor kinase and small GTPase signaling pathways. Finally, we have found that PINCH is concentrated in peripheral ruffles of cells spreading on fibronectin and have detected clusters of PINCH that are colocalized with the alpha5beta1 integrins. These results demonstrate a specific protein recognition mechanism utilizing a specific LIM domain and multiple ANK repeats and suggest that PINCH functions as an adapter protein connecting ILK and the integrins with components of growth factor receptor kinase and small GTPase signaling pathways.  (+info)

Characterization of Chlamydomonas reinhardtii zygote-specific cDNAs that encode novel proteins containing ankyrin repeats and WW domains. (2/741)

Genes that are expressed only in the young zygote are considered to be of great importance in the development of an isogamous green alga, Chlamydomonas reinhardtii. Clones representing the Zys3 gene were isolated from a cDNA library prepared using zygotes at 10 min after fertilization. Sequencing of Zys3 cDNA clones resulted in the isolation of two related molecular species. One of them encoded a protein that contained two kinds of protein-to-protein interaction motifs known as ankyrin repeats and WW domains. The other clone lacked the ankyrin repeats but was otherwise identical. These mRNA species began to accumulate simultaneously in cells beginning 10 min after fertilization, and reached maximum levels at about 4 h, after which time levels decreased markedly. Genomic DNA gel-blot analysis indicated that Zys3 was a single-copy gene. The Zys3 proteins exhibited parallel expression to the Zys3 mRNAs at first, appearing 2 h after mating, and reached maximum levels at more than 6 h, but persisted to at least 1 d. Immunocytochemical analysis revealed their localization in the endoplasmic reticulum, which suggests a role in the morphological changes of the endoplasmic reticulum or in the synthesis and transport of proteins to the Golgi apparatus or related vesicles.  (+info)

RFX-B is the gene responsible for the most common cause of the bare lymphocyte syndrome, an MHC class II immunodeficiency. (3/741)

The bare lymphocyte syndrome (BLS) is characterized by the absence of MHC class II transcription and humoral- and cellular-mediated immune responses to foreign antigens. Three of the four BLS genetic complementation groups have defects in the activity of the MHC class II transcription factor RFX. We have purified the RFX complex and sequenced its three subunits. The sequence of the smallest subunit describes a novel gene, termed RFX-B. RFX-B complements the predominant BLS complementation group (group B) and was found to be mutant in cell lines from this BLS group. The protein has no known DNA-binding domain but does contain three ankyrin repeats that are likely to be important in protein-protein interactions.  (+info)

Paxillin LD4 motif binds PAK and PIX through a novel 95-kD ankyrin repeat, ARF-GAP protein: A role in cytoskeletal remodeling. (4/741)

Paxillin is a focal adhesion adaptor protein involved in the integration of growth factor- and adhesion-mediated signal transduction pathways. Repeats of a leucine-rich sequence named paxillin LD motifs (Brown M.C., M.S. Curtis, and C.E. Turner. 1998. Nature Struct. Biol. 5:677-678) have been implicated in paxillin binding to focal adhesion kinase (FAK) and vinculin. Here we demonstrate that the individual paxillin LD motifs function as discrete and selective protein binding interfaces. A novel scaffolding function is described for paxillin LD4 in the binding of a complex of proteins containing active p21 GTPase-activated kinase (PAK), Nck, and the guanine nucleotide exchange factor, PIX. The association of this complex with paxillin is mediated by a new 95-kD protein, p95PKL (paxillin-kinase linker), which binds directly to paxillin LD4 and PIX. This protein complex also binds to Hic-5, suggesting a conservation of LD function across the paxillin superfamily. Cloning of p95PKL revealed a multidomain protein containing an NH2-terminal ARF-GAP domain, three ankyrin-like repeats, a potential calcium-binding EF hand, calmodulin-binding IQ motifs, a myosin homology domain, and two paxillin-binding subdomains (PBS). Green fluorescent protein- (GFP-) tagged p95PKL localized to focal adhesions/complexes in CHO.K1 cells. Overexpression in neuroblastoma cells of a paxillin LD4 deletion mutant inhibited lamellipodia formation in response to insulin-like growth fac- tor-1. Microinjection of GST-LD4 into NIH3T3 cells significantly decreased cell migration into a wound. These data implicate paxillin as a mediator of p21 GTPase-regulated actin cytoskeletal reorganization through the recruitment to nascent focal adhesion structures of an active PAK/PIX complex potentially via interactions with p95PKL.  (+info)

Identification of a novel inhibitor of nuclear factor-kappaB, RelA-associated inhibitor. (5/741)

Here we report the identification and characterization of a novel protein, RelA-associated inhibitor (RAI), that binds to the NF-kappaB subunit p65 (RelA) and inhibits its transcriptional activity. RAI gene was isolated in a yeast two-hybrid screen using the central region of p65 as bait. We confirmed the physical interaction in vitro using recombinant proteins as well as in vivo by immunoprecipitation/Western blot assay. RAI gene encodes a protein with homology to the C-terminal region of 53BP2 containing four consecutive ankyrin repeats and an Src homology 3 domain. RAI mRNA was preferentially expressed in human heart, placenta, and prostate. Despite its similarity to 53BP2, RAI did not interact with p53 in a yeast two-hybrid assay. RAI inhibited the action of NF-kappaB p65 but not that of p53 in transient luciferase gene expression assays. Similarly, RAI inhibited the endogenous NF-kappaB activity induced by tumor necrosis factor-alpha. RAI specifically inhibited the DNA binding activity of p65 when co-transfected in 293 cells. RAI protein appeared to be located in the nucleus and colocalized with NF-kappaB p65 that was activated by TNF-alpha. These observations indicate that RAI is another inhibitor of NF-kappaB in addition to IkappaB proteins and may confer an alternative mechanism of regulation.  (+info)

INK4 cell cycle inhibitors direct transcriptional inactivation of NF-kappaB. (6/741)

The nuclear factor kappaB, a transcription factor regulating the expression of multiple genes including genes essential for cell cycle control, is found in most cells in a dormant state in the cytoplasm bound to the inhibitory family I kappaB via an ankyrin repeat domain. Stimulation of cells with a variety of inducers inactivates I kappaB proteins. The active dimeric NF-kappaB complex, often composed of 50- and 65-kilodalton subunits of the Rel family, translocates into the nucleus, where the NF-kappaBp65 subunit stimulates transcription. Here we report that a family of proteins containing ankyrin repeats, the inhibitors of Cdk4 (INK4) is able to bind NF-kappaBp65. The association of p16INK4 with NF-kappaBp65 is considerable in HeLa- or 293 cells, if the NF-kappaB inhibitor I kappaB alpha is degraded in response to TNFalpha stimulation. Overexpression of INK4 molecules suppresses the transactivational ability of NF-kappaB significantly. In contrast to INK4 proteins, the cell cycle inhibitor p27 enhances NF-kappaB transactivation activity. Thus, the effect of INK4 proteins on NF-kappaB function possibly modifies NF-kappaB mediated transcriptional activation of cell cycle associated factors.  (+info)

The Bcl-3 oncoprotein acts as a bridging factor between NF-kappaB/Rel and nuclear co-regulators. (7/741)

The proto-oncoprotein Bcl-3 is a member of the IkappaB family and is present predominantly in the nucleus. To gain insight into specific nuclear functions of Bcl-3 we have isolated proteins that interact with its ankyrin repeat domain. Using the yeast two-hybrid-system we identified four novel binding partners of Bcl-3 in addition to NF-kappaB p50 and p52, previously known to associate with Bcl-3. The novel Bcl-3 interactors Jab1, Pirin, Tip60 and Bard1 are nuclear proteins which also bind to other transcription factors including c-Jun, nuclear factor I (NFI), HIV-1 Tat or the tumor suppressor and PolII holoenzyme component Brca1, respectively. Bcl-3, p50, and either Bard1, Tip60 or Pirin are sequestered into quarternary complexes on NF-kappaB DNA binding sites, whereas Jab1 enhances p50-Bcl-3-DNA complex formation. Furthermore, the histone acetylase Tip60 enhances Bcl-3-p50 activated transcription through an NF-kappaB binding site, indicating that quarternary complexes containing Bcl-3 interactors modulate NF-kappaB driven gene expression. These data implicate Bcl-3 as an adaptor between NF-kappaB p50/p52 and other transcription regulators and suggest that its gene activation function may at least in part be due to recruitment of the Tip60 histone actetylase.  (+info)

Mutation in ankyrin repeats of the mouse Notch2 gene induces early embryonic lethality. (8/741)

Notch family genes encode transmembrane proteins involved in cell-fate determination. Using gene targeting procedures, we disrupted the mouse Notch2 gene by replacing all but one of the ankyrin repeat sequences in the cytoplasmic domain with the E. coli (beta)-galactosidase gene. The mutant Notch2 gene encodes a 380 kDa Notch2-(beta)-gal fusion protein with (beta)-galactosidase activity. Notch2 homozygous mutant mice die prior to embryonic day 11.5, whereas heterozygotes show no apparent abnormalities and are fully viable. Analysis of Notch2 expression patterns, revealed by X-gal staining, demonstrated that the Notch2 gene is expressed in a wide variety of tissues including neuroepithelia, somites, optic vesicles, otic vesicles, and branchial arches, but not heart. Histological studies, including in situ nick end labeling procedures, showed earlier onset and higher incidence of apoptosis in homozygous mutant mice than in heterozygotes or wild type mice. Dying cells were particularly evident in neural tissues, where they were seen as early as embryonic day 9.5 in Notch2-deficient mice. Cells from Notch2 mutant mice attach and grow normally in culture, demonstrating that Notch2 deficiency does not interfere with cell proliferation and that expression of the Notch2-(beta)-gal fusion protein is not toxic per se. In contrast to Notch1-deficient mice, Notch2 mutant mice did not show disorganized somitogenesis, nor did they fail to properly regulate the expression of neurogenic genes such as Hes-5 or Mash1. In situ hybridization studies show no indication of altered Notch1 expression patterns in Notch2 mutant mice. The results indicate that Notch2 plays an essential role in postimplantation development in mice, probably in some aspect of cell specification and/or differentiation, and that the ankyrin repeats are indispensable for its function.  (+info)

Spectrins are tetrameric actin-cross-linking proteins that form an elastic network, termed the membrane skeleton, on the cytoplasmic surface of cellular membranes. At the plasma membrane, the membrane skeleton provides essential support, preventing loss of membrane material to environmental shear stresses. The skeleton also controls the location, abundance, and activity of membrane proteins that are critical to cell and tissue function. The ability of the skeleton to modulate membrane stability and function requires adaptor proteins that bind the skeleton to membranes. The principal adaptors are the ankyrin proteins, which bind to the beta-subunit of spectrin and to the cytoplasmic domains of numerous integral membrane proteins. Here, we present the crystal structure of the ankyrin-binding domain of human beta2-spectrin at 1.95 A resolution together with mutagenesis data identifying the binding surface for ankyrins on beta2-spectrin.. ...
We have recently found that the erythroid ankyrin gene, Ank1, expresses isoforms in mouse skeletal muscle, several of which share COOH-terminal sequence with previously known Ank1 isoforms but have a novel, highly hydrophobic 72-amino acid segment at their NH2 termini. Here, through the use of domain-specific peptide antibodies, we report the presence of the small ankyrins in rat and rabbit skeletal muscle and demonstrate their selective association with the sarcoplasmic reticulum. In frozen sections of rat skeletal muscle, antibodies to the spectrin-binding domain (anti-p65) react only with a 210-kD Ank1 and label the sarcolemma and nuclei, while antibodies to the COOH terminus of the small ankyrin (anti-p6) react with peptides of 20 to 26 kD on immunoblots and decorate the myoplasm in a reticular pattern. Mice homozygous for the normoblastosis mutation (gene symbol nb) are deficient in the 210-kD ankyrin but contain normal levels of the small ankyrins in the myoplasm. In nb/nb skeletal
Hearing and touch depend on the ability of sensory neurons to be activated by a force, such as pressure or vibration from sound, and then pass information on to the brain. William Schafers group has identified some of the key proteins that make this possible.
Erythrocyte ankyrin contains an 89-kDa domain (residues 2-827) comprised almost entirely of 22 tandem repeats of 33 amino acids which are responsible for the high affinity interaction of ankyrin with the anion exchanger (Davis, L., and Bennett, V. (1990) J. Biol. Chem. 265, 10589-10596). The question of whether the repeats are equivalent with respect to binding to the anion exchanger was addressed using defined regions of erythrocyte and brain ankyrins expressed in bacteria. The conclusion is that the repeats are not interchangeable and that the 44 residues from 722 to 765 are essential for high affinity binding between erythrocyte ankyrin and the anion exchanger. Residues 348-765 were active whereas a polypeptide of the same size (residues 305-721) but missing the 44 residues was not active. The difference between the active and inactive polypeptides was not caused by the degree of folding based on circular dichroism spectra. The 44 residues from 722 to 765 were not sufficient for binding since ...
Erythrocyte ankyrin contains an 89-kDa domain (residues 2-827) comprised almost entirely of 22 tandem repeats of 33 amino acids which are responsible for the high affinity interaction of ankyrin with the anion exchanger (Davis, L., and Bennett, V. (1990) J. Biol. Chem. 265, 10589-10596). The question of whether the repeats are equivalent with respect to binding to the anion exchanger was addressed using defined regions of erythrocyte and brain ankyrins expressed in bacteria. The conclusion is that the repeats are not interchangeable and that the 44 residues from 722 to 765 are essential for high affinity binding between erythrocyte ankyrin and the anion exchanger. Residues 348-765 were active whereas a polypeptide of the same size (residues 305-721) but missing the 44 residues was not active. The difference between the active and inactive polypeptides was not caused by the degree of folding based on circular dichroism spectra. The 44 residues from 722 to 765 were not sufficient for binding since ...
Ankyrins are a family of proteins that are believed to link the integral membrane proteins to the underlying spectrin-actin cytoskeleton and play key…
N terminal band 3 binding domain with 24 tandem subunits of 33 amino-acids (the SW16/Ank repeat), important for lipid-binding activity of the beta-spectrin ankyrin-binding domain and its substantial role in maintaining the spectrin-based skeleton distribution ...
Recruitment of ankyrin G by NF186 is critical for PNS node assembly. (A) DRG neurons expressing NF186-GFP or NF186ΔABD-GFP were cultured with Schwann cells under myelinating conditions, fixed, and stained for GFP, P0, and ankyrin G (left) or sodium channels (NaCh; right). Robust levels of NF186ΔABD at nodes were associated with reduced coexpression of ankyrin G and sodium channels, as evident by comparison of nontransfected nodes (asterisks) to transfected nodes (arrowheads). Bars, 10 μm. (B) Schematic diagram and sequence of NF constructs used for rescue experiments. The modified sequence within the NF mucin-like domain is shown with substituted codons marked in red. (C) Western blot of NF186 knockdown and rescue. DRG neurons were infected with pLL3.7 vector alone (sh Con) or encoding shRNA to endogenous NF186. shRNA-treated neurons were either not nucleofected (sh NF) or were nucleofected with the codon-modified NF186-GFP (+NF) or NF186ΔABD-GFP constructs (+NFΔABD). Lysates were blotted ...
Ankyrin-binding proteins related to nervous system cell adhesion molecules: candidates to provide transmembrane and intercellular connections in adult brain.
Assembly of the full-length cDNA for 270-kD ankyrinG (Ank270) was achieved by ligating the first half of membrane-binding domain, which was isolated from adult rat brain 5′-stretch plus cDNA library (Clontech Laboratories Inc., Palo Alto, CA) and confirmed by DNA sequencing, with construct M-Sb-Sr-T-C (Zhang and Bennett, 1996) through the EcoRI-NsiI sites. The COOH-terminal domain of 270-kD ankyrinG was PCR amplified and introduced into the SalI site of pEGFP-N1 vector (Clontech Laboratories Inc.), while keeping in-frame with the downstream EGFP protein (Ank-Ct). The full-length 270-kD ankyrinG with GFP tagged at its COOH terminus (see Fig. 2, Ank270-GFP) was prepared by ligating the EcoRI-EcoRV fragment of construct Ank270 into the EcoRI-EcoRV sites of construct Ank-Ct. The cDNA construct for 190-kD ankyrinG (see Fig. 2, Ank270[ΔSR,T]-GFP) was prepared similarly except using construct M-Sb-C (Zhang and Bennett, 1996) instead of M-Sb-Sr-T-C. The cDNA construct lacking the first half of the ...
In order for the axon to initiate an action potential, we know that the axon initial segment must be brought to threshold. So my question is as follows: Say we have the minimum charge input, X, necessary to depolarize the axon initial segment of Neuron 1. Now, we have Neuron 2, which has a larger soma. Will this same input X be sufficient to depolarize the axon initial segment of Neuron 2?. I am trying to explore how physical concepts like capacitance manifest in biological systems. Neuron 1s soma (approximated as a sphere) presumably has a lower capacitance than Neuron 2s soma (approximated as a sphere), due to the difference in cross sectional area of the somas. Therefore, I would assume that Neuron 2s axon initial segment requires greater input to depolarize than Neuron 1s axon initial segment.. Is this simplistic idealization of somas actually observed in experiments? ...
Here, we described a protocol to quantitatively study the assembly and structure of the axon initial segments (AIS) of hippocampal...
Kv2.1 is a major delayed-rectifier voltage-gated potassium channel widely expressed in neurons of the CNS. Kv2.1 localizes in high-density cell-surface clusters in the soma and proximal dendrites as well as in the axon initial segment (AIS). Given the crucial roles of both of these compartments in i …
Mohler PJ, Le Scouarnec S, Denjoy I, Lowe JS, Guicheney P, Caron L, Driskell IM, Schott JJ, Norris K, Leenhardt A, Kim RB, Escande D, Roden DM, Defining the cellular phenotype of ankyrin-B syndrome variants: human ANK2 variants associated with clinical phenotypes display a spectrum of activities in cardiomyocytes Circulation115:432-41 ...
interacts with the second ankyrin-like repeat domain of TRPC6 and interacted with TRPC1, -3, -4, -5, and -7 (regulated the activity of TRPC6 by a mechanism requiring GTP binding) ...
A distinct subtype of dopaminergic interneuron displays inverted structural plasticity at the axon initial segment.: The axon initial segment (AIS) is a special
Video created by Peking University for the course Advanced Neurobiology I. Lets learn more about the basic unit of the nervous system: the neuron.
KEYWORD: 3D-structure Activator Alternative splicing ANK repeat Apoptosis DNA-binding Nuclear protein Phosphorylation Polymorphism Repeat Transcription regulation Ubl conjugation ...
ANKRA2 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 336 amino acids and having a molecular mass of 36.7kDa.
Es gibt mehrere Dinge, die Sie mehr Biologie erhalten motiviert tun können, um zu schreiben.. Eine der Möglichkeiten ist an der Stuttgarter Bibliothek an einem neurowissenschaftlichen Programm zu nehmen. Das Stuttgarter Zentrum für Bioethik oder SCBI beherbergt ein Programm, wie male lehren Studenten wie Wissenschaftler zu denken. Das Programm hilft Ihnen über die Wissenschaft der determination zu lernen.. SCBI ist ein Ableger der Abteilung Bioethik der Universität Stuttgart und dient als Leitbild. SCBI sich für eine Vorteile der biomedizinischen Forschung am Menschen. Das Programm unterstreicht die Bedeutung menschliche Forschungsthemen von der Ausbeutung durch Förderagenturen zu schützen.. Das Programm zielt auf enable Studenten das Leben derer, die Arbeit mit Labortieren und Kinder zu schützen. Wenn ein Schüler in dem Programm beendet besseres Verständnis dafür, wie die Forschung am Menschen zu unterstützen und wie Forschungsthemen zu ...
If youre looking for a game with a Chinese-wuxia-esque twist, youll be interested to know that Zu Online will enter its open beta testing phase this evening...
Looking for GRAINGER APPROVED No Hub Coupling,For Pipe Size 1-1/2 (2ZU19)? Graingers got your back. Price:$4.20. Easy ordering & convenient delivery. Log-in or register for your pricing.
Beh lt sich der Arbeitgeber durch arbeitsvertragliche Klauseln vor, eine Dienstwagenberechtigung zu widerrufen, braucht die Widerrufsklausel keine Ank ndigungsfrist zu enthalten
Das Ziel ist durch das Verständnis molekularer Krankheitsmechanismen neue Therapiestrategien gegen die Herzinsuffizienz zu entwickeln.
A recent investigative report by Steve Silberman from Wired about the highly resistant Acinetobacter baumannii, encountered by clinicians treating wounded
Mice with normoblastosis, nb/nb, have a severe hemolytic anemia. The extreme fragility and shortened lifespan of the mutant erythrocytes result from a defective membrane skeleton. Previous studies in our laboratory indicated a 50% deficiency of spectrin and an absence of normal ankyrin in erythrocyte membranes of nb/nb mice. We now report genetic mapping data that localize both the nb and erythroid ankyrin (Ank-1) loci to the centromeric end of mouse chromosome 8. Using immunological and biochemical methods, we have further characterized the nature of the ankyrin defect in mutant erythrocytes. We do not detect normal sized (210 kDa) erythroid ankyrin by immunoblot analysis in nb/nb reticulocytes. However, nb/nb reticulocytes do contain a 150-kDa ankyrin immunoreactive protein. The 150-kDa protein is present with normal-sized ankyrin in nb/+ reticulocytes but is not found in +/+ reticulocytes. Our genetic and biochemical data indicate that the nb mutation results from a defect in the
Abstract. Mutations in erythrocyte ankyrin, ankyrin-1, are the most common cause of typical hereditary spherocytosis. Co-inheritance of cardiac, muscular, and
Spectrin and ankyrin are two essential proteins acting like bricks and...Ron Dubreuil associate professor of biological sciences at the Univer...Spectrin was first discovered in red blood cells where it forms a pro...Dubreuil and his UIC co-workers have spent a decade looking at differe... In our study we showed spectrin doesnt have to bind to ankyrin to d...,Ghost,protein,leaves,fresh,tracks,in,the,cell,biological,biology news articles,biology news today,latest biology news,current biology news,biology newsletters
The axon initial segment (AIS) is a specialized domain essential for neuronal function, the formation of which begins with localization of an ankyrin‐G (AnkG) scaffold. However, the mechanism directing and maintaining AnkG localization is largely unknown. In this study, we demonstrate that in vivo knockdown of microtubule cross‐linking factor 1 (MTCL1) in cerebellar Purkinje cells causes loss of axonal polarity coupled with AnkG mislocalization. MTCL1 lacking MT‐stabilizing activity failed to restore these defects, and stable MT bundles spanning the AIS were disorganized in knockdown cells. Interestingly, during early postnatal development, colocalization of MTCL1 with these stable MT bundles was observed prominently in the axon hillock and proximal axon. These results indicate that MTCL1‐mediated formation of stable MT bundles is crucial for maintenance of AnkG localization. We also demonstrate that Mtcl1 gene disruption results in abnormal motor coordination with Purkinje cell ...
To date little attention has focused on the relation between AF and prolongation of the QT interval. Maintenance of AF is dependent on vagal stimulation in multiple model systems, and this dependence is thought to reflect the role of dispersion of refractoriness in the sustained propagation of electrical rotors within the atria.2 Atrial repolarisation has not been extensively studied in the context of long QT syndrome, but in at least one form of the disorder abnormalities of atrial electrophysiology have been documented. In long QT syndrome type 4 (LQT4), caused by mutations in the β-ankyrin gene, affected family members exhibit not only typical ventricular repolarisation abnormalities, but also sinoatrial dysfunction and AF. Recently, Chen and colleagues identified an unusual mutation in the LQT1 potassium channel gene, KCNQ1, that resulted in very early onset AF and long QT syndrome.5 These findings, coupled with the variable sensitivity of the surface ECG in inherited repolarisation ...
Zongming Pan, Tingching Kao, Zsolt Horvath, Julia Lemos, Jai-Yoon Sul, Stephen D Cranstoun, Vann Bennett, Steven S Scherer, Edward C Cooper. J. Neurosci., 2006 Mar 8 , 26, 2599-613. KCNQ (KV7) potassium channels underlie subthreshold M-currents that stabilize the neuronal resting potential and prevent repetitive firing of action potentials. Here, antibodies against four different KCNQ2 and KCNQ3 polypeptide epitopes show these subunits concentrated at the axonal initial segment (AIS) and node of Ranvier. AIS concentration of KCNQ2 and KCNQ3, like that of voltage-gated sodium (NaV) channels, is abolished in ankyrin-G knock-out mice. A short motif, common to KCNQ2 and KCNQ3, mediates both in vivo ankyrin-G interaction and retention of the subunits at the AIS. This KCNQ2/KCNQ3 motif is nearly identical to the sequence on NaV alpha subunits that serves these functions. All identified NaV and KCNQ genes of worms, insects, and molluscs lack the ankyrin-G binding motif. In contrast, vertebrate ...
Interacting selectively and non-covalently with spectrin, a protein that is the major constituent of the erythrocyte cytoskeletal network. It associates with band 4.1 (see band protein) and actin to form the cytoskeletal superstructure of the erythrocyte plasma membrane. It is composed of nonhomologous chains, alpha and beta, which aggregate side-to-side in an antiparallel fashion to form dimers, tetramers, and higher polymers. [GOC:mah, ISBN:0198506732]
The results described above emphasize the importance of ion channels at the AIS, and how their location, biophysical properties, and distribution can be modified by activity. However, how activity directly regulates these AIS properties, and whether the phenomenon of AIS plasticity occurs during normal brain function or only in response to large perturbations in neuronal activity or pathological conditions remains unclear. One strategy to begin to elucidate the mechanisms regulating AIS plasticity is to determine how the AIS is assembled during development and then maintained over an organisms lifetime.. How do ion channels become enriched at the AIS? As described above, the AIS is highly enriched in a variety of ion channels and each interacts with scaffolding proteins that link to the flexible actin/βIV spectrin-based submembranous cytoskeleton (Fig. 1D). Two scaffolding proteins have been identified at the AIS: ankG and PSD-93. PSD-93 binds to the KV1 channels found at the AIS, and ...
Product Pig Ankyrin repeat and BTB/POZ domain containing protein BTBD11(BTBD11) ELISA kit From B-Gene - A competitive ELISA for quantitative measurement of Porcine Ankyrin repeat and BTB/POZ domain containing protein BTBD11(BTBD11) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUTION*1 vial 12. WASH SOLUTION (100 x)*1 vial 13. BALANCE SOLUTION*1 vial 14. INSTRUCTION*1
Nanion offers analysis instruments for ion channel analysis, as patch clamp, impedance and bilayer recordings, used for drug development as cardiac safety and basic research.
These reference sequences exist independently of genome builds. Explain. These reference sequences are curated independently of the genome annotation cycle, so their versions may not match the RefSeq versions in the current genome build. Identify version mismatches by comparing the version of the RefSeq in this section to the one reported in Genomic regions, transcripts, and products above. ...
View mouse Shank2 Chr7:144001928-144424494 with: phenotypes, sequences, polymorphisms, proteins, references, function, expression
Please, confirm that you want to generate a PDF file of this page. This may take some seconds once process has started. Then it will be opened automatically. ...
MTHSPATSEDEERHSASECPEGGSESDSSPDGPGRGPRGTRGQGSGAPGSLASVRGLQGRSMSVPDDAHF 1 - 70 SMMVFRIGIPDLHQTKCLRFNPDATIWTAKQQVLCALSESLQDVLNYGLFQPATSGRDANFLEEERLLRE 71 - 140 YPQSFEKGVPYLEFRYKTRVYKQTNLDEKQLAKLHTKTGLKKFLEYVQLGTSDKVARLLDKGLDPNYHDS 141 - 210 DSGETPLTLAAQTEGSVEVIRTLCLGGAHIDFRARDGMTALHKAACARHCLALTALLDLGGSPNYKDRRG 211 - 280 LTPLFHTAMVGGDPRCCELLLFNRAQLGIADENGWQEIHQACQRGHSQHLEHLLFYGAEPGAQNASGNTA 281 - 350 LHICALYNKETCARILLYRGADKDVKNNNGQTPFQVAVIAGNFELGELIRNHREQDVVPFQESPKYAARR 351 - 420 RGPPGTGLTVPPALLRANSDTSMALPDWMVFSAPGAASSGAPGPTSGSQGQSQPSAPTTKLSSGTLRSAS 421 - 490 SPRGARARSPSRGRHPEDAKRQPRGRPSSSGTPREGPAGGTGGSGGPGGSLGSRGRRRKLYSAVPGRSFM 491 - 560 AVKSYQAQAEGEISLSKGEKIKVLSIGEGGFWEGQVKGRVGWFPSDCLEEVANRSQESKQESRSDKAKRL 561 - 630 FRHYTVGSYDSFDAPSLMDGIGPGSDYIIKEKTVLLQKKDSEGFGFVLRGAKAQTPIEEFTPTPAFPALQ 631 - 700 YLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTRHPDMDEAVHKKA 701 - 770 PQQAKRLPPPTISLRSKSMTSELEEMEYEQQPAPVPSMEKKRTVYQMALNKLDEILAAAQQTISASESPG 771 - 840 ...
Video created by Peking University for the course Advanced Neurobiology I. Lets learn more about the basic unit of the nervous system: the neuron. 2000+ courses from schools like Stanford and Yale - no application required. Build career skills ...
Ankyrin Repeat and SOCS Box Containing 8 Recombinant Protein. The ASB8 solution (0.25mg/ml) contains 20mM Tris-HCl buffer (pH8.0), 0.15M NaCl, 1mM DTT and 10% glycerol.
Shop Ankyrin ELISA Kit, Recombinant Protein and Ankyrin Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
LIAR antibody (ankyrin repeat domain 54) for ELISA, ICC/IF, IHC-P, WB. Anti-LIAR pAb (GTX85269) is tested in Human, Mouse, Rat samples. 100% Ab-Assurance.
Complete information for FANK1 gene (Protein Coding), Fibronectin Type III And Ankyrin Repeat Domains 1, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
Complete information for ANKRD53 gene (Protein Coding), Ankyrin Repeat Domain 53, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
To examine this further, we subtracted the membrane potential in the soma from the membrane potential simultaneously recorded in the axon. Shown here is a plot of membrane potential difference between the axon initial segment and the soma in a layer 5 pyramidal cell during injection of noise into the soma. Note that
Mapping axon initial segment structure and function by multiplexed proximity biotinylation. Hamdan H, Lim BC, Torii T, Joshi A, Konning M, Smith C, Palmer DJ, Ng P, Leterrier C, Oses-Prieto JA, Burlingame AL, Rasband MN. Nat Commun. 2020 Jan 3;11(1):100. doi: 10.1038/s41467-019-13658-5. ...
SHANK3 antibody (SH3/ankyrin domain gene 3) for ICC/IF, IHC-Fr, WB. Anti-SHANK3 pAb (GTX133133) is tested in Mouse, Rat samples. 100% Ab-Assurance.
This antibody pair set comes with matched antibody pair to detect and quantify protein level of human ANKRA2. (H00057763-AP11) - Products - Abnova
description of : ANKFY1 , anti ANKFY1 products, ANKHZN anti-BTBD23 anti-ZFYVE14 and related products to ANKFY1, ANKHZN, BTBD23, ZFYVE14
Opens the Highlight Feature Bar and highlights feature annotations from the FEATURES table of the record. The Highlight Feature Bar can be used to navigate to and highlight other features and provides links to display the highlighted region separately. Links in the FEATURES table will also highlight the corresponding region of the sequence. More... ...
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class=publication>Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href=http://www.nrbook.com/b/bookcpdf.php>Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
MAGTYSSTLKTLEDLTLDSGYGAGDSCRSLSLSSSKSNSQALNSSAQQHRGAAWWCYSGSMNSRHNSWDT 1 - 70 VNTVLPEDPEVADLFSRCPRLPELEEFPWTEGDVARVLRKGAGGRRLPQFSAEAVRRLAGLLRRALIRVA 71 - 140 REAQRLSVLHAKCTRFEVQSAVRLVHSWALAESCALAAVKALSLYSMSAGDGLRRGKSARCGLTFSVGRF 141 - 210 FRWMVDTRISVRIHEYAAISLTACMENLVEEIRARVMASHSPDGGGAGGGEVSAEALEMVINNDAELWGV 211 - 280 LQPYEHLICGKNANGVLSLPAYFSPYNGGSLGHDERADAYAQLELRTLEQSLLATCVGSISELSDLVSRA 281 - 350 MHHMQGRHPLCPGASPARQARQPPQPITWSPDALHTLYYFLRCPQMESMENPNLDPPRMTLNNERPFMLL 351 - 420 PPLMEWMRVAITYAEHRRSLTVDSGDIRQAARLLLPGLDCEPRQLKPEHCFSSFRRLDARAATEKFNQDL 421 - 490 GFRMLNCGRTDLINQAIEALGPDGVNTMDDQGMTPLMYACAAGDEAMVQMLIDAGANLDIQVPSNSPRHP 491 - 560 SIHPDSRHWTSLTFAVLHGHISVVQLLLDAGAHVEGSAVNGGEDSYAETPLQLASAAGNYELVSLLLSRG 561 - 630 ADPLLSMLEAHGMGSSLHEDMNCFSHSAAHGHRNVLRKLLTQPQQAKADVLSLEEILAEGVEESDASSQG 631 - 700 SGSEGPVRLSRTRTKALQEAMYYSAEHGYVDITMELRALGVPWKLHIWIESLRTSFSQSRYSVVQSLLRD 701 - 770 FSSIREEEYNEELVTEGLQLMFDILKTSKNDSVIQQLATIFTHCYGSSPIPSIPEIRKTLPARLDPHFLN 771 - 840 ...
Cookies sind für die korrekte Funktionsweise einer Website wichtig. Um Ihnen eine angenehmere Erfahrung zu bieten, nutzen wir Cookies zum Speichern Ihrer Anmeldedaten, um für sichere Anmeldung zu sorgen, um statistische Daten zur Optimierung der Website-Funktionen zu erheben und um Ihnen Inhalt bereitzustellen, der auf Ihre Interessen zugeschnitten ist. Um fortzufahren stimmen Sie zu, um Cookies zu akzeptieren und direkt zur Website weiter zu navigieren; oder klicken Sie unten auf „Datenschutz, um eine detaillierte Beschreibung der von uns verwendeten Arten von Cookies zu erhalten und um zu entscheiden, ob bestimmte Cookies bei der Nutzung unserer Website gespeichert werden sollen.OKDatenschutzerklärung ...
Cookies sind für die korrekte Funktionsweise einer Website wichtig. Um Ihnen eine angenehmere Erfahrung zu bieten, nutzen wir Cookies zum Speichern Ihrer Anmeldedaten, um für sichere Anmeldung zu sorgen, um statistische Daten zur Optimierung der Website-Funktionen zu erheben und um Ihnen Inhalt bereitzustellen, der auf Ihre Interessen zugeschnitten ist. Um fortzufahren stimmen Sie zu, um Cookies zu akzeptieren und direkt zur Website weiter zu navigieren; oder klicken Sie unten auf „Datenschutz, um eine detaillierte Beschreibung der von uns verwendeten Arten von Cookies zu erhalten und um zu entscheiden, ob bestimmte Cookies bei der Nutzung unserer Website gespeichert werden sollen.OKDatenschutzerklärung ...
Kupte knihu Uber Die Moglichkeit, Koronarsklerose Und Herzinfarkt Zu Verhuten Und Zu Behandeln. Externe Messung Von Herzstruktur Und -Funktion (U) za 2091 Kč v ověřeném obchodě. Prolistujte stránky knihy, přečtěte si recenze čtenářů, nechte si doporučit podobnou knihu z nabídky více než 12 miliónů titulů.
Linksammlung mit Links zu Websites, die Artikel, Beiträge, Filme und ähnliches zu den Themen Venenbehandlung, -therapie und Prävention von Venenleiden enthalten.
Alejandra Consejo; Karolina Gławdecka; Karol Karnowski; Jędrzej Solarski; Jos J. Rozema; Maciej Wojtkowski; D. Robert Iskander ...
Lei Shi; Vithusan Muthukumar; Tanja Stachon; Lorenz Latta; Mohamed Ibrahem Elhawy; Gubesh Gunaratnam; Erika Orosz; Berthold Seitz; Albrecht F. Kiderlen; Markus Bischoff; Nóra ...
They contain multiple ankyrin repeats. The INK4a/ARF/INK4b locus encodes three genes (p15INK4b, ARF, and p16INK4a) in a 35- ... P15 is also formed from four ankyrin repeat (AR) motifs. Expression of P15INK4b is induced by TGF-b indicating its role as a ... P16 is formed from four ankyrin repeat (AR) motifs that exhibit a helix-turn-helix conformation except that the first helix in ...
"ANK2 ankyrin 2 [Homo sapiens (human)] - Gene - NCBI". www.ncbi.nlm.nih.gov. Retrieved 2017-04-06. "KCNE1 potassium voltage- ...
They are derived from natural ankyrin repeat proteins. Repeat proteins are among the most common classes of binding proteins in ... Plückthun, A (2015). "Designed ankyrin repeat proteins (DARPins): binding proteins for research, diagnostics, and therapy". ... soluble and stable proteins from combinatorial libraries of consensus ankyrin repeat proteins". Journal of Molecular Biology. ... "High-affinity binders selected from designed ankyrin repeat protein libraries". Nature Biotechnology. 22 (5): 575-582. doi: ...
They are derived from natural ankyrin repeat proteins, one of the most common classes of binding proteins in nature, which are ... DARPins correspond to the average size of natural ankyrin repeat protein domains. Proteins with fewer than three repeats (i.e ... Mosavi, L. K.; Minor, D. L.; Peng, Z. -Y. (2002). "Consensus-derived structural determinants of the ankyrin repeat motif". ... Simon M, Frey R, Zangemeister-Wittke U, Plückthun A (2013). "rthogonal assembly of a designed ankyrin repeat protein-cytotoxin ...
Ankyrin repeat and zinc finger domain-containing protein 1 is a protein that in humans is encoded by the ANKZF1 gene. ... "Entrez Gene: ANKZF1 ankyrin repeat and zinc finger domain containing 1". Human ANKZF1 genome location and ANKZF1 gene details ...
Binding to ankyrin and to the cytoplasmic domain of band 3". J. Biol. Chem. 263 (21): 10212-8. PMID 2968981. Azim AC, Marfatia ...
Pan X, Lührmann A, Satoh A, Laskowski-Arce MA, Roy CR (June 2008). "Ankyrin repeat proteins comprise a diverse family of ...
"Sodium channel beta subunits mediate homophilic cell adhesion and recruit ankyrin to points of cell-cell contact". The Journal ... sodium channel beta subunits also modulate channel expression and form links to the intracellular cytoskeleton via ankyrin and ... "Structural requirements for interaction of sodium channel beta 1 subunits with ankyrin". The Journal of Biological Chemistry. ...
Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 is a protein that in humans is encoded by the ASZ1 ... "Entrez Gene: ASZ1 ankyrin repeat, SAM and basic leucine zipper domain containing 1". Human ASZ1 genome location and ASZ1 gene ... an evolutionarily conserved gene expressed exclusively in germ cells and encoding a protein with four ankyrin repeats, a ...
Interactions with ankyrin G are important as it is the major organizer in the AIS. The axoplasm is the equivalent of cytoplasm ... Leterrier C, Clerc N, Rueda-Boroni F, Montersino A, Dargent B, Castets F (2017). "Ankyrin G Membrane Partners Drive the ...
"Entrez Gene: ANKRD26 ankyrin repeat domain 26". Entrez Gene: ANKRD26 ankyrin repeat domain 26 "Homo sapiens ankyrin repeat ... Ankyrin repeat domain-containing protein 26 is a protein that in humans is encoded by the ANKRD26 gene. This protein has a ... Ankyrin repeat domain-containing protein 26 is a protein that in humans is encoded by the ANKRD26 gene. ANKRD26 is found on ... Ankyrin repeats are found to mediate protein-protein interactions, and also contains two antiparallel helices, as well as a ...
Additionally, mice with an ankyrin (ankB) knock-out have disrupted calcium homeostasis in the myocardia. Affected mice have ... through direct interactions with protein 4.1 and ankyrin, with the transmembrane ion transporter band 3 Protein 4.2 binds the ...
Ankyrin repeat-containing proteins are secreted through a type I secretion system into the host cell. The precise role of type ... RAGE contains a number of genes including tra genes typical of type IV secretion systems and gene for ankyrin repeat-containing ...
... contains an ankyrin repeat region located near the N-terminus that consists of 6 ankyrin repeats. The protein is ... Ankycorbin is an ankyrin repeat and coiled-coil domain containing protein that in humans is encoded by the RAI14 gene. It is ... only portion that retains some semblance of conservation is the area near the N-terminus that is associated with the ankyrin ...
... the ankyrin repeat domain. A current focus of the group is modification of histones, in particular oxygenase catalysed N- ... catalyses the post-translational hydroxylation of histidinyl residues within ankyrin repeat domains". FEBS Journal. 278 (7): ...
... binds to erythrocyte ankyrin and is colocalized with ankyrin along the basolateral plasma membrane of human gastric parietal ... and BLAST NPBF3 interacts with three other proteins: C1orf19, ankyrin-1 (ANK1) and Ewing sarcoma breakpoint region 1 (EWSR1). ...
... of voltage-gated ion channels is a consequence of plasma-membrane and cytoskeletal associating proteins such as ankyrin. In ...
DARPins (Designed Ankyrin Repeat Proteins), one of the most common binding proteins in nature and responsible for diverse ... In his research group Designed Ankyrin Repeat Proteins (DARPins) were created as a robust alternative scaffold for binding ... proteins (antibody mimetics). DARPins are derived from naturally occurring ankyrin proteins, a protein class that mediates high ...
... (B-cell scaffold protein with ankyrin repeats 1) is a protein-encoding human gene located on chromosome 4 (4q24. Adaptor ... "BANK1 B-cell scaffold protein with ankyrin repeats 1 [ Homo sapiens (human) ]". NIH. 15 January 2014. Retrieved 18 January 2014 ...
Wei H, Karimaa M, Korjamo T, Koivisto A, Pertovaara A (July 2012). "Transient receptor potential ankyrin 1 ion channel ...
Furthermore, substitution of the ankyrin-like repeat in synphilin 1 with an aggresome-targeting signal from huntingtin was ... Analogously, attachment of the ankyrin-like repeat to a huntingtin fragment lacking its aggresome-targeting signal promoted its ... an ankyrin-like repeat domain. On the other hand, formation of multiple small aggregates required an entirely different segment ...
... which are proteins that contain multiple copies of a sequence called ankyrin repeats. By virtue of their ankyrin repeat domains ... IκBs are a family of related proteins that have an N-terminal regulatory domain, followed by six or more ankyrin repeats and a ... Due to the presence of ankyrin repeats in their C-terminal halves, p105 and p100 also function as IκB proteins. The c-terminal ... mediated by the ubiquitin/proteasome pathway and involves selective degradation of their C-terminal region containing ankyrin ...
SOWAHD - Sosondowah Ankyrin repeat domain family member D. It is located on chromosome X and predicted to localize in the ...
Huang Y, Chen SR, Chen H, Pan HL (May 2019). "Endogenous transient receptor potential ankyrin 1 and vanilloid 1 activity ...
... and proteoglycans or intracellular proteins like ankyrins.[citation needed] The pathfinding defect occurs via the association ...
Ovalocyte band 3 binds more tightly than normal band 3 to ankyrin, which connects the membrane skeleton to the band 3 anion ... Band 3 serves as the principal binding site for the membrane skeleton, a submembrane protein network composed of ankyrin, ...
A 2009 review describes work in modeling and verifying simulations of proteins such as titin, fibrinogen, ankyrin, and cadherin ...
RFX ankyrin repeats (RFXANK; also known as RFXB) BLS I, also called "HLA class I deficiency", which is much more rare, is ...
September 2020). "Transient Receptor Potential Ankyrin 1 Is Up-Regulated in Response to Lipopolysaccharide via P38/Mitogen- ...
... actin and spectrin that are held together by ankyrin. Shape change of erythrocytes under applied forces (i.e., shear forces in ...
Ankyrins are a family of proteins that are believed to link the integral membrane proteins to the underlying spectrin-actin ... Background of Ankyrin-1 antibody. Ankyrins are a family of proteins that are believed to link the integral membrane proteins to ... Most ankyrins are typically composed of three structural domains: an amino-terminal domain containing multiple ankyrin repeats ... Ankyrin 1, the prototype of this family, was first discovered in the erythrocytes, but since has also been found in brain and ...
2.12 Research: AIS and Ankyrin G. To view this video please enable JavaScript, and consider upgrading to a web browser that ...
Unique Serine-rich and Tail Domains of 270-kD AnkyrinG Contribute to Restriction of AnkyrinG at Axon Proximal Segments. Ankyrin ... Ank3 (epithelial ankyrin), a widely distributed new member of the ankyrin gene family and the major ankyrin in kidney, is ... Ank3 (epithelial ankyrin), a widely distributed new member of the ankyrin gene family and the major ankyrin in kidney, is ... Distribution of 270/ 480-kD native ankyrinG, ankyrinB, spectrin, and neurofascin in cultured DRG neurons. 270/480-kD ankyrinG ( ...
The principal adaptors are the ankyrin proteins, which bind to the beta-subunit of spectrin and to the cytoplasmic domains of ... Here, we present the crystal structure of the ankyrin-binding domain of human beta2-spectrin at 1.95 A resolution together with ... Localization and structure of the ankyrin-binding site on beta2-spectrin.. J Biol Chem. 284(11):6982-7. doi: 10.1074/jbc. ... mutagenesis data identifying the binding surface for ankyrins on beta2-spectrin. ...
Ankyrins: a missing molecular link in mechanical senses. Ankyrins: a missing molecular link in mechanical senses. Published on ... UNC-44 is the worm version of a protein family called ankyrins. Ankyrins are elastic filamentous proteins that interact with ... How CIB and ankyrin (ANK) may link mechanotransduction ion channels (TMC) to the cytoskeleton to sense touch and sound. ... This suggests that CALM-1 acts as an adaptor to link the gating spring ankyrin to the channel, completing the chain link from ...
Here, through the use of domain-specific peptide antibodies, we report the presence of the small ankyrins in rat and rabbit ... When expressed in transfected HEK 293 cells, the small ankyrins are distributed in a reticular pattern resembling the ER if the ... Mice homozygous for the normoblastosis mutation (gene symbol nb) are deficient in the 210-kD ankyrin but contain normal levels ... These results suggest that the small ankyrins are integral membrane proteins of the sarcoplasmic reticulum. We propose that, ...
Ankyrin Repeat, Family A (RFXANK-Like), 2, ANKRA, RFXANK-Like Protein 2, Ankyrin Repeat Family A Protein 2, ANKRA2. ... Ankyrin Repeat Family A2, also known as ANKRA2 contains 5 ANK repeats. ANKRA2 assist endocytosis by linking megalin to ...
Ankyrin repeat domain 33 is a protein that in humans is encoded by the ANKRD33 gene. GRCh38: Ensembl release 89: ... "Entrez Gene: Ankyrin repeat domain 33". Retrieved 2018-04-17. CS1 maint: discouraged parameter (link) v t e. ...
KN motif and ankyrin repeat domains 4 is a protein that in humans is encoded by the KANK4 gene. GRCh38: Ensembl release 89: ... "Entrez Gene: KN motif and ankyrin repeat domains 4". Retrieved 2017-09-07. v t e. ...
Ankyrin repeat domain 11 is a protein that in humans is encoded by the ANKRD11 gene.[5] ... ANKRD11, ANCO-1, ANCO1, LZ16, T13, ankyrin repeat domain 11. External IDs. OMIM: 611192 MGI: 1924337 HomoloGene: 69134 ... This locus encodes an ankyrin repeat domain-containing protein. The encoded protein inhibits ligand-dependent activation of ... "Characterization of transcriptional regulatory domains of ankyrin repeat cofactor-1". Biochem. Biophys. Res. Commun. 358 (4): ...
Ankyrin-B syndrome is associated with a variety of heart problems related to disruption of the hearts normal rhythm ( ... Ankyrin-B syndrome is caused by mutations in the ANK2 gene, which provides instructions for making a protein called ankyrin-B. ... Ankyrin-B syndrome is inherited in an autosomal dominant pattern. , which means one copy of the altered ANK2 gene in each cell ... Ankyrin-B syndrome: a case of sinus node dysfunction, atrial fibrillation and prolonged QT in a young adult. Heart Lung Circ. ...
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
Ankyrin repeat (IPR002110). Short name: Ankyrin_rpt Description. The ankyrin repeat is one of the most common protein-protein ... The ankyrin fold appears to be defined by its structure rather than its function since there is no specific sequence or ... Ankyrin repeats are tandemly repeated modules of about 33 amino acids. They occur in a large number of functionally diverse ... Hundreds of ankyrin-like repeats in functionally diverse proteins: mobile modules that cross phyla horizontally?. Proteins 17 ...
Death_ank3; Death domain of Ankyrin-3. cd00204. Location:62 → 187. ANK; ankyrin repeats; ankyrin repeats mediate protein- ... Death_ank3; Death domain of Ankyrin-3. cd00204. Location:51 → 176. ANK; ankyrin repeats; ankyrin repeats mediate protein- ... Death_ank3; Death domain of Ankyrin-3. cd00204. Location:68 → 193. ANK; ankyrin repeats; ankyrin repeats mediate protein- ... Death_ank3; Death domain of Ankyrin-3. cd00204. Location:68 → 193. ANK; ankyrin repeats; ankyrin repeats mediate protein- ...
Ank_2; Ankyrin repeats (3 copies). pfam13637. Location:75 → 128. Ank_4; Ankyrin repeats (many copies). ... Ank_2; Ankyrin repeats (3 copies). pfam13637. Location:75 → 128. Ank_4; Ankyrin repeats (many copies). ... ANKRD49 ankyrin repeat domain 49 [Homo sapiens] ANKRD49 ankyrin repeat domain 49 [Homo sapiens]. Gene ID:54851 ... ankyrin repeat domain 49provided by HGNC. Primary source. HGNC:HGNC:25970 See related. Ensembl:ENSG00000168876 Gene type. ...
Ankyrin-3 isoform X26Imported. ,p>Information which has been imported from another database using automatic procedures.,/p> ,p ... IPR040745 Ankyrin_UPA. IPR011029 DEATH-like_dom_sf. IPR000488 Death_domain. IPR000906 ZU5_dom. ... IPR040745 Ankyrin_UPA. IPR011029 DEATH-like_dom_sf. IPR000488 Death_domain. IPR000906 ZU5_dom. ... tr,A0A480SDG8,A0A480SDG8_PIG Ankyrin-3 isoform X26 OS=Sus scrofa OX=9823 PE=4 SV=1 ...
... Niaz Mahmood1 and Nahid Tamanna2 ... Ankyrin (ANK) repeat containing proteins are evolutionary conserved and have functions in crucial cellular processes like cell ...
IPR002110. Ankyrin_rpt. IPR020683. Ankyrin_rpt-contain_dom. IPR036770. Ankyrin_rpt-contain_sf. ... IPR002110. Ankyrin_rpt. IPR020683. Ankyrin_rpt-contain_dom. IPR036770. Ankyrin_rpt-contain_sf. ... AnkyrinImported. ,p>Information which has been imported from another database using automatic procedures.,/p> ,p>,a href="/ ... tr,P97582,P97582_RAT Ankyrin (Fragment) OS=Rattus norvegicus GN=Ank2 PE=2 SV=1 ...
Tam H.K., Malviya V.N., Pos K.M. (2018) High-Resolution Crystallographic Analysis of AcrB Using Designed Ankyrin Repeat ... High-Resolution Crystallographic Analysis of AcrB Using Designed Ankyrin Repeat Proteins (DARPins). ... High-affinity binders selected from designed ankyrin repeat protein libraries. Nat Biotechnol 22:575-582CrossRefPubMedGoogle ... soluble and stable proteins from combinatorial libraries of consensus ankyrin repeat proteins. J Mol Biol 332:489-503CrossRef ...
Compare Ankyrin repeat domain 12 ELISA Kits from leading suppliers on Biocompare. View specifications, prices, citations, ... Ankyrin repeat domain 12 ELISA Kits. The ELISA (enzyme-linked immunosorbent assay) is a widely used application for detecting ... Your search returned 20 Ankyrin repeat domain 12 ELISA ELISA Kit across 6 suppliers. ...
The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex assemblies. As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
... uses its ankyrin repeat clusters (ARCs) to bind a wide range of proteins and thereby controls diverse cellular functions. A ... Tankyrase-1 Ankyrin Repeats Form an Adaptable Binding Platform for Targets of ADP-Ribose Modification. Structure 24, 1679-1692 ... Pollock, K., Liu, M., Zaleska, M. et al. Fragment-based screening identifies molecules targeting the substrate-binding ankyrin ... The PARP enzyme and scaffolding protein tankyrase (TNKS, TNKS2) uses its ankyrin repeat clusters (ARCs) to bind a wide range of ...
Ankyrin Repeat. Protein Motif that contains a 33-amino acid long sequence that often occurs in tandem arrays. This repeating ... Ankyrin repeats cooperatively fold into domains that mediate molecular recognition via protein-protein interactions. ... sequence of 33-Amino Acids was discovered in Ankyrin where it is involved in interaction with the anion exchanger (Anion ...
Compare Ankyrin repeat domain 29 ELISA Kits from leading suppliers on Biocompare. View specifications, prices, citations, ... Ankyrin repeat domain 29 ELISA Kits. The ELISA (enzyme-linked immunosorbent assay) is a well-established antibody-based tool ... Your search returned 13 Ankyrin repeat domain 29 ELISA ELISA Kit across 1 supplier. ...
X-ray structural analysis of the yeast cell cycle regulator Swi6 reveals variations of the ankyrin fold and has implications ...
Our findings introduce what we believe to be a new pathway for ACM, a role of ankyrin-B in cardiac structure and signaling, a ... Following identification of deceased ACM probands possessing ANK2 rare variants and evidence of ankyrin-B loss of function on ... Ankyrin-B dysfunction predisposes to arrhythmogenic cardiomyopathy and is amenable to therapy. ... Ankyrin-B dysfunction predisposes to arrhythmogenic cardiomyopathy and is amenable to therapy. ...
... ankyrin repeat explanation free. What is ankyrin repeat? Meaning of ankyrin repeat medical term. What does ankyrin repeat mean? ... Looking for online definition of ankyrin repeat in the Medical Dictionary? ... ankyrin repeat. Also found in: Wikipedia. ankyrin repeat. A short repetitive sequence of amino acids consisting of a beta ... Ankyrin repeats were first identified in ankyrin, which tethers different proteins (e.g., nuclear and cytoplasmic proteins), ...
There are no specific protocols for Anti-Ankyrin brain antibody [N105/13] (ab131419). Please download our general protocols ...
Specifically, we generated knockin mice that express either the human ankyrin-B variant R1788W, which is present in 0.3% of ... Ankyrin-B metabolic syndrome combines age-dependent adiposity with pancreatic β cell insufficiency. ... Ankyrin-B metabolic syndrome combines age-dependent adiposity with pancreatic β cell insufficiency. ... GLUT4 trafficking was altered in animals expressing mutant forms of ankyrin-B, and we propose that increased cell surface ...
Diversity in membrane binding sites of ankyrins. Brain ankyrin, erythrocyte ankyrin, and processed erythrocyte ankyrin ... Diversity in membrane binding sites of ankyrins. Brain ankyrin, erythrocyte ankyrin, and processed erythrocyte ankyrin ... Moreover, analysis of rat 190-kDa ankyrin G/ankyrin B chimeras shows that all three domains of 190-kDa ankyrin-G are required ... Ankyrins G and B also exhibit differences; mutations affecting spectrin binding had no effect on ankyrin-B function but did ...
Browse our Ankyrin Repeat Domain 33B product catalog backed by our Guarantee+. ... Ankyrin Repeat Domain 33B products available through Novus Biologicals. ... Bioinformatics Tool for Ankyrin Repeat Domain 33B. Discover related pathways, diseases and genes to Ankyrin Repeat Domain 33B. ...
Homo sapiens (human) : ANKRD13C (ankyrin repeat domain 13C) HGNC Alliance Rattus norvegicus (Norway rat) : Ankrd13c (ankyrin ... Pan paniscus (bonobo/pygmy chimpanzee) : ANKRD13C (ankyrin repeat domain 13C) Canis lupus familiaris (dog) : ANKRD13C (ankyrin ... Sus scrofa (pig) : ANKRD13C (ankyrin repeat domain 13C) Chlorocebus sabaeus (green monkey) : ANKRD13C (ankyrin repeat domain ... Ankrd13c (ankyrin repeat domain 13C). Transitive Ortholog Pipeline. Transitive Ortholog Pipeline. Sus scrofa (pig):. ANKRD13C ( ...
SHANK2, SH3 and multiple ankyrin repeat domains 2. Orthology source: HomoloGene, HGNC ...
In our study we showed spectrin doesnt have to bind to ankyrin to d...,Ghost,protein,leaves,fresh,tracks,in,the,cell, ... Spectrin and ankyrin are two essential proteins acting like bricks and...Ron Dubreuil associate professor of biological ... Spectrin and ankyrin are two essential proteins acting like bricks and mortar to shape and fortify cell membranes. But ... "In our study, we showed spectrin doesnt have to bind to ankyrin to do its job," said Dubreuil. "This hints at a complexity we ...
offers a broad range of Ankyrin CRISPR/Cas9 Knockout plasmids and Ankyrin Double Nickase Plasmids. ... Ankyrin gene silencers are available as Ankyrin CRISPR/Cas9 Knockout plasmids and Ankyrin Double Nickase Plasmids. Ankyrin ... Ankyrin Antibodies for analysis of cellular responses to Ankyrin CRISPR Products * For further details describing the CRISPR ... Ankyrin G CRISPR Activation Plasmid (h2) sc-400421-ACT-2. h. Gene Activation. Puro, Blast, Hygro. ...
2). The two DARPins E40 and pE59 in the complex have the expected ankyrin repeat domain fold (Fig. 2 and Fig. 3A). The ... 2003) Designed to be stable: Crystal structure of a consensus ankyrin repeat protein. Proc Natl Acad Sci USA 100:1700-1705. ... 2010) Designed ankyrin repeat proteins: A novel tool for testing epidermal growth factor receptor 2 expression in breast cancer ... 2012) Designed Ankyrin Repeat Proteins (DARPins) as novel isoform-specific intracellular inhibitors of c-Jun N-terminal kinases ...
... binding site maps to the N-terminal part of the ankyrin-binding domain of β-spectrin (ankBDn). Here we have identified the ... but its residual PE/PC-binding activity was insensitive to inhibition with ankyrin. Structure prediction and analysis, ... It was shown previously that an ankyrin-sensitive, phosphatidylethanolamine/phosphatidylcholine (PE/PC) ...
  • We have recently found that the erythroid ankyrin gene, Ank1, expresses isoforms in mouse skeletal muscle, several of which share COOH-terminal sequence with previously known Ank1 isoforms but have a novel, highly hydrophobic 72-amino acid segment at their NH2 termini. (jax.org)
  • UNC-44 is the worm version of a protein family called ankyrins. (cam.ac.uk)
  • A conclusion is that multiple ankyrin G -specific domains, in addition to the conserved membrane-binding domain, contribute to restriction of ankyrin G to the axonal plasma membrane in dorsal root ganglion neurons. (rupress.org)
  • Ankyrins are a family of proteins that are believed to link the integral membrane proteins to the underlying spectrin-actin cytoskeleton and play key roles in activities such as cell motility, activation, proliferation, contact and the maintenance of specialized membrane domains. (acris-antibodies.com)
  • Multiple isoforms of ankyrin with different affinities for various target proteins are expressed in a tissue-specific, developmentally regulated manner. (acris-antibodies.com)
  • The mechanisms responsible for concentrating sodium channels in these specialized membrane domains in axons are not established, but are likely to involve specialized members of the ankyrin family of spectrin-binding proteins. (rupress.org)
  • The principal adaptors are the ankyrin proteins, which bind to the beta-subunit of spectrin and to the cytoplasmic domains of numerous integral membrane proteins. (scienceexchange.com)
  • Ankyrins are elastic filamentous proteins that interact with the cytoskeleton and therefore show the expected properties of a gating spring for mechanotransduction. (cam.ac.uk)
  • Immunoblots of the proteins isolated with rabbit sarcoplasmic reticulum indicate that the small ankyrins are highly enriched in this fraction. (jax.org)
  • These results suggest that the small ankyrins are integral membrane proteins of the sarcoplasmic reticulum. (jax.org)
  • The ankyrin G -specific spectrin-binding and tail domains are capable of binding directly to sites on the plasma membrane of neuronal cell bodies and axon proximal segments, and presumably have yet to be identified docking sites. (rupress.org)
  • Ankyrin G (−/−) neurons fail to concentrate voltage-sensitive sodium channels and neurofascin at their axon proximal segments, suggesting that ankyrin G is a key component of a structural pathway involved in assembly of specialized membrane domains at axon proximal segments and possibly nodes of Ranvier (Zhou, D., S. Lambert, D.L. Malen, S. Carpenter, L. Boland, and V. Bennett, manuscript submitted for publication). (rupress.org)
  • The membrane-binding, spectrin-binding, and tail domains of ankyrin G also contribute to limiting the lateral mobility of ankyrin G -neurofascin complexes. (rupress.org)
  • Localization and structure of the ankyrin-binding site on beta2-spectrin. (scienceexchange.com)
  • Here, we present the crystal structure of the ankyrin-binding domain of human beta2-spectrin at 1.95 A resolution together with mutagenesis data identifying the binding surface for ankyrins on beta2-spectrin. (scienceexchange.com)
  • In frozen sections of rat skeletal muscle, antibodies to the spectrin-binding domain (anti-p65) react only with a 210-kD Ank1 and label the sarcolemma and nuclei, while antibodies to the COOH terminus of the small ankyrin (anti-p6) react with peptides of 20 to 26 kD on immunoblots and decorate the myoplasm in a reticular pattern. (jax.org)
  • Ankyrin Repeat Family A2, also known as ANKRA2 contains 5 ANK repeats. (prospecbio.com)
  • This suggests that CALM-1 acts as an adaptor to link the gating spring ankyrin to the channel, completing the chain link from cytoskeleton to ion channel. (cam.ac.uk)
  • Mutations in erythrocytic ankyrin 1 have been associated in approximately half of all patients with hereditary spherocytosis. (acris-antibodies.com)
  • Alternative polyadenylation accounting for the different sized erythrocytic ankyrin 1 mRNAs, has also been reported. (acris-antibodies.com)
  • Complex patterns of alternative splicing in the regulatory domain, giving rise to different isoforms of ankyrin 1 have been described, however, the precise functions of the various isoforms are not known. (acris-antibodies.com)
  • The serine-rich domain, which is present only in 480- and 270-kD ankyrin G polypeptides, contributes to restriction of ankyrin G to axon proximal segments as well as limiting lateral diffusion of ankyrin G -neurofascin complexes. (rupress.org)
  • Here, through the use of domain-specific peptide antibodies, we report the presence of the small ankyrins in rat and rabbit skeletal muscle and demonstrate their selective association with the sarcoplasmic reticulum. (jax.org)
  • When expressed in transfected HEK 293 cells, the small ankyrins are distributed in a reticular pattern resembling the ER if the NH2-terminal hydrophobic domain is present, but they are uniformly distributed in the cytosol if this domain is absent. (jax.org)
  • This paper addresses the mechanism for restriction of 270-kD ankyrin G to axon proximal segments by evaluation of localization of GFP-tagged ankyrin G constructs transfected into cultured dorsal root ganglion neurons, as well as measurements of fluorescence recovery after photobleaching of neurofascin- GFP-tagged ankyrin G complexes in nonneuronal cells. (rupress.org)
  • Immunoblot against crude membranes from adult rat brain (RBM) and wild-type (WT) and Ankyrin-R knockout (KO) mouse brains probed with N388A/60 (left) and K58/35 (right) TC supe. (acris-antibodies.com)
  • Truncated muscle-specific isoforms of ankyrin 1 resulting from usage of an alternate promoter have also been identified. (acris-antibodies.com)
  • This complex behavior explains ability of ankyrin B and ankyrin G to sort to distinct sites in neurons and the fact that these ankyrins do not compensate for each other in ankyrin gene knockouts in mice. (rupress.org)
  • Mice homozygous for the normoblastosis mutation (gene symbol nb) are deficient in the 210-kD ankyrin but contain normal levels of the small ankyrins in the myoplasm. (jax.org)
  • Small, membrane-bound, alternatively spliced forms of ankyrin 1 associated with the sarcoplasmic reticulum of mammalian skeletal muscle. (jax.org)
  • Ankyrin 1, the prototype of this family, was first discovered in the erythrocytes, but since has also been found in brain and muscles. (acris-antibodies.com)
  • Biopharmaceutical company Cubist Pharmaceuticals Inc (NASDAQ:CBST) and Hydra Biosciences Inc announced on Tuesday the joint proposal to commence a Phase 1 clinical study for a small molecule antagonist of the human Transient Receptor Potential Ankyrin repeat 1 (TRPA1) ion channel. (thefreedictionary.com)
  • today announced plans to begin a Phase 1 clinical trial for a small molecule antagonist of the human Transient Receptor Potential Ankyrin repeat 1 (TRPA1) ion channel discovered in a collaboration between Cubist and Hydra. (thefreedictionary.com)
  • Thymol activates human transient receptor potential family Ankyrin subtype 1 (hTRPA1) and modulates the thermo-transient receptor potential (thermoTPP) (4,5). (thefreedictionary.com)
  • A distinct role for transient receptor potential ankyrin 1, in addition to transient receptor potential vanilloid 1, in tumor necrosis factor a-induced inflammatory hyperalgesia and Freund's complete adjuvant-induced monarthritis. (thefreedictionary.com)
  • Transient receptor potential vanilloid 4 (TRPV4) and transient receptor potential ankyrin 1 (TRPA1) have already been main focuses for comparatively mature studies currently. (thefreedictionary.com)
  • Other studies show that transient receptor potential vanilloid 1 (TRPV1) and ankyrin 1 (TRPA1), heat and cold sensors, respectively (Andrade et al. (thefreedictionary.com)
  • Ji, "Oxidative stress induces itch via activation of transient receptor potential subtype ankyrin 1 in mice," Neuroscience Bulletin, vol. (thefreedictionary.com)
  • Transient Receptor Potential Ankyrin 1 Enhances Ovalbumin-Induced Acute Allergic Inflammation in Murine Models. (bioportfolio.com)
  • Transient receptor potential ankyrin 1 (TRPA1) is an ion channel known to mediate nociception and neurogenic inflammation, and to be activated by reactive oxygen and nitrogen species (ROS and RNS) produced at the sites of inflammation. (bioportfolio.com)
  • Transient Receptor Potential Ankyrin-1 (TRPA1) Channel Contributes to Myocardial Ischemia-Reperfusion Injury. (bioportfolio.com)
  • Ionic channels such as the transient receptor potential ankyrin 1 (TRPA1) are essential for the detection and transmission of painful stimuli. (bioportfolio.com)
  • In particular, one type of sensor named Transient Receptor Potential Ankyrin 1 (TRPA1) is studied. (lu.se)
  • Transient receptor potential ankyrin 1 (TRPA1) is coexpressed with TRPV1. (aspetjournals.org)
  • Based on response to the transient receptor potential ankyrin 1 antagonists after plantar incision, we hypothesized that H 2 O 2 exerts nociceptive effects via the transient receptor potential ankyrin 1 in muscle. (asahq.org)
  • These H 2 O 2 -induced behaviors were blocked by transient receptor potential ankyrin 1 antagonists. (asahq.org)
  • Nociceptive time after intramuscular H 2 O 2 in transient receptor potential ankyrin 1 knockout mice was shorter (173 ± 156 s) compared with wild-type mice (931 ± 629 s). (asahq.org)
  • Transient receptor potential ankyrin 1 (TRPA1) channel plays an important role in pain and inflammation. (biomedcentral.com)
  • The role of the transient receptor potential ankyrin type-1 (TRPA1) channel in migraine pain: evaluation in an animal model. (physiciansweekly.com)
  • Clinical and experimental studies have pointed to the possible involvement of the transient receptor potential ankyrin type-1 (TRPA1) channels in migraine pain. (physiciansweekly.com)
  • The transient receptor potential ankyrin 1 (TRPA1) is a calcium-permeable cation channel that is expressed on capsaicin-sensitive sensory neurons, endothelial and inflammatory cells. (biomedcentral.com)
  • o-Chlorobenzylidene malononitrile (CS) is a selective and potent agonist of the transient receptor potential ankyrin repeat 1 (TRPA1), which is a transducer molecule in nociceptors sensing reactive chemical species. (ovid.com)
  • Spinal transient receptor potential ankyrin 1 channel induces mechanical hypersensitivity, increases cutaneous blood flow, and mediates the pronociceptive action of dynorphin A. (painresearchforum.org)
  • However, because additional heart problems can result from changes in the same gene, long QT syndrome 4 is usually considered part of ankyrin-B syndrome. (medlineplus.gov)
  • Not everyone with an ANK2 gene mutation has heart problems related to ankyrin-B syndrome. (medlineplus.gov)
  • Ankyrin 3 is an immunologically distinct gene product from ankyrins 1 and 2, and was originally found at the axonal initial segment and nodes of Ranvier of neurons in the central and peripheral nervous systems. (nih.gov)
  • Ankyrin gene silencers are available as Ankyrin CRISPR/Cas9 Knockout plasmids and Ankyrin Double Nickase Plasmids. (scbt.com)
  • Ankyrin CRISPR/dCas9 Activation Plasmids and CRISPR Lenti Activation Systems for gene activation are also available. (scbt.com)
  • The AFLP2 fragment showed a significant level of similarity with the porcine ankyrin repeat domain 16 (ANKRD16) gene (GenBank accession no. (thefreedictionary.com)
  • Defects of the ankyrin-1 gene are the most common cause in humans of hereditary spherocytosis, an inherited anemia that affects patients of all ethnic groups. (luriechildrens.org)
  • In some kindreds, linked -108/-153 nucleotide substitutions have been found in the upstream region of the ankyrin gene promoter that is active in erythroid cells. (luriechildrens.org)
  • In transgenic mice, flanking a mutant -108/-153 ankyrin gene promoter with the well-characterized chicken HS4 barrier insulator restored position-independent, uniform expression at levels comparable to wild-type. (luriechildrens.org)
  • Ankyrin-2 or -Ankyrin-B is encoded by the gene ANK2. (antibodiesinc.com)
  • This complex behavior explains ability of ankyrin B and ankyrin G to sort to distinct sites in neurons and the fact that these ankyrins do not compensate for each other in ankyrin gene knockouts in mice. (rupress.org)
  • Important and extensively investigated are TRP vanilloid 1 (TRPV1) and TRP ankyrin 1 (TRPA1). (aspetjournals.org)
  • Here, we demonstrate based on Förster resonance energy transfer (FRET) and bilayer patch-clamp studies, a direct calmodulin-independent action of calcium on the purified human TRPA1 (hTRPA1), causing structural changes and activation without immediate subsequent desensitization of hTRPA1 with and without its N-terminal ankyrin repeat domain (N-ARD). (nanion.de)
  • There are currently no images for Ankyrin Brain Antibody (NBP2-22407IR). (novusbio.com)
  • Ankyrin antibody LS-C710038 is an HRP-conjugated rabbit polyclonal antibody to human Ankyrin (ANK1) (aa32-369). (lsbio.com)
  • Following identification of deceased ACM probands possessing ANK2 rare variants and evidence of ankyrin-B loss of function on cardiac tissue analysis, an ANK2 mouse model was found to develop dramatic structural abnormalities reflective of human ACM, including biventricular dilation, reduced ejection fraction, cardiac fibrosis, and premature death. (jci.org)
  • This study has resolved intermediate stages in the developmental transition from a continuous distribution of ankyrin G 480/270 kDa in all axons to a highly polarized localization at the node of Ranvier in the developing rat sciatic nerve. (jneurosci.org)
  • We identify aspartate-histidine-histidine-cysteine 5/8 (DHHC5/8) as ankyrin-G palmitoyltransferases required for ankyrin-G lateral membrane localization and for assembly of lateral membranes. (rupress.org)
  • We also find that βII-spectrin functions as a coincidence detector that requires recognition of both ankyrin-G and phosphoinositide lipids for its lateral membrane localization. (rupress.org)
  • Here, we provide evidence that Nup358 associates selectively with the axon initial segment (AIS) of mature neurons and mediated by the AIS scaffold ankyrin-G. The N-terminus of Nup358 is found to be sufficient for its localization at the AIS. (biologists.org)
  • We now report that nuclear localization of Ikappa Balpha is mediated by a novel nuclear import sequence within the second ankyrin repeat. (caltech.edu)
  • This paper addresses the mechanism for restriction of 270-kD ankyrin G to axon proximal segments by evaluation of localization of GFP-tagged ankyrin G constructs transfected into cultured dorsal root ganglion neurons, as well as measurements of fluorescence recovery after photobleaching of neurofascin- GFP-tagged ankyrin G complexes in nonneuronal cells. (rupress.org)
  • Localization and structure of the ankyrin-binding site on beta2-spectrin. (scienceexchange.com)
  • Truncated muscle-specific isoforms of ankyrin 1 resulting from usage of an alternate promoter have also been identified. (acris-antibodies.com)
  • The cytoplasmic domains of neurofascin contains a highly conserved sequence (F1315IGQY) that binds ankyrin. (reactome.org)
  • This suggests that CALM-1 acts as an adaptor to link the gating spring ankyrin to the channel, completing the chain link from cytoskeleton to ion channel. (cam.ac.uk)
  • Ankyrin-G isoform imbalance and interneuronopathy link epilepsy and bipolar disorder. (nih.gov)
  • Before myelination in embryonic nerves, ankyrin G 480/270 kDa and the related ankyrin isoform ankyrin B 440 kDa are co-expressed along with NrCAM in an abundant, continuous distribution along the length of axons. (jneurosci.org)
  • Mutations in erythrocytic ankyrin 1 have been associated in approximately half of all patients with hereditary spherocytosis. (acris-antibodies.com)
  • This constellation of traits is known as ankyrin-B syndrome, which may have important implications for humans possessing functional ankyrin-B mutations. (duke.edu)
  • Clustering of neurofascin and NrCAM precedes redistribution of ankyrin G 480/270 kDa and the voltage-dependent sodium channel, suggesting that the adhesion molecules define the initial site for subsequent assembly of ankyrin and the voltage-dependent sodium channel. (jneurosci.org)
  • Ankyrin G (−/−) neurons fail to concentrate voltage-sensitive sodium channels and neurofascin at their axon proximal segments, suggesting that ankyrin G is a key component of a structural pathway involved in assembly of specialized membrane domains at axon proximal segments and possibly nodes of Ranvier (Zhou, D., S. Lambert, D.L. Malen, S. Carpenter, L. Boland, and V. Bennett, manuscript submitted for publication). (rupress.org)
  • The membrane-binding, spectrin-binding, and tail domains of ankyrin G also contribute to limiting the lateral mobility of ankyrin G -neurofascin complexes. (rupress.org)
  • Here we show that ankyrin-B, expressed by Schwann cells, and ankyrin-G, expressed by oligodendrocytes, are highly enriched at the glial side of paranodal junctions where they interact with the essential glial junctional component neurofascin 155. (mysciencework.com)
  • Title: L1 coupling to ankyrin and the spectrin-actin cytoskeleton modulates ethanol inhibition of L1 adhesion and ethanol teratogenesis. (nih.gov)
  • In people with ankyrin-B syndrome, arrhythmia can lead to fainting (syncope) or cardiac arrest and sudden death. (medlineplus.gov)
  • Our findings introduce what we believe to be a new pathway for ACM, a role of ankyrin-B in cardiac structure and signaling, a molecular link between ankyrin-B and β-catenin, and evidence for targeted activation of the WNT/β-catenin pathway as a potential treatment for this disease. (jci.org)
  • Rare functional variants of ankyrin-B have been implicated in human disease, including hereditary cardiac arrhythmia and type 2 diabetes (T2D). (jci.org)
  • Studies in the ankyrin-B+/- mouse reveal that ankyrin-B deficiency is associated with both the benefits of enhanced cardiac contractility and the costs of arrhythmia, early senescence, reduced lifespan, and impaired glucose tolerance. (duke.edu)
  • We found that ankyrin-B variants are surprisingly common, ranging from 2 percent of European individuals to 8 percent in individuals from West Africa. (duke.edu)
  • Functional characterization of these animals will allow us to better understand the relationship between human ankyrin-B variants and ankyrin-B syndrome. (duke.edu)
  • Interestingly, unlike the spherical nature of ankyrin-deficient erythrocytes, the cellular morphology of an ankB mutant was identical to that of wild-type bacteria, yet the mutant produced more membrane vesicles. (asm.org)
  • The structure reveals a substantial interface between ankyrin polypeptides, showing a high degree of shape and charge complementarity, which may be related to homotypic interactions suggested from indirect studies. (elsevier.com)
  • Ankyrin serves as the mortar that attaches spectrin to the red blood cell membrane. (bio-medicine.org)
  • Biochemical experiments in cells isolated from mouse embryos show that ankyrin-B recognizes vesicles containing specific phosphoinositide lipids and attaches to them. (elifesciences.org)
  • Ankyrin 1, the prototype of this family, was first discovered in the erythrocytes, but since has also been found in brain and muscles. (acris-antibodies.com)
  • Immunoblot against crude membranes from adult rat brain (RBM) and wild-type (WT) and Ankyrin-R knockout (KO) mouse brains probed with N388A/60 (left) and K58/35 (right) TC supe. (acris-antibodies.com)
  • Also known as Ankyrin-2 (ANK-2) (Ankyrin-B) (Brain ankyrin). (mybiosource.com)
  • Ankyrin B is expressed in brain and muscle. (antibodiesinc.com)