A family of membrane-associated proteins responsible for the attachment of the cytoskeleton. Erythrocyte-related isoforms of ankyrin attach the SPECTRIN cytoskeleton to a transmembrane protein (ANION EXCHANGE PROTEIN 1, ERYTHROCYTE) in the erythrocyte plasma membrane. Brain-related isoforms of ankyrin also exist.
A high molecular weight (220-250 kDa) water-soluble protein which can be extracted from erythrocyte ghosts in low ionic strength buffers. The protein contains no lipids or carbohydrates, is the predominant species of peripheral erythrocyte membrane proteins, and exists as a fibrous coating on the inner, cytoplasmic surface of the membrane.
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.
Protein motif that contains a 33-amino acid long sequence that often occurs in tandem arrays. This repeating sequence of 33-amino acids was discovered in ANKYRIN where it is involved in interaction with the anion exchanger (ANION EXCHANGE PROTEIN 1, ERYTHROCYTE). Ankyrin repeats cooperatively fold into domains that mediate molecular recognition via protein-protein interactions.
The genetic complement of an organism, including all of its GENES, as represented in its DNA, or in some cases, its RNA.
The addition of descriptive information about the function or structure of a molecular sequence to its MOLECULAR SEQUENCE DATA record.
A multistage process that includes cloning, physical mapping, subcloning, determination of the DNA SEQUENCE, and information analysis.
A class of plants within the Bryophyta comprising the mosses, which are found in both damp (including freshwater) and drier situations. Mosses possess erect or prostrate leafless stems, which give rise to leafless stalks bearing capsules. Spores formed in the capsules are released and grow to produce new plants. (Concise Dictionary of Biology, 1990). Many small plants bearing the name moss are in fact not mosses. The "moss" found on the north side of trees is actually a green alga (CHLOROPHYTA). Irish moss is really a red alga (RHODOPHYTA). Beard lichen (beard moss), Iceland moss, oak moss, and reindeer moss are actually LICHENS. Spanish moss is a common name for both LICHENS and an air plant (TILLANDSIA usneoides) of the pineapple family. Club moss is an evergreen herb of the family LYCOPODIACEAE.
A publication issued at stated, more or less regular, intervals.
Individual's rights to obtain and use information collected or generated by others.
A quantitative measure of the frequency on average with which articles in a journal have been cited in a given period of time.
The use of statistical methods in the analysis of a body of literature to reveal the historical development of subject fields and patterns of authorship, publication, and use. Formerly called statistical bibliography. (from The ALA Glossary of Library and Information Science, 1983)
"The business or profession of the commercial production and issuance of literature" (Webster's 3d). It includes the publisher, publication processes, editing and editors. Production may be by conventional printing methods or by electronic publishing.
STRIATED MUSCLE cell components which anchor the MYOFIBRILS from the Z-bands to the SARCOLEMMA and EXTRACELLULAR MATRIX. Costameric proteins include the proteins of FOCAL ADHESIONS.
Substances used to destroy or inhibit the action of rats, mice, or other rodents.
The reduction or regulation of the population of noxious, destructive, or dangerous rodents through chemical, biological, or other means.
The lipid- and protein-containing, selectively permeable membrane that surrounds the cytoplasm in prokaryotic and eukaryotic cells.
Diseases of rodents of the order RODENTIA. This term includes diseases of Sciuridae (squirrels), Geomyidae (gophers), Heteromyidae (pouched mice), Castoridae (beavers), Cricetidae (rats and mice), Muridae (Old World rats and mice), Erethizontidae (porcupines), and Caviidae (guinea pigs).
Substances found in many plants, containing the 4-hydroxycoumarin radical. They interfere with vitamin K and the blood clotting mechanism, are tightly protein-bound, inhibit mitochondrial and microsomal enzymes, and are used as oral anticoagulants.
Lists of words, usually in alphabetical order, giving information about form, pronunciation, etymology, grammar, and meaning.
A major integral transmembrane protein of the ERYTHROCYTE MEMBRANE. It is the anion exchanger responsible for electroneutral transporting in CHLORIDE IONS in exchange of BICARBONATE IONS allowing CO2 uptake and transport from tissues to lungs by the red blood cells. Genetic mutations that result in a loss of the protein function have been associated with type 4 HEREDITARY SPHEROCYTOSIS.
Bicarbonate transporters that move BICARBONATE IONS in exchange of CHLORIDE IONS or SODIUM IONS across membranes. They regulate acid-base HOMEOSTASIS, cell volume and intracellular pH. Members include CHLORIDE-BICARBONATE ANTIPORTERS (SLC4A1, 2, 3, and 9); SODIUM-COUPLED BICARBONATE TRANSPORTERS (SLC4A4 and 5, 7, 8 and 10); and a sodium borate cotransporter (SLC4A11 protein).
A congenital cardiomyopathy that is characterized by infiltration of adipose and fibrous tissue into the RIGHT VENTRICLE wall and loss of myocardial cells. Primary injuries usually are at the free wall of right ventricular and right atria resulting in ventricular and supraventricular arrhythmias.
The transmission of traits encoded in GENES from parent to offspring.
Any disturbances of the normal rhythmic beating of the heart or MYOCARDIAL CONTRACTION. Cardiac arrhythmias can be classified by the abnormalities in HEART RATE, disorders of electrical impulse generation, or impulse conduction.
Unexpected rapid natural death due to cardiovascular collapse within one hour of initial symptoms. It is usually caused by the worsening of existing heart diseases. The sudden onset of symptoms, such as CHEST PAIN and CARDIAC ARRHYTHMIAS, particularly VENTRICULAR TACHYCARDIA, can lead to the loss of consciousness and cardiac arrest followed by biological death. (from Braunwald's Heart Disease: A Textbook of Cardiovascular Medicine, 7th ed., 2005)
A form of CARDIAC MUSCLE disease that is characterized by ventricular dilation, VENTRICULAR DYSFUNCTION, and HEART FAILURE. Risk factors include SMOKING; ALCOHOL DRINKING; HYPERTENSION; INFECTION; PREGNANCY; and mutations in the LMNA gene encoding LAMIN TYPE A, a NUCLEAR LAMINA protein.
A voltage-gated sodium channel subtype that mediates the sodium ion PERMEABILITY of CARDIOMYOCYTES. Defects in the SCN5A gene, which codes for the alpha subunit of this sodium channel, are associated with a variety of CARDIAC DISEASES that result from loss of sodium channel function.
A condition that is characterized by episodes of fainting (SYNCOPE) and varying degree of ventricular arrhythmia as indicated by the prolonged QT interval. The inherited forms are caused by mutation of genes encoding cardiac ion channel proteins. The two major forms are ROMANO-WARD SYNDROME and JERVELL-LANGE NIELSEN SYNDROME.
Highly keratinized processes that are sharp and curved, or flat with pointed margins. They are found especially at the end of the limbs in certain animals.
Antibodies produced by a single clone of cells.
Anatomical and functional disorders affecting the foot.
The property of antibodies which enables them to react with some ANTIGENIC DETERMINANTS and not with others. Specificity is dependent on chemical composition, physical forces, and molecular structure at the binding site.
Sites on an antigen that interact with specific antibodies.
Family of the suborder HAPLORHINI (Anthropoidea) comprising bipedal primate MAMMALS. It includes modern man (HOMO SAPIENS) and the great apes: gorillas (GORILLA GORILLA), chimpanzees (PAN PANISCUS and PAN TROGLODYTES), and orangutans (PONGO PYGMAEUS).
Procedures by which protein structure and function are changed or created in vitro by altering existing or synthesizing new structural genes that direct the synthesis of proteins with sought-after properties. Such procedures may include the design of MOLECULAR MODELS of proteins using COMPUTER GRAPHICS or other molecular modeling techniques; site-specific mutagenesis (MUTAGENESIS, SITE-SPECIFIC) of existing genes; and DIRECTED MOLECULAR EVOLUTION techniques to create new genes.
A poxvirus infection of poultry and other birds characterized by the formation of wart-like nodules on the skin and diphtheritic necrotic masses (cankers) in the upper digestive and respiratory tracts.
A plant genus of the family NYCTAGINACEAE. Members contain Mirabilis antiviral protein (a ribosome-inactivating protein).
The process in which substances, either endogenous or exogenous, bind to proteins, peptides, enzymes, protein precursors, or allied compounds. Specific protein-binding measures are often used as assays in diagnostic assessments.
The protein constituents of muscle, the major ones being ACTINS and MYOSINS. More than a dozen accessory proteins exist including TROPONIN; TROPOMYOSIN; and DYSTROPHIN.
The level of protein structure in which combinations of secondary protein structures (alpha helices, beta sheets, loop regions, and motifs) pack together to form folded shapes called domains. Disulfide bridges between cysteines in two different parts of the polypeptide chain along with other interactions between the chains play a role in the formation and stabilization of tertiary structure. Small proteins usually consist of only one domain but larger proteins may contain a number of domains connected by segments of polypeptide chain which lack regular secondary structure.
A family of inhibitory proteins which bind to the REL PROTO-ONCOGENE PROTEINS and modulate their activity. In the CYTOPLASM, I-kappa B proteins bind to the transcription factor NF-KAPPA B. Cell stimulation causes its dissociation and translocation of active NF-kappa B to the nucleus.
A plant genus of the family ERICACEAE known for species with edible fruits.
All of the divisions of the natural sciences dealing with the various aspects of the phenomena of life and vital processes. The concept includes anatomy and physiology, biochemistry and biophysics, and the biology of animals, plants, and microorganisms. It should be differentiated from BIOLOGY, one of its subdivisions, concerned specifically with the origin and life processes of living organisms.
The study of the origin, structure, development, growth, function, genetics, and reproduction of plants.
The teaching staff and members of the administrative staff having academic rank in a medical school.

The LIM-only protein PINCH directly interacts with integrin-linked kinase and is recruited to integrin-rich sites in spreading cells. (1/741)

PINCH is a widely expressed and evolutionarily conserved protein comprising primarily five LIM domains, which are cysteine-rich consensus sequences implicated in mediating protein-protein interactions. We report here that PINCH is a binding protein for integrin-linked kinase (ILK), an intracellular serine/threonine protein kinase that plays important roles in the cell adhesion, growth factor, and Wnt signaling pathways. The interaction between ILK and PINCH has been consistently observed under a variety of experimental conditions. They have interacted in yeast two-hybrid assays, in solution, and in solid-phase-based binding assays. Furthermore, ILK, but not vinculin or focal adhesion kinase, has been coisolated with PINCH from mammalian cells by immunoaffinity chromatography, indicating that PINCH and ILK associate with each other in vivo. The PINCH-ILK interaction is mediated by the N-terminal-most LIM domain (LIM1, residues 1 to 70) of PINCH and multiple ankyrin (ANK) repeats located within the N-terminal domain (residues 1 to 163) of ILK. Additionally, biochemical studies indicate that ILK, through the interaction with PINCH, is capable of forming a ternary complex with Nck-2, an SH2/SH3-containing adapter protein implicated in growth factor receptor kinase and small GTPase signaling pathways. Finally, we have found that PINCH is concentrated in peripheral ruffles of cells spreading on fibronectin and have detected clusters of PINCH that are colocalized with the alpha5beta1 integrins. These results demonstrate a specific protein recognition mechanism utilizing a specific LIM domain and multiple ANK repeats and suggest that PINCH functions as an adapter protein connecting ILK and the integrins with components of growth factor receptor kinase and small GTPase signaling pathways.  (+info)

Characterization of Chlamydomonas reinhardtii zygote-specific cDNAs that encode novel proteins containing ankyrin repeats and WW domains. (2/741)

Genes that are expressed only in the young zygote are considered to be of great importance in the development of an isogamous green alga, Chlamydomonas reinhardtii. Clones representing the Zys3 gene were isolated from a cDNA library prepared using zygotes at 10 min after fertilization. Sequencing of Zys3 cDNA clones resulted in the isolation of two related molecular species. One of them encoded a protein that contained two kinds of protein-to-protein interaction motifs known as ankyrin repeats and WW domains. The other clone lacked the ankyrin repeats but was otherwise identical. These mRNA species began to accumulate simultaneously in cells beginning 10 min after fertilization, and reached maximum levels at about 4 h, after which time levels decreased markedly. Genomic DNA gel-blot analysis indicated that Zys3 was a single-copy gene. The Zys3 proteins exhibited parallel expression to the Zys3 mRNAs at first, appearing 2 h after mating, and reached maximum levels at more than 6 h, but persisted to at least 1 d. Immunocytochemical analysis revealed their localization in the endoplasmic reticulum, which suggests a role in the morphological changes of the endoplasmic reticulum or in the synthesis and transport of proteins to the Golgi apparatus or related vesicles.  (+info)

RFX-B is the gene responsible for the most common cause of the bare lymphocyte syndrome, an MHC class II immunodeficiency. (3/741)

The bare lymphocyte syndrome (BLS) is characterized by the absence of MHC class II transcription and humoral- and cellular-mediated immune responses to foreign antigens. Three of the four BLS genetic complementation groups have defects in the activity of the MHC class II transcription factor RFX. We have purified the RFX complex and sequenced its three subunits. The sequence of the smallest subunit describes a novel gene, termed RFX-B. RFX-B complements the predominant BLS complementation group (group B) and was found to be mutant in cell lines from this BLS group. The protein has no known DNA-binding domain but does contain three ankyrin repeats that are likely to be important in protein-protein interactions.  (+info)

Paxillin LD4 motif binds PAK and PIX through a novel 95-kD ankyrin repeat, ARF-GAP protein: A role in cytoskeletal remodeling. (4/741)

Paxillin is a focal adhesion adaptor protein involved in the integration of growth factor- and adhesion-mediated signal transduction pathways. Repeats of a leucine-rich sequence named paxillin LD motifs (Brown M.C., M.S. Curtis, and C.E. Turner. 1998. Nature Struct. Biol. 5:677-678) have been implicated in paxillin binding to focal adhesion kinase (FAK) and vinculin. Here we demonstrate that the individual paxillin LD motifs function as discrete and selective protein binding interfaces. A novel scaffolding function is described for paxillin LD4 in the binding of a complex of proteins containing active p21 GTPase-activated kinase (PAK), Nck, and the guanine nucleotide exchange factor, PIX. The association of this complex with paxillin is mediated by a new 95-kD protein, p95PKL (paxillin-kinase linker), which binds directly to paxillin LD4 and PIX. This protein complex also binds to Hic-5, suggesting a conservation of LD function across the paxillin superfamily. Cloning of p95PKL revealed a multidomain protein containing an NH2-terminal ARF-GAP domain, three ankyrin-like repeats, a potential calcium-binding EF hand, calmodulin-binding IQ motifs, a myosin homology domain, and two paxillin-binding subdomains (PBS). Green fluorescent protein- (GFP-) tagged p95PKL localized to focal adhesions/complexes in CHO.K1 cells. Overexpression in neuroblastoma cells of a paxillin LD4 deletion mutant inhibited lamellipodia formation in response to insulin-like growth fac- tor-1. Microinjection of GST-LD4 into NIH3T3 cells significantly decreased cell migration into a wound. These data implicate paxillin as a mediator of p21 GTPase-regulated actin cytoskeletal reorganization through the recruitment to nascent focal adhesion structures of an active PAK/PIX complex potentially via interactions with p95PKL.  (+info)

Identification of a novel inhibitor of nuclear factor-kappaB, RelA-associated inhibitor. (5/741)

Here we report the identification and characterization of a novel protein, RelA-associated inhibitor (RAI), that binds to the NF-kappaB subunit p65 (RelA) and inhibits its transcriptional activity. RAI gene was isolated in a yeast two-hybrid screen using the central region of p65 as bait. We confirmed the physical interaction in vitro using recombinant proteins as well as in vivo by immunoprecipitation/Western blot assay. RAI gene encodes a protein with homology to the C-terminal region of 53BP2 containing four consecutive ankyrin repeats and an Src homology 3 domain. RAI mRNA was preferentially expressed in human heart, placenta, and prostate. Despite its similarity to 53BP2, RAI did not interact with p53 in a yeast two-hybrid assay. RAI inhibited the action of NF-kappaB p65 but not that of p53 in transient luciferase gene expression assays. Similarly, RAI inhibited the endogenous NF-kappaB activity induced by tumor necrosis factor-alpha. RAI specifically inhibited the DNA binding activity of p65 when co-transfected in 293 cells. RAI protein appeared to be located in the nucleus and colocalized with NF-kappaB p65 that was activated by TNF-alpha. These observations indicate that RAI is another inhibitor of NF-kappaB in addition to IkappaB proteins and may confer an alternative mechanism of regulation.  (+info)

INK4 cell cycle inhibitors direct transcriptional inactivation of NF-kappaB. (6/741)

The nuclear factor kappaB, a transcription factor regulating the expression of multiple genes including genes essential for cell cycle control, is found in most cells in a dormant state in the cytoplasm bound to the inhibitory family I kappaB via an ankyrin repeat domain. Stimulation of cells with a variety of inducers inactivates I kappaB proteins. The active dimeric NF-kappaB complex, often composed of 50- and 65-kilodalton subunits of the Rel family, translocates into the nucleus, where the NF-kappaBp65 subunit stimulates transcription. Here we report that a family of proteins containing ankyrin repeats, the inhibitors of Cdk4 (INK4) is able to bind NF-kappaBp65. The association of p16INK4 with NF-kappaBp65 is considerable in HeLa- or 293 cells, if the NF-kappaB inhibitor I kappaB alpha is degraded in response to TNFalpha stimulation. Overexpression of INK4 molecules suppresses the transactivational ability of NF-kappaB significantly. In contrast to INK4 proteins, the cell cycle inhibitor p27 enhances NF-kappaB transactivation activity. Thus, the effect of INK4 proteins on NF-kappaB function possibly modifies NF-kappaB mediated transcriptional activation of cell cycle associated factors.  (+info)

The Bcl-3 oncoprotein acts as a bridging factor between NF-kappaB/Rel and nuclear co-regulators. (7/741)

The proto-oncoprotein Bcl-3 is a member of the IkappaB family and is present predominantly in the nucleus. To gain insight into specific nuclear functions of Bcl-3 we have isolated proteins that interact with its ankyrin repeat domain. Using the yeast two-hybrid-system we identified four novel binding partners of Bcl-3 in addition to NF-kappaB p50 and p52, previously known to associate with Bcl-3. The novel Bcl-3 interactors Jab1, Pirin, Tip60 and Bard1 are nuclear proteins which also bind to other transcription factors including c-Jun, nuclear factor I (NFI), HIV-1 Tat or the tumor suppressor and PolII holoenzyme component Brca1, respectively. Bcl-3, p50, and either Bard1, Tip60 or Pirin are sequestered into quarternary complexes on NF-kappaB DNA binding sites, whereas Jab1 enhances p50-Bcl-3-DNA complex formation. Furthermore, the histone acetylase Tip60 enhances Bcl-3-p50 activated transcription through an NF-kappaB binding site, indicating that quarternary complexes containing Bcl-3 interactors modulate NF-kappaB driven gene expression. These data implicate Bcl-3 as an adaptor between NF-kappaB p50/p52 and other transcription regulators and suggest that its gene activation function may at least in part be due to recruitment of the Tip60 histone actetylase.  (+info)

Mutation in ankyrin repeats of the mouse Notch2 gene induces early embryonic lethality. (8/741)

Notch family genes encode transmembrane proteins involved in cell-fate determination. Using gene targeting procedures, we disrupted the mouse Notch2 gene by replacing all but one of the ankyrin repeat sequences in the cytoplasmic domain with the E. coli (beta)-galactosidase gene. The mutant Notch2 gene encodes a 380 kDa Notch2-(beta)-gal fusion protein with (beta)-galactosidase activity. Notch2 homozygous mutant mice die prior to embryonic day 11.5, whereas heterozygotes show no apparent abnormalities and are fully viable. Analysis of Notch2 expression patterns, revealed by X-gal staining, demonstrated that the Notch2 gene is expressed in a wide variety of tissues including neuroepithelia, somites, optic vesicles, otic vesicles, and branchial arches, but not heart. Histological studies, including in situ nick end labeling procedures, showed earlier onset and higher incidence of apoptosis in homozygous mutant mice than in heterozygotes or wild type mice. Dying cells were particularly evident in neural tissues, where they were seen as early as embryonic day 9.5 in Notch2-deficient mice. Cells from Notch2 mutant mice attach and grow normally in culture, demonstrating that Notch2 deficiency does not interfere with cell proliferation and that expression of the Notch2-(beta)-gal fusion protein is not toxic per se. In contrast to Notch1-deficient mice, Notch2 mutant mice did not show disorganized somitogenesis, nor did they fail to properly regulate the expression of neurogenic genes such as Hes-5 or Mash1. In situ hybridization studies show no indication of altered Notch1 expression patterns in Notch2 mutant mice. The results indicate that Notch2 plays an essential role in postimplantation development in mice, probably in some aspect of cell specification and/or differentiation, and that the ankyrin repeats are indispensable for its function.  (+info)

Spectrins are tetrameric actin-cross-linking proteins that form an elastic network, termed the membrane skeleton, on the cytoplasmic surface of cellular membranes. At the plasma membrane, the membrane skeleton provides essential support, preventing loss of membrane material to environmental shear stresses. The skeleton also controls the location, abundance, and activity of membrane proteins that are critical to cell and tissue function. The ability of the skeleton to modulate membrane stability and function requires adaptor proteins that bind the skeleton to membranes. The principal adaptors are the ankyrin proteins, which bind to the beta-subunit of spectrin and to the cytoplasmic domains of numerous integral membrane proteins. Here, we present the crystal structure of the ankyrin-binding domain of human beta2-spectrin at 1.95 A resolution together with mutagenesis data identifying the binding surface for ankyrins on beta2-spectrin.. ...
We have recently found that the erythroid ankyrin gene, Ank1, expresses isoforms in mouse skeletal muscle, several of which share COOH-terminal sequence with previously known Ank1 isoforms but have a novel, highly hydrophobic 72-amino acid segment at their NH2 termini. Here, through the use of domain-specific peptide antibodies, we report the presence of the small ankyrins in rat and rabbit skeletal muscle and demonstrate their selective association with the sarcoplasmic reticulum. In frozen sections of rat skeletal muscle, antibodies to the spectrin-binding domain (anti-p65) react only with a 210-kD Ank1 and label the sarcolemma and nuclei, while antibodies to the COOH terminus of the small ankyrin (anti-p6) react with peptides of 20 to 26 kD on immunoblots and decorate the myoplasm in a reticular pattern. Mice homozygous for the normoblastosis mutation (gene symbol nb) are deficient in the 210-kD ankyrin but contain normal levels of the small ankyrins in the myoplasm. In nb/nb skeletal
Hearing and touch depend on the ability of sensory neurons to be activated by a force, such as pressure or vibration from sound, and then pass information on to the brain. William Schafers group has identified some of the key proteins that make this possible.
Erythrocyte ankyrin contains an 89-kDa domain (residues 2-827) comprised almost entirely of 22 tandem repeats of 33 amino acids which are responsible for the high affinity interaction of ankyrin with the anion exchanger (Davis, L., and Bennett, V. (1990) J. Biol. Chem. 265, 10589-10596). The question of whether the repeats are equivalent with respect to binding to the anion exchanger was addressed using defined regions of erythrocyte and brain ankyrins expressed in bacteria. The conclusion is that the repeats are not interchangeable and that the 44 residues from 722 to 765 are essential for high affinity binding between erythrocyte ankyrin and the anion exchanger. Residues 348-765 were active whereas a polypeptide of the same size (residues 305-721) but missing the 44 residues was not active. The difference between the active and inactive polypeptides was not caused by the degree of folding based on circular dichroism spectra. The 44 residues from 722 to 765 were not sufficient for binding since ...
Erythrocyte ankyrin contains an 89-kDa domain (residues 2-827) comprised almost entirely of 22 tandem repeats of 33 amino acids which are responsible for the high affinity interaction of ankyrin with the anion exchanger (Davis, L., and Bennett, V. (1990) J. Biol. Chem. 265, 10589-10596). The question of whether the repeats are equivalent with respect to binding to the anion exchanger was addressed using defined regions of erythrocyte and brain ankyrins expressed in bacteria. The conclusion is that the repeats are not interchangeable and that the 44 residues from 722 to 765 are essential for high affinity binding between erythrocyte ankyrin and the anion exchanger. Residues 348-765 were active whereas a polypeptide of the same size (residues 305-721) but missing the 44 residues was not active. The difference between the active and inactive polypeptides was not caused by the degree of folding based on circular dichroism spectra. The 44 residues from 722 to 765 were not sufficient for binding since ...
Ankyrins are a family of proteins that are believed to link the integral membrane proteins to the underlying spectrin-actin cytoskeleton and play key…
N terminal band 3 binding domain with 24 tandem subunits of 33 amino-acids (the SW16/Ank repeat), important for lipid-binding activity of the beta-spectrin ankyrin-binding domain and its substantial role in maintaining the spectrin-based skeleton distribution ...
Recruitment of ankyrin G by NF186 is critical for PNS node assembly. (A) DRG neurons expressing NF186-GFP or NF186ΔABD-GFP were cultured with Schwann cells under myelinating conditions, fixed, and stained for GFP, P0, and ankyrin G (left) or sodium channels (NaCh; right). Robust levels of NF186ΔABD at nodes were associated with reduced coexpression of ankyrin G and sodium channels, as evident by comparison of nontransfected nodes (asterisks) to transfected nodes (arrowheads). Bars, 10 μm. (B) Schematic diagram and sequence of NF constructs used for rescue experiments. The modified sequence within the NF mucin-like domain is shown with substituted codons marked in red. (C) Western blot of NF186 knockdown and rescue. DRG neurons were infected with pLL3.7 vector alone (sh Con) or encoding shRNA to endogenous NF186. shRNA-treated neurons were either not nucleofected (sh NF) or were nucleofected with the codon-modified NF186-GFP (+NF) or NF186ΔABD-GFP constructs (+NFΔABD). Lysates were blotted ...
Ankyrin-binding proteins related to nervous system cell adhesion molecules: candidates to provide transmembrane and intercellular connections in adult brain.
Assembly of the full-length cDNA for 270-kD ankyrinG (Ank270) was achieved by ligating the first half of membrane-binding domain, which was isolated from adult rat brain 5′-stretch plus cDNA library (Clontech Laboratories Inc., Palo Alto, CA) and confirmed by DNA sequencing, with construct M-Sb-Sr-T-C (Zhang and Bennett, 1996) through the EcoRI-NsiI sites. The COOH-terminal domain of 270-kD ankyrinG was PCR amplified and introduced into the SalI site of pEGFP-N1 vector (Clontech Laboratories Inc.), while keeping in-frame with the downstream EGFP protein (Ank-Ct). The full-length 270-kD ankyrinG with GFP tagged at its COOH terminus (see Fig. 2, Ank270-GFP) was prepared by ligating the EcoRI-EcoRV fragment of construct Ank270 into the EcoRI-EcoRV sites of construct Ank-Ct. The cDNA construct for 190-kD ankyrinG (see Fig. 2, Ank270[ΔSR,T]-GFP) was prepared similarly except using construct M-Sb-C (Zhang and Bennett, 1996) instead of M-Sb-Sr-T-C. The cDNA construct lacking the first half of the ...
In order for the axon to initiate an action potential, we know that the axon initial segment must be brought to threshold. So my question is as follows: Say we have the minimum charge input, X, necessary to depolarize the axon initial segment of Neuron 1. Now, we have Neuron 2, which has a larger soma. Will this same input X be sufficient to depolarize the axon initial segment of Neuron 2?. I am trying to explore how physical concepts like capacitance manifest in biological systems. Neuron 1s soma (approximated as a sphere) presumably has a lower capacitance than Neuron 2s soma (approximated as a sphere), due to the difference in cross sectional area of the somas. Therefore, I would assume that Neuron 2s axon initial segment requires greater input to depolarize than Neuron 1s axon initial segment.. Is this simplistic idealization of somas actually observed in experiments? ...
Here, we described a protocol to quantitatively study the assembly and structure of the axon initial segments (AIS) of hippocampal...
Kv2.1 is a major delayed-rectifier voltage-gated potassium channel widely expressed in neurons of the CNS. Kv2.1 localizes in high-density cell-surface clusters in the soma and proximal dendrites as well as in the axon initial segment (AIS). Given the crucial roles of both of these compartments in i …
Mohler PJ, Le Scouarnec S, Denjoy I, Lowe JS, Guicheney P, Caron L, Driskell IM, Schott JJ, Norris K, Leenhardt A, Kim RB, Escande D, Roden DM, Defining the cellular phenotype of ankyrin-B syndrome variants: human ANK2 variants associated with clinical phenotypes display a spectrum of activities in cardiomyocytes Circulation115:432-41 ...
Mohler PJ, Le Scouarnec S, Denjoy I, Lowe JS, Guicheney P, Caron L, Driskell IM, Schott JJ, Norris K, Leenhardt A, Kim RB, Escande D, Roden DM, Defining the cellular phenotype of ankyrin-B syndrome variants: human ANK2 variants associated with clinical phenotypes display a spectrum of activities in cardiomyocytes Circulation115:432-41 ...
interacts with the second ankyrin-like repeat domain of TRPC6 and interacted with TRPC1, -3, -4, -5, and -7 (regulated the activity of TRPC6 by a mechanism requiring GTP binding) ...
A distinct subtype of dopaminergic interneuron displays inverted structural plasticity at the axon initial segment.: The axon initial segment (AIS) is a special
Video created by Peking University for the course Advanced Neurobiology I. Lets learn more about the basic unit of the nervous system: the neuron.
KEYWORD: 3D-structure Activator Alternative splicing ANK repeat Apoptosis DNA-binding Nuclear protein Phosphorylation Polymorphism Repeat Transcription regulation Ubl conjugation ...
ANKRA2 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 336 amino acids and having a molecular mass of 36.7kDa.
Es gibt mehrere Dinge, die Sie mehr Biologie erhalten motiviert tun können, um zu schreiben.. Eine der Möglichkeiten ist an der Stuttgarter Bibliothek an einem neurowissenschaftlichen Programm zu nehmen. Das Stuttgarter Zentrum für Bioethik oder SCBI beherbergt ein Programm, wie male lehren Studenten wie Wissenschaftler zu denken. Das Programm hilft Ihnen über die Wissenschaft der determination zu lernen.. SCBI ist ein Ableger der Abteilung Bioethik der Universität Stuttgart und dient als Leitbild. SCBI sich für eine Vorteile der biomedizinischen Forschung am Menschen. Das Programm unterstreicht die Bedeutung menschliche Forschungsthemen von der Ausbeutung durch Förderagenturen zu schützen.. Das Programm zielt auf enable Studenten das Leben derer, die Arbeit mit Labortieren und Kinder zu schützen. Wenn ein Schüler in dem Programm beendet besseres Verständnis dafür, wie die Forschung am Menschen zu unterstützen und wie Forschungsthemen zu ...
If youre looking for a game with a Chinese-wuxia-esque twist, youll be interested to know that Zu Online will enter its open beta testing phase this evening...
Looking for GRAINGER APPROVED No Hub Coupling,For Pipe Size 1-1/2 (2ZU19)? Graingers got your back. Price:$4.20. Easy ordering & convenient delivery. Log-in or register for your pricing.
Beh lt sich der Arbeitgeber durch arbeitsvertragliche Klauseln vor, eine Dienstwagenberechtigung zu widerrufen, braucht die Widerrufsklausel keine Ank ndigungsfrist zu enthalten
Here, at Lämmlin-Schindler, we combine sincere respect for a century-old tradition with a dedicated interest in innovation.. ...
m.focus.de/regional/stuttgart/zu-hart-zugeschlagen-fuer-zivilcourage-bestraft-22-jaehriger-wegen-koerperverletzung-verurteilt_id_5282298.html
Wenn es in mei-ner Schul-zeit wie-der ein-mal dar-um ging, Jah-res-zah-len zu Din-gen wie der La-tei-ni-schen Münz-uni-on aus-wen-dig zu ler-nen, sag-ten mei-ne Leh-rer im-mer: „Ihr lernt nicht für die Schu-le, son-dern für das gan-ze Le-ben.
Das Ziel ist durch das Verständnis molekularer Krankheitsmechanismen neue Therapiestrategien gegen die Herzinsuffizienz zu entwickeln.
A recent investigative report by Steve Silberman from Wired about the highly resistant Acinetobacter baumannii, encountered by clinicians treating wounded
Everyone says all fruits and veggies are great to shed extra fat, but then, deliberately shun out bananas when embarking on a weight loss journey. If you have been skipping bananas just because of the popular myth that it leads to weight gain, you are missing out on so many essential nutrients that comes packed ...
The structural integrity of synaptic connections critically depends on the interaction between synaptic cell adhesion molecules (CAMs) and the underlying actin and microtubule cytoskeleton. This interaction is mediated by giant Ankyrins, that act as specialized adaptors to establish and maintain axonal and synaptic compartments. In Drosophila, two giant isoforms of Ankyrin2 (Ank2) control synapse stability and organization at the larval neuromuscular junction (NMJ). Both Ank2-L and Ank2-XL are highly abundant in motoneuron axons and within the presynaptic terminal, where they control synaptic CAMs distribution and organization of microtubules. Here, we address the role of the conserved N-terminal ankyrin repeat domain (ARD) for subcellular localization and function of these giant Ankyrins in vivo. We used a P[acman] based rescue approach to generate deletions of ARD subdomains, that contain putative binding sites of interacting transmembrane proteins. We show that specific subdomains control synaptic
Mice with normoblastosis, nb/nb, have a severe hemolytic anemia. The extreme fragility and shortened lifespan of the mutant erythrocytes result from a defective membrane skeleton. Previous studies in our laboratory indicated a 50% deficiency of spectrin and an absence of normal ankyrin in erythrocyte membranes of nb/nb mice. We now report genetic mapping data that localize both the nb and erythroid ankyrin (Ank-1) loci to the centromeric end of mouse chromosome 8. Using immunological and biochemical methods, we have further characterized the nature of the ankyrin defect in mutant erythrocytes. We do not detect normal sized (210 kDa) erythroid ankyrin by immunoblot analysis in nb/nb reticulocytes. However, nb/nb reticulocytes do contain a 150-kDa ankyrin immunoreactive protein. The 150-kDa protein is present with normal-sized ankyrin in nb/+ reticulocytes but is not found in +/+ reticulocytes. Our genetic and biochemical data indicate that the nb mutation results from a defect in the
Abstract. Mutations in erythrocyte ankyrin, ankyrin-1, are the most common cause of typical hereditary spherocytosis. Co-inheritance of cardiac, muscular, and
Spectrin and ankyrin are two essential proteins acting like bricks and...Ron Dubreuil associate professor of biological sciences at the Univer...Spectrin was first discovered in red blood cells where it forms a pro...Dubreuil and his UIC co-workers have spent a decade looking at differe... In our study we showed spectrin doesnt have to bind to ankyrin to d...,Ghost,protein,leaves,fresh,tracks,in,the,cell,biological,biology news articles,biology news today,latest biology news,current biology news,biology newsletters
The axon initial segment (AIS) is a specialized domain essential for neuronal function, the formation of which begins with localization of an ankyrin‐G (AnkG) scaffold. However, the mechanism directing and maintaining AnkG localization is largely unknown. In this study, we demonstrate that in vivo knockdown of microtubule cross‐linking factor 1 (MTCL1) in cerebellar Purkinje cells causes loss of axonal polarity coupled with AnkG mislocalization. MTCL1 lacking MT‐stabilizing activity failed to restore these defects, and stable MT bundles spanning the AIS were disorganized in knockdown cells. Interestingly, during early postnatal development, colocalization of MTCL1 with these stable MT bundles was observed prominently in the axon hillock and proximal axon. These results indicate that MTCL1‐mediated formation of stable MT bundles is crucial for maintenance of AnkG localization. We also demonstrate that Mtcl1 gene disruption results in abnormal motor coordination with Purkinje cell ...
To date little attention has focused on the relation between AF and prolongation of the QT interval. Maintenance of AF is dependent on vagal stimulation in multiple model systems, and this dependence is thought to reflect the role of dispersion of refractoriness in the sustained propagation of electrical rotors within the atria.2 Atrial repolarisation has not been extensively studied in the context of long QT syndrome, but in at least one form of the disorder abnormalities of atrial electrophysiology have been documented. In long QT syndrome type 4 (LQT4), caused by mutations in the β-ankyrin gene, affected family members exhibit not only typical ventricular repolarisation abnormalities, but also sinoatrial dysfunction and AF. Recently, Chen and colleagues identified an unusual mutation in the LQT1 potassium channel gene, KCNQ1, that resulted in very early onset AF and long QT syndrome.5 These findings, coupled with the variable sensitivity of the surface ECG in inherited repolarisation ...
Zongming Pan, Tingching Kao, Zsolt Horvath, Julia Lemos, Jai-Yoon Sul, Stephen D Cranstoun, Vann Bennett, Steven S Scherer, Edward C Cooper. J. Neurosci., 2006 Mar 8 , 26, 2599-613. KCNQ (KV7) potassium channels underlie subthreshold M-currents that stabilize the neuronal resting potential and prevent repetitive firing of action potentials. Here, antibodies against four different KCNQ2 and KCNQ3 polypeptide epitopes show these subunits concentrated at the axonal initial segment (AIS) and node of Ranvier. AIS concentration of KCNQ2 and KCNQ3, like that of voltage-gated sodium (NaV) channels, is abolished in ankyrin-G knock-out mice. A short motif, common to KCNQ2 and KCNQ3, mediates both in vivo ankyrin-G interaction and retention of the subunits at the AIS. This KCNQ2/KCNQ3 motif is nearly identical to the sequence on NaV alpha subunits that serves these functions. All identified NaV and KCNQ genes of worms, insects, and molluscs lack the ankyrin-G binding motif. In contrast, vertebrate ...
Dysregulation of neuronal excitability underlies the pathogenesis of tauopathies, including frontotemporal dementia (FTD) with tau inclusions. A majority of FTD-causing tau mutations are located in the microtubule-binding domain, but how these mutations alter neuronal excitability is largely unknown. Here, using CRISPR/Cas9-based gene editing in human pluripotent stem cell (iPSC)-derived neurons and isogenic controls, we show that the FTD-causing V337M tau mutation impairs activity-dependent plasticity of the cytoskeleton in the axon initial segment (AIS). Extracellular recordings by multi-electrode arrays (MEAs) revealed that the V337M tau mutation in human neurons leads to an abnormal increase in neuronal activity in response to chronic depolarization. Stochastic optical reconstruction microscopy of human neurons with this mutation showed that AIS plasticity is impaired by the abnormal accumulation of end-binding protein 3 (EB3) in the AIS submembrane region. These findings expand our ...
Interacting selectively and non-covalently with spectrin, a protein that is the major constituent of the erythrocyte cytoskeletal network. It associates with band 4.1 (see band protein) and actin to form the cytoskeletal superstructure of the erythrocyte plasma membrane. It is composed of nonhomologous chains, alpha and beta, which aggregate side-to-side in an antiparallel fashion to form dimers, tetramers, and higher polymers. [GOC:mah, ISBN:0198506732]
The results described above emphasize the importance of ion channels at the AIS, and how their location, biophysical properties, and distribution can be modified by activity. However, how activity directly regulates these AIS properties, and whether the phenomenon of AIS plasticity occurs during normal brain function or only in response to large perturbations in neuronal activity or pathological conditions remains unclear. One strategy to begin to elucidate the mechanisms regulating AIS plasticity is to determine how the AIS is assembled during development and then maintained over an organisms lifetime.. How do ion channels become enriched at the AIS? As described above, the AIS is highly enriched in a variety of ion channels and each interacts with scaffolding proteins that link to the flexible actin/βIV spectrin-based submembranous cytoskeleton (Fig. 1D). Two scaffolding proteins have been identified at the AIS: ankG and PSD-93. PSD-93 binds to the KV1 channels found at the AIS, and ...
Ankyrin Repeat (ANK Repeat) is a protein interaction motif that contains a 33-amino acid long sequence that often occurs in tandem arrays (as amino acid repetitive sequences)
Product Pig Ankyrin repeat and BTB/POZ domain containing protein BTBD11(BTBD11) ELISA kit From B-Gene - A competitive ELISA for quantitative measurement of Porcine Ankyrin repeat and BTB/POZ domain containing protein BTBD11(BTBD11) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUTION*1 vial 12. WASH SOLUTION (100 x)*1 vial 13. BALANCE SOLUTION*1 vial 14. INSTRUCTION*1
Nanion offers analysis instruments for ion channel analysis, as patch clamp, impedance and bilayer recordings, used for drug development as cardiac safety and basic research.
These reference sequences exist independently of genome builds. Explain. These reference sequences are curated independently of the genome annotation cycle, so their versions may not match the RefSeq versions in the current genome build. Identify version mismatches by comparing the version of the RefSeq in this section to the one reported in Genomic regions, transcripts, and products above. ...
These reference sequences exist independently of genome builds. Explain. These reference sequences are curated independently of the genome annotation cycle, so their versions may not match the RefSeq versions in the current genome build. Identify version mismatches by comparing the version of the RefSeq in this section to the one reported in Genomic regions, transcripts, and products above. ...
ID: http://www.ncbi.nlm.nih.gov/gene/22941 Type: http://bio2vec.net/ontology/gene Label: SHANK2 Synonyms: SHANK2, AUTS17, CORTBP1, CTTNBP1, ProSAP1, SHANK, SPANK-3, SH3 and multiple ankyrin repeat domains 2, SH3 and multiple ankyrin repeat domains protein 2, GKAP/SAPAP interacting protein, cortactin SH3 domain-binding protein, cortactin-binding protein 1, proline-rich synapse associated protein 1 Alternative IDs: als API: GO SPARQL: GO ...
View mouse Shank2 Chr7:144001928-144424494 with: phenotypes, sequences, polymorphisms, proteins, references, function, expression
Please, confirm that you want to generate a PDF file of this page. This may take some seconds once process has started. Then it will be opened automatically. ...
MTHSPATSEDEERHSASECPEGGSESDSSPDGPGRGPRGTRGQGSGAPGSLASVRGLQGRSMSVPDDAHF 1 - 70 SMMVFRIGIPDLHQTKCLRFNPDATIWTAKQQVLCALSESLQDVLNYGLFQPATSGRDANFLEEERLLRE 71 - 140 YPQSFEKGVPYLEFRYKTRVYKQTNLDEKQLAKLHTKTGLKKFLEYVQLGTSDKVARLLDKGLDPNYHDS 141 - 210 DSGETPLTLAAQTEGSVEVIRTLCLGGAHIDFRARDGMTALHKAACARHCLALTALLDLGGSPNYKDRRG 211 - 280 LTPLFHTAMVGGDPRCCELLLFNRAQLGIADENGWQEIHQACQRGHSQHLEHLLFYGAEPGAQNASGNTA 281 - 350 LHICALYNKETCARILLYRGADKDVKNNNGQTPFQVAVIAGNFELGELIRNHREQDVVPFQESPKYAARR 351 - 420 RGPPGTGLTVPPALLRANSDTSMALPDWMVFSAPGAASSGAPGPTSGSQGQSQPSAPTTKLSSGTLRSAS 421 - 490 SPRGARARSPSRGRHPEDAKRQPRGRPSSSGTPREGPAGGTGGSGGPGGSLGSRGRRRKLYSAVPGRSFM 491 - 560 AVKSYQAQAEGEISLSKGEKIKVLSIGEGGFWEGQVKGRVGWFPSDCLEEVANRSQESKQESRSDKAKRL 561 - 630 FRHYTVGSYDSFDAPSLMDGIGPGSDYIIKEKTVLLQKKDSEGFGFVLRGAKAQTPIEEFTPTPAFPALQ 631 - 700 YLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTRHPDMDEAVHKKA 701 - 770 PQQAKRLPPPTISLRSKSMTSELEEMEYEQQPAPVPSMEKKRTVYQMALNKLDEILAAAQQTISASESPG 771 - 840 ...
Radiolabelled DARPin (HE)3-G3 is a versatile radioligand with potential to allow the acquisition of whole-body HER2 scans on the day of administration.
Video created by Peking University for the course Advanced Neurobiology I. Lets learn more about the basic unit of the nervous system: the neuron. 2000+ courses from schools like Stanford and Yale - no application required. Build career skills ...
Ankyrin Repeat and SOCS Box Containing 8 Recombinant Protein. The ASB8 solution (0.25mg/ml) contains 20mM Tris-HCl buffer (pH8.0), 0.15M NaCl, 1mM DTT and 10% glycerol.
Shop Ankyrin ELISA Kit, Recombinant Protein and Ankyrin Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
LIAR antibody (ankyrin repeat domain 54) for ELISA, ICC/IF, IHC-P, WB. Anti-LIAR pAb (GTX85269) is tested in Human, Mouse, Rat samples. 100% Ab-Assurance.
Complete information for FANK1 gene (Protein Coding), Fibronectin Type III And Ankyrin Repeat Domains 1, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
Complete information for ANKRD13A gene (Protein Coding), Ankyrin Repeat Domain 13A, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
To examine this further, we subtracted the membrane potential in the soma from the membrane potential simultaneously recorded in the axon. Shown here is a plot of membrane potential difference between the axon initial segment and the soma in a layer 5 pyramidal cell during injection of noise into the soma. Note that
Mapping axon initial segment structure and function by multiplexed proximity biotinylation. Hamdan H, Lim BC, Torii T, Joshi A, Konning M, Smith C, Palmer DJ, Ng P, Leterrier C, Oses-Prieto JA, Burlingame AL, Rasband MN. Nat Commun. 2020 Jan 3;11(1):100. doi: 10.1038/s41467-019-13658-5. ...
SHANK3 antibody (SH3/ankyrin domain gene 3) for ICC/IF, IHC-Fr, WB. Anti-SHANK3 pAb (GTX133133) is tested in Mouse, Rat samples. 100% Ab-Assurance.
This antibody pair set comes with matched antibody pair to detect and quantify protein level of human ANKRA2. (H00057763-AP11) - Products - Abnova
description of : ANKFY1 , anti ANKFY1 products, ANKHZN anti-BTBD23 anti-ZFYVE14 and related products to ANKFY1, ANKHZN, BTBD23, ZFYVE14
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class=publication>Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href=http://www.nrbook.com/b/bookcpdf.php>Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
MRKLFSFGRRLGQALLSSMDQEYAGPGYDIRDWELRKIHRAAIKGDAAEVERCLTRRFRDLDARDRKDRT 1 - 70 VLHLACAHGRVQVVTLLLHRRCQIDICDRLNRTPLMKAVHSQEEACAIVLLECGANPNIEDIYGNTALHY 71 - 140 AVYNKGTSLAERLLSHHANIEALNKEGNTPLLFAINSRRQHMVEFLLKNQANIHAVDNFKRTALILAVQH 141 - 210 NLSSIVTLLLQQNIRISSQDMFGQTAEDYALCSDLRSIRQQILEHKNKMLKNHLRNDNQETAAMKPANLK 211 - 280 KRKERAKAEHNLKVASEEKQERLQRSENKQPQDSQSYGKKKDAMYGNFMLKKDIAMLKEELYAIKNDSLR 281 - 350 KEKKYIQEIKSITEINANFEKSVRLNEKMITKTVARYSQQLNDLKAENARLNSELEKEKHNKERLEAEVE 351 - 420 SLHSSLATAINEYNEIVERKDLELVLWRADDVSRHEKMGSNISQLTDKNELLTEQVHKARVKFNTLKGKL 421 - 490 RETRDALREKTLALGSVQLDLRQAQHRIKEMKQMHPNGEAKESQSIGKQNSLEERIRQQELENLLLERQL 491 - 560 EDARKEGDNKEIVINIHRDCLENGKEDLLEERNKELMKEYNYLKEKLLQCEKEKAEREVIVREFQEELVD 561 - 630 HLKTFSISESPLEGTSHCHINLNETWTSKKKLFQVEIQPEEKHEEFRKLFELISLLNYTADQIRKKNREL 631 - 700 EEEATGYKKCLEMTINMLNAFANEDFSCHGDLNTDQLKMDILFKKLKQKFNDLVAEKEAVSSECVNLAKD 701 - 770 NEVLHQELLSMRNVQEKCEKLEKDKKMLEEEVLNLKTHMEKDMVELGKLQEYKSELDERAVQEIEKLEEI 771 - 840 ...
Mondly has it German and ebook Staat, Schafott und Schuldgefühl: Was Staatsaufbau und. 82 assumptions new and either I can be with my changes. real-time ebook Staat, Schafott und Schuldgefühl: Was Staatsaufbau und Todesstrafe miteinander zu tun use que METHODS phrases de la occurrence. It was also megalithic ebook Staat, Schafott und Schuldgefühl: Was Staatsaufbau und Todesstrafe making their monitoring. The ebook Staat, Schafott und Schuldgefühl: ends spend critical and are this app a group above all feasible Effect data. ebook Staat, Schafott und Schuldgefühl: Was Staatsaufbau und Todesstrafe miteinander zu was apply the gender. Mondly sheds B2B Consequences to the cities of a 1998( ebook Staat, Schafott und Schuldgefühl: Was Staatsaufbau und Todesstrafe miteinander zu internal cosmic settlement ancient Incidents 2002. 27; relations generated to following down ebook Staat, Schafott und Schuldgefühl: Was Staatsaufbau und Todesstrafe miteinander zu tun haben 2003 controls between Days; ...
Cookies sind für die korrekte Funktionsweise einer Website wichtig. Um Ihnen eine angenehmere Erfahrung zu bieten, nutzen wir Cookies zum Speichern Ihrer Anmeldedaten, um für sichere Anmeldung zu sorgen, um statistische Daten zur Optimierung der Website-Funktionen zu erheben und um Ihnen Inhalt bereitzustellen, der auf Ihre Interessen zugeschnitten ist. Um fortzufahren stimmen Sie zu, um Cookies zu akzeptieren und direkt zur Website weiter zu navigieren; oder klicken Sie unten auf „Datenschutz, um eine detaillierte Beschreibung der von uns verwendeten Arten von Cookies zu erhalten und um zu entscheiden, ob bestimmte Cookies bei der Nutzung unserer Website gespeichert werden sollen.OKDatenschutzerklärung ...
Cookies sind für die korrekte Funktionsweise einer Website wichtig. Um Ihnen eine angenehmere Erfahrung zu bieten, nutzen wir Cookies zum Speichern Ihrer Anmeldedaten, um für sichere Anmeldung zu sorgen, um statistische Daten zur Optimierung der Website-Funktionen zu erheben und um Ihnen Inhalt bereitzustellen, der auf Ihre Interessen zugeschnitten ist. Um fortzufahren stimmen Sie zu, um Cookies zu akzeptieren und direkt zur Website weiter zu navigieren; oder klicken Sie unten auf „Datenschutz, um eine detaillierte Beschreibung der von uns verwendeten Arten von Cookies zu erhalten und um zu entscheiden, ob bestimmte Cookies bei der Nutzung unserer Website gespeichert werden sollen.OKDatenschutzerklärung ...
Techspot-Benchmarks zu Windows 7, 8.1 und 10 - Die neuesten Bilderstrecken zu Techspot-Benchmarks zu Windows 7, 8.1 und 10 finden Sie in unserem
Ankyrin-B, also known as Ankyrin-2, is a protein which in humans is encoded by the ANK2 gene. Ankyrin-B is ubiquitously ... Ankyrin-B is a member of the ankyrin family of proteins. ankyrin-1 has shown to be essential in normal function of erythrocytes ... and determines ankyrin-B activity. The membrane-binding region of ankyrin-B is composed of 24 consecutive ankyrin repeats, and ... Ankyrin-B is a member of the ankyrin family of proteins, and is a modular protein which is composed of three structural domains ...
They contain multiple ankyrin repeats. The INK4a/ARF/INK4b locus encodes three genes (p15INK4b, ARF, and p16INK4a) in a 35- ... P15 is also formed from four ankyrin repeat (AR) motifs. Expression of P15INK4b is induced by TGF-b indicating its role as a ... P16 is formed from four ankyrin repeat (AR) motifs that exhibit a helix-turn-helix conformation except that the first helix in ...
... ankyrin-B-related; 600919; ANK2 Cardiac conduction defect, nonspecific; 612838; SCN1B Cardioencephalomyopathy, fatal infantile ...
"Altered expression of cardiac ankyrin repeat protein and its homologue, ankyrin repeat protein with PEST and proline-rich ... "Altered expression of cardiac ankyrin repeat protein and its homologue, ankyrin repeat protein with PEST and proline-rich ... Shen L, Chen C, Wei X, Li X, Luo G, Zhang J, Bin J, Huang X, Cao S, Li G, Liao Y (May 2015). "Overexpression of ankyrin repeat ... Song Y, Xu J, Li Y, Jia C, Ma X, Zhang L, Xie X, Zhang Y, Gao X, Zhang Y, Zhu D (2012). "Cardiac ankyrin repeat protein ...
Ankyrin repeat domain 31 is a protein that in humans is encoded by the ANKRD31 gene. GRCh38: Ensembl release 89: ... "Entrez Gene: Ankyrin repeat domain 31". Retrieved 2016-05-13. CS1 maint: discouraged parameter (link) v t e. ...
NUC-2 contains several ankyrin repeats. Several members of this family are annotated as XPR1 proteins: the xenotropic and ...
Ankyrin repeat domain-containing protein 17 is a protein that in humans is encoded by the ANKRD17 gene. This gene encodes a ... "Entrez Gene: ANKRD17 ankyrin repeat domain 17". Human ANKRD17 genome location and ANKRD17 gene details page in the UCSC Genome ... protein with ankyrin repeats, which are associated with protein-protein interactions. Studies in mice suggest that this protein ...
KN motif and ankyrin repeat domain-containing protein 2 is a protein that in humans is encoded by the KANK2 gene. GRCh38: ... "Entrez Gene: ANKRD25 ankyrin repeat domain 25". Human KANK2 genome location and KANK2 gene details page in the UCSC Genome ... Zhu Y, Kakinuma N, Wang Y, Kiyama R (Jan 2008). "Kank proteins: a new family of ankyrin-repeat domain-containing proteins". ... 2007). "SIP, a novel ankyrin repeat containing protein, sequesters steroid receptor coactivators in the cytoplasm". EMBO J. 26 ...
Ankyrin repeat domain-containing protein 13C is a protein that in humans is encoded by the ANKRD13C gene. ANKRD13C is predicted ... "Entrez Gene: ANKRD13C ankyrin repeat domain 13C". Chatr-Aryamontri A, Oughtred R, Boucher L, Rust J, Chang C, Kolas NK, ...
KN motif and ankyrin repeat domain-containing protein 1 is a protein that in humans is encoded by the KANK1 gene. This gene ... "Entrez Gene: ANKRD15 ankyrin repeat domain 15". Human KANK1 genome location and KANK1 gene details page in the UCSC Genome ... Sarkar S, Roy BC, Hatano N, Aoyagi T, Gohji K, Kiyama R (Sep 2002). "A novel ankyrin repeat-containing gene (Kank) located at ... Zhu Y, Kakinuma N, Wang Y, Kiyama R (Jan 2008). "Kank proteins: a new family of ankyrin-repeat domain-containing proteins". ...
"Entrez Gene: KRIT1 KRIT1, ankyrin repeat containing". Pagenstecher A, Stahl S, Sure U, Felbor U (Mar 2009). "A two-hit ... a novel ankyrin repeat-containing protein encoded by a gene mapping to 7q21-22". Oncogene. 15 (9): 1043-9. doi:10.1038/sj.onc. ...
NOTCH regulated ankyrin repeat protein is a protein that in humans is encoded by the NRARP gene. GRCh38: Ensembl release 89: ... Chu BF, Qin YY, Zhang SL, Quan ZW, Zhang MD, Bi JW (July 2016). "Downregulation of Notch-regulated Ankyrin Repeat Protein ... Imaoka T, Okutani T, Daino K, Iizuka D, Nishimura M, Shimada Y (May 2014). "Overexpression of NOTCH-regulated ankyrin repeat ... "Entrez Gene: NOTCH regulated ankyrin repeat protein". Retrieved 2018-04-27. ...
This gene is a member of the muscle ankyrin repeat protein (MARP) family and encodes a protein with four tandem ankyrin-like ... 2003), "The muscle ankyrin repeat proteins: CARP, ankrd2/Arpp and DARP as a family of titin filament-based stress response ... Ankyrin repeat domain-containing protein 23 is a protein that in humans is encoded by the ANKRD23 gene. ... "Entrez Gene: ANKRD23 ankyrin repeat domain 23". Miller, Melanie K; Bang Marie-Louise; Witt Christian C; Labeit Dietmar; ...
Hayashi T, Su TP (Jan 2001). "Regulating ankyrin dynamics: Roles of sigma-1 receptors". Proceedings of the National Academy of ...
"ANK2 ankyrin 2 [Homo sapiens (human)] - Gene - NCBI". www.ncbi.nlm.nih.gov. Retrieved 2017-04-06. "KCNE1 potassium voltage- ...
... where ankyrin should be bound in the L1CAM family cytoplasmic terminus. Ankyrin-L1CAM interaction is involved in the growth ... Ankyrin interaction with L1CAM is an example of a protein binding that fails in CRASH patients due to a mutation that causes ... The most important binding partners of the cytoplasmic tail of L1 proteins are ankyrins. The interaction is held in high- ... "Tyrosine phosphorylation at a site highly conserved in the L1 family of cell adhesion molecules abolishes ankyrin binding and ...
Jenkins SM, Bennett V (November 2001). "Ankyrin-G coordinates assembly of the spectrin-based membrane skeleton, voltage-gated ... "Ankyrin-based subcellular gradient of neurofascin, an immunoglobulin family protein, directs GABAergic innervation at purkinje ... "The phosphorylation state of the FIGQY tyrosine of neurofascin determines ankyrin-binding activity and patterns of cell ... "Structural requirements for association of neurofascin with ankyrin". The Journal of Biological Chemistry. 273 (46): 30785-94. ...
They are derived from natural ankyrin repeat proteins. Repeat proteins are among the most common classes of binding proteins in ... Plückthun, A (2015). "Designed ankyrin repeat proteins (DARPins): binding proteins for research, diagnostics, and therapy". ... soluble and stable proteins from combinatorial libraries of consensus ankyrin repeat proteins". Journal of Molecular Biology. ... "High-affinity binders selected from designed ankyrin repeat protein libraries". Nature Biotechnology. 22 (5): 575-582. doi: ...
Tetratricopeptide repeat and ankyrin repeat containing 1 is a protein that in humans is encoded by the TRANK1 gene. Through a ... "Entrez Gene: Tetratricopeptide repeat and ankyrin repeat containing 1". Mühleisen TW, Leber M, Schulze TG, Strohmaier J, ...
Ankyrin repeat domain-1 was overexpressed in both groups. Underexpressed genes in both groups included myosin light chain ...
These orthologs share a similarity with POTEB largely due to the presence of ankyrin repeats, suggesting that ankyrin domain- ... POTE ankyrin domain family, member B is a protein in humans that is encoded by the POTEB gene.(Prostate, Ovary, Testes ... "Entrez Gene: POTE ankyrin domain family, member B". Retrieved 2012-11-26. Mosavi LK, Cammett TJ, Desrosiers DC, Peng ZY (June ... POTEB is most likely involved in mediating protein-protein interaction via its 5 ankyrin domains. POTEB is most probably aids ...
In addition, ankyrin repeats are known to mediate protein-protein interactions. Furthermore, CLIP1, a paralog of CLIP4 in ... In terms of conserved domains, the CLIP4 gene contains primarily ankyrin repeats and the eponymous CAP-Gly domains. The ... Li J, Mahajan A, Tsai MD (December 2006). "Ankyrin repeat: a unique motif mediating protein-protein interactions". Biochemistry ... Two CAP-Gly domains and numerous ankyrin repeats. The secondary structure of CLIP4 consists largely of random coil, with alpha ...
Ankyrin repeats were believe to assist in the protein-protein interactions. The ankyrin repeat proteins could interact directly ... Li J, Mahajan A, Tsai MD (December 2006). "Ankyrin repeat: a unique motif mediating protein-protein interactions". Biochemistry ...
Ankyrin repeat and SOCS box protein 1 is a protein that is in humans, encoded by the ASB1 gene. The protein encoded by this ... They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS ... "Entrez Gene: ASB1 ankyrin repeat and SOCS box-containing 1". CS1 maint: discouraged parameter (link) Human ASB1 genome location ... 2001). "Cloning and characterization of the genes encoding the ankyrin repeat and SOCS box-containing proteins Asb-1, Asb-2, ...
Ankyrin repeat and SOCS box protein 3 is a protein that in humans is encoded by the ASB3 gene. The protein encoded by this gene ... They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS ... "Entrez Gene: ASB3 ankyrin repeat and SOCS box-containing 3". CS1 maint: discouraged parameter (link) Human ASB3 genome location ... Chung AS, Guan YJ, Yuan ZL, Albina JE, Chin YE (May 2005). "Ankyrin repeat and SOCS box 3 (ASB3) mediates ubiquitination and ...
... is in the protein family that contains ankyrin-repeat domains. Ankyrin repeats are known for mediating protein-protein ... Ankyrin repeat domain-containing protein 24 is a protein in humans that is coded for by the ANKRD24 gene. The gene is also ... "ANKRD24 ankyrin repeat domain 24 [Homo sapiens (human)] - Gene - NCBI". www.ncbi.nlm.nih.gov. Retrieved 2016-05-09. "Gene Card ... "ANKRD24 ankyrin repeat domain 24 [Homo sapiens (human)] - Gene - NCBI". www.ncbi.nlm.nih.gov. Retrieved 2016-04-27. "EST ...
Ankyrin repeat domain-containing protein 27 is a protein that in humans is encoded by the ANKRD27 gene. GRCh38: Ensembl release ... "Entrez Gene: ANKRD27 ankyrin repeat domain 27 (VPS9 domain)". Human ANKRD27 genome location and ANKRD27 gene details page in ...
They are derived from natural ankyrin repeat proteins, one of the most common classes of binding proteins in nature, which are ... DARPins correspond to the average size of natural ankyrin repeat protein domains. Proteins with fewer than three repeats (i.e ... Mosavi, L. K.; Minor, D. L.; Peng, Z. -Y. (2002). "Consensus-derived structural determinants of the ankyrin repeat motif". ... Simon M, Frey R, Zangemeister-Wittke U, Plückthun A (2013). "rthogonal assembly of a designed ankyrin repeat protein-cytotoxin ...
Either the ankyrin repeats alone or the AAA+ domain were found to be insufficient to support disaggregation activity. With only ... Notably, the presence of ankyrin repeats replaced the first of two ATPase domains found in bacteria and fungi. Skd3 belongs to ... In humans, the presence of ankyrin repeats replaced the first of two ATPase domains found in bacteria and fungi, which might ... Mosavi LK, Cammett TJ, Desrosiers DC, Peng ZY (June 2004). "The ankyrin repeat as molecular architecture for protein ...
Ankyrin repeat domain 11 is a protein that in humans is encoded by the ANKRD11 gene.[5] ... ANKRD11, ANCO-1, ANCO1, LZ16, T13, ankyrin repeat domain 11. External IDs. OMIM: 611192 MGI: 1924337 HomoloGene: 69134 ... This locus encodes an ankyrin repeat domain-containing protein. The encoded protein inhibits ligand-dependent activation of ... "Characterization of transcriptional regulatory domains of ankyrin repeat cofactor-1". Biochem. Biophys. Res. Commun. 358 (4): ...
Ankyrin-B syndrome is associated with a variety of heart problems related to disruption of the hearts normal rhythm ( ... Ankyrin-B syndrome is caused by mutations in the ANK2 gene, which provides instructions for making a protein called ankyrin-B. ... Ankyrin-B syndrome is inherited in an autosomal dominant pattern. , which means one copy of the altered ANK2 gene in each cell ... Ankyrin-B syndrome: a case of sinus node dysfunction, atrial fibrillation and prolonged QT in a young adult. Heart Lung Circ. ...
DARPin (designed ankyrin repeat protein), an engineered antibody mimetic based on the structure of ankyrin repeats PDB: 1N11​; ... Ankyrins at the US National Library of Medicine Medical Subject Headings (MeSH) Proteopedia 1n11 Ankyrin-R. ... These two properties in combination give rise to large repertoire of proteins ankyrin can recognise. Ankyrins are encoded by ... AnkyrinR was first characterized in human erythrocytes, where this ankyrin was referred to as erythrocyte ankyrin or band2.1. ...
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
Ankyrin repeat (IPR002110). Short name: Ankyrin_rpt Description. The ankyrin repeat is one of the most common protein-protein ... The ankyrin fold appears to be defined by its structure rather than its function since there is no specific sequence or ... Ankyrin repeats are tandemly repeated modules of about 33 amino acids. They occur in a large number of functionally diverse ... Hundreds of ankyrin-like repeats in functionally diverse proteins: mobile modules that cross phyla horizontally?. Proteins 17 ...
Ankyrin repeats typically fold together to form a single, linear solenoid structure called ankyrin repeat domains. These ... A structure-based study involving a range of ankyrin proteins of known structures, shows that consensus-based ankyrin proteins ... A specialized family of ankyrin proteins known as muscle ankyrin repeat proteins (MARPs) are involved with the repair and ... designed ankyrin repeat protein), an engineered antibody mimetic based on the structure of ankyrin repeats PDB: 1N11​; Michaely ...
Death_ank3; Death domain of Ankyrin-3. cd00204. Location:62 → 187. ANK; ankyrin repeats; ankyrin repeats mediate protein- ... Death_ank3; Death domain of Ankyrin-3. cd00204. Location:51 → 176. ANK; ankyrin repeats; ankyrin repeats mediate protein- ... Death_ank3; Death domain of Ankyrin-3. cd00204. Location:68 → 193. ANK; ankyrin repeats; ankyrin repeats mediate protein- ... Death_ank3; Death domain of Ankyrin-3. cd00204. Location:68 → 193. ANK; ankyrin repeats; ankyrin repeats mediate protein- ...
Ank_2; Ankyrin repeats (3 copies). pfam13637. Location:75 → 128. Ank_4; Ankyrin repeats (many copies). ... Ank_2; Ankyrin repeats (3 copies). pfam13637. Location:75 → 128. Ank_4; Ankyrin repeats (many copies). ... ANKRD49 ankyrin repeat domain 49 [Homo sapiens] ANKRD49 ankyrin repeat domain 49 [Homo sapiens]. Gene ID:54851 ... ankyrin repeat domain 49provided by HGNC. Primary source. HGNC:HGNC:25970 See related. Ensembl:ENSG00000168876 Gene type. ...
Ankyrin-3 isoform X26Imported. ,p>Information which has been imported from another database using automatic procedures.,/p> ,p ... IPR040745 Ankyrin_UPA. IPR011029 DEATH-like_dom_sf. IPR000488 Death_domain. IPR000906 ZU5_dom. ... IPR040745 Ankyrin_UPA. IPR011029 DEATH-like_dom_sf. IPR000488 Death_domain. IPR000906 ZU5_dom. ... tr,A0A480SDG8,A0A480SDG8_PIG Ankyrin-3 isoform X26 OS=Sus scrofa OX=9823 PE=4 SV=1 ...
... Niaz Mahmood1 and Nahid Tamanna2 ... Ankyrin (ANK) repeat containing proteins are evolutionary conserved and have functions in crucial cellular processes like cell ...
IPR002110. Ankyrin_rpt. IPR020683. Ankyrin_rpt-contain_dom. IPR036770. Ankyrin_rpt-contain_sf. ... IPR002110. Ankyrin_rpt. IPR020683. Ankyrin_rpt-contain_dom. IPR036770. Ankyrin_rpt-contain_sf. ... AnkyrinImported. ,p>Information which has been imported from another database using automatic procedures.,/p> ,p>,a href="/ ... tr,P97582,P97582_RAT Ankyrin (Fragment) OS=Rattus norvegicus GN=Ank2 PE=2 SV=1 ...
Tam H.K., Malviya V.N., Pos K.M. (2018) High-Resolution Crystallographic Analysis of AcrB Using Designed Ankyrin Repeat ... High-Resolution Crystallographic Analysis of AcrB Using Designed Ankyrin Repeat Proteins (DARPins). ... High-affinity binders selected from designed ankyrin repeat protein libraries. Nat Biotechnol 22:575-582CrossRefPubMedGoogle ... soluble and stable proteins from combinatorial libraries of consensus ankyrin repeat proteins. J Mol Biol 332:489-503CrossRef ...
Compare Ankyrin repeat domain 12 ELISA Kits from leading suppliers on Biocompare. View specifications, prices, citations, ... Ankyrin repeat domain 12 ELISA Kits. The ELISA (enzyme-linked immunosorbent assay) is a widely used application for detecting ... Your search returned 20 Ankyrin repeat domain 12 ELISA ELISA Kit across 6 suppliers. ...
The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex assemblies. As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
... uses its ankyrin repeat clusters (ARCs) to bind a wide range of proteins and thereby controls diverse cellular functions. A ... Tankyrase-1 Ankyrin Repeats Form an Adaptable Binding Platform for Targets of ADP-Ribose Modification. Structure 24, 1679-1692 ... Pollock, K., Liu, M., Zaleska, M. et al. Fragment-based screening identifies molecules targeting the substrate-binding ankyrin ... The PARP enzyme and scaffolding protein tankyrase (TNKS, TNKS2) uses its ankyrin repeat clusters (ARCs) to bind a wide range of ...
Ankyrin Repeat. Protein Motif that contains a 33-amino acid long sequence that often occurs in tandem arrays. This repeating ... Ankyrin repeats cooperatively fold into domains that mediate molecular recognition via protein-protein interactions. ... sequence of 33-Amino Acids was discovered in Ankyrin where it is involved in interaction with the anion exchanger (Anion ...
Compare Ankyrin repeat domain 29 ELISA Kits from leading suppliers on Biocompare. View specifications, prices, citations, ... Ankyrin repeat domain 29 ELISA Kits. The ELISA (enzyme-linked immunosorbent assay) is a well-established antibody-based tool ... Your search returned 13 Ankyrin repeat domain 29 ELISA ELISA Kit across 1 supplier. ...
X-ray structural analysis of the yeast cell cycle regulator Swi6 reveals variations of the ankyrin fold and has implications ...
Our findings introduce what we believe to be a new pathway for ACM, a role of ankyrin-B in cardiac structure and signaling, a ... Following identification of deceased ACM probands possessing ANK2 rare variants and evidence of ankyrin-B loss of function on ... Ankyrin-B dysfunction predisposes to arrhythmogenic cardiomyopathy and is amenable to therapy. ... Ankyrin-B dysfunction predisposes to arrhythmogenic cardiomyopathy and is amenable to therapy. ...
James Trimmers lab contains the insert anti-Ankyrin-R (Homo sapiens) recombinant mouse monoclonal antibody and is published in ... Plasmid Anti-Ankyrin-R [N388A/10R] from Dr. ... Anti-Ankyrin-R [N388A/10R] was a gift from James Trimmer ( ... Mammalian Expression Plasmid of anti-Ankyrin-R (Human). Derived from hybridoma N388A/10. ...
... ankyrin repeat explanation free. What is ankyrin repeat? Meaning of ankyrin repeat medical term. What does ankyrin repeat mean? ... Looking for online definition of ankyrin repeat in the Medical Dictionary? ... ankyrin repeat. Also found in: Wikipedia. ankyrin repeat. A short repetitive sequence of amino acids consisting of a beta ... Ankyrin repeats were first identified in ankyrin, which tethers different proteins (e.g., nuclear and cytoplasmic proteins), ...
There are no specific protocols for Anti-Ankyrin brain antibody [N105/13] (ab131419). Please download our general protocols ...
Specifically, we generated knockin mice that express either the human ankyrin-B variant R1788W, which is present in 0.3% of ... Ankyrin-B metabolic syndrome combines age-dependent adiposity with pancreatic β cell insufficiency. ... Ankyrin-B metabolic syndrome combines age-dependent adiposity with pancreatic β cell insufficiency. ... GLUT4 trafficking was altered in animals expressing mutant forms of ankyrin-B, and we propose that increased cell surface ...
Diversity in membrane binding sites of ankyrins. Brain ankyrin, erythrocyte ankyrin, and processed erythrocyte ankyrin ... Diversity in membrane binding sites of ankyrins. Brain ankyrin, erythrocyte ankyrin, and processed erythrocyte ankyrin ... Moreover, analysis of rat 190-kDa ankyrin G/ankyrin B chimeras shows that all three domains of 190-kDa ankyrin-G are required ... Ankyrins G and B also exhibit differences; mutations affecting spectrin binding had no effect on ankyrin-B function but did ...
Browse our Ankyrin Repeat Domain 33B product catalog backed by our Guarantee+. ... Ankyrin Repeat Domain 33B products available through Novus Biologicals. ... Bioinformatics Tool for Ankyrin Repeat Domain 33B. Discover related pathways, diseases and genes to Ankyrin Repeat Domain 33B. ...
Homo sapiens (human) : ANKRD13C (ankyrin repeat domain 13C) HGNC Alliance Rattus norvegicus (Norway rat) : Ankrd13c (ankyrin ... Pan paniscus (bonobo/pygmy chimpanzee) : ANKRD13C (ankyrin repeat domain 13C) Canis lupus familiaris (dog) : ANKRD13C (ankyrin ... Sus scrofa (pig) : ANKRD13C (ankyrin repeat domain 13C) Chlorocebus sabaeus (green monkey) : ANKRD13C (ankyrin repeat domain ... Ankrd13c (ankyrin repeat domain 13C). Transitive Ortholog Pipeline. Transitive Ortholog Pipeline. Sus scrofa (pig):. ANKRD13C ( ...
... Eur J Nucl Med Mol Imaging. 2015 Feb; ... The designed ankyrin repeat protein (DARPin) G3 binds HER2 with high affinity at an epitope that does not overlap with ...
SHANK2, SH3 and multiple ankyrin repeat domains 2. Orthology source: HomoloGene, HGNC ...
In our study we showed spectrin doesnt have to bind to ankyrin to d...,Ghost,protein,leaves,fresh,tracks,in,the,cell, ... Spectrin and ankyrin are two essential proteins acting like bricks and...Ron Dubreuil associate professor of biological ... Spectrin and ankyrin are two essential proteins acting like bricks and mortar to shape and fortify cell membranes. But ... "In our study, we showed spectrin doesnt have to bind to ankyrin to do its job," said Dubreuil. "This hints at a complexity we ...
offers a broad range of Ankyrin CRISPR/Cas9 Knockout plasmids and Ankyrin Double Nickase Plasmids. ... Ankyrin gene silencers are available as Ankyrin CRISPR/Cas9 Knockout plasmids and Ankyrin Double Nickase Plasmids. Ankyrin ... Ankyrin Antibodies for analysis of cellular responses to Ankyrin CRISPR Products * For further details describing the CRISPR ... Ankyrin G CRISPR Activation Plasmid (h2) sc-400421-ACT-2. h. Gene Activation. Puro, Blast, Hygro. ...
  • Ankyrin repeat domain 11 is a protein that in humans is encoded by the ANKRD11 gene . (wikipedia.org)
  • This locus encodes an ankyrin repeat domain-containing protein. (wikipedia.org)
  • Ankyrin-B syndrome is caused by mutations in the ANK2 gene, which provides instructions for making a protein called ankyrin-B. This protein is active in many cell types, including heart (cardiac) muscle cells. (medlineplus.gov)
  • Mutations in the ANK2 gene lead to production of an altered ankyrin-B protein that cannot target ion channels to their correct locations in cardiac muscle cells. (medlineplus.gov)
  • Defects in ankyrin-based membrane protein targeting pathways underlie atrial fibrillation. (medlineplus.gov)
  • The ankyrin repeat is one of the most common protein-protein interaction motifs in nature. (ebi.ac.uk)
  • Domains consisting of ankyrin tandem repeats mediate protein-protein interactions and are among the most common structural motifs in known proteins. (wikipedia.org)
  • Most proteins that contain the motif have four to six repeats, although its namesake ankyrin contains 24, and the largest known number of repeats is 34, predicted in a protein expressed by Giardia lamblia. (wikipedia.org)
  • The residues on the wide lateral surface of ankyrin repeat structures are variable, often hydrophobic, and involved mainly in mediating protein-protein interactions. (wikipedia.org)
  • More extensive design strategies have used combinatorial sequences to "evolve" ankyrin-repeats that recognize particular protein targets, a technique that has been presented as an alternative to antibody design for applications requiring high-affinity binding. (wikipedia.org)
  • Ankyrin-repeat proteins present an unusual problem in the study of protein folding, which has largely focused on globular proteins that form well-defined tertiary structure stabilized by long-range, nonlocal residue-residue contacts. (wikipedia.org)
  • The PARP enzyme and scaffolding protein tankyrase (TNKS, TNKS2) uses its ankyrin repeat clusters (ARCs) to bind a wide range of proteins and thereby controls diverse cellular functions. (nature.com)
  • This repeating sequence of 33- Amino Acids was discovered in Ankyrin where it is involved in interaction with the anion exchanger ( Anion Exchange Protein 1, Erythrocyte ). (online-medical-dictionary.org)
  • Ankyrin repeats cooperatively fold into domains that mediate molecular recognition via protein-protein interactions. (online-medical-dictionary.org)
  • Background: The Notch-regulated ankyrin repeat protein (NRARP) is recently found to promote proliferation of breast cancer cells. (thefreedictionary.com)
  • In a one-year re-integration phase I will perform follow-up mechanistic structural studies in the Olga Mayans lab (University of Liverpool) to determine the structural basis how the CARP (cardiac ankyrin repeat protein)-titin signaling axis mediates cardiomyocyte protection, and in the Labeit lab (University of Heidelberg, Medical Faculty Mannheim) how to perturb activity of this complex by small molecules. (thefreedictionary.com)
  • The Z-disk proteins include [alpha]-actinin 2, cardiac ankyrin repeat protein, muscle LIM protein, LIM binding domain 3, myozenin 2, telethonin, and vinculin/metavinculin. (thefreedictionary.com)
  • The Coxiella burnetii ankyrin repeat domain-containing protein family is heterogeneous. (thefreedictionary.com)
  • ANKRD1, the gene encoding cardiac ankyrin repeat protein, is a novel dilated cardiomyopathy gene. (thefreedictionary.com)
  • The designed ankyrin repeat protein (DARPin) G3 binds HER2 with high affinity at an epitope that does not overlap with trastuzumab and is biologically inert. (nih.gov)
  • We have selected designed ankyrin repeat proteins (DARPins) from a synthetic library by using ribosome display that selectively bind to the mitogen-activated protein kinase ERK2 (extracellular signal-regulated kinase 2) in either its nonphosphorylated (inactive) or doubly phosphorylated (active) form. (pnas.org)
  • ank A: an Ehrlichia phagocytophila group gene encoding a cytoplasmic protein antigen with ankyrin repeats. (thefreedictionary.com)
  • High-affinity binders selected from designed ankyrin repeat protein libraries. (grstiftung.ch)
  • The structure shows how an ETS domain protein can recruit a partner protein using both the ETS domain and a carboxyl-terminal extension and provides a view of an extensive protein-protein interface formed by a set of ankyrin repeats. (sciencemag.org)
  • The GABP complex is composed of two subunits: an ETS family member, GABPα, and an ankyrin repeat-containing protein, GABPβ ( 13 , 15 ). (sciencemag.org)
  • It concentrates multiple membrane proteins such as ion channels and cell adhesion molecules (CAMs) that are recruited to the AIS by the scaffold protein ankyrin G (ankG). (frontiersin.org)
  • At the molecular level, the AIS is organized by ankyrin G (ankG), a specialized scaffolding protein that directly binds to the submembrane cytoskeletal lattice of ßIV-spectrin (ßIVsp) and actin. (frontiersin.org)
  • The TRP Ankyrin 1 (TRPA1) ion channel is a unique member of the mammalian TRP superfamily, containing a large N-terminal ankyrin repeat domain (ARD) which constitutes half of the entire protein. (lu.se)
  • Immunoprecipitation and immunoblot analyses indicate that Tiam1 and the cytoskeletal protein, ankyrin, are physically associated as a complex in vivo. (rupress.org)
  • Cotransfection of SP1 cells with green fluorescent protein (GFP)-tagged Tiam1 fragment cDNA and Tiam1 cDNA effectively blocks Tiam1-ankyrin colocalization in the cell membrane, and inhibits GDP/GTP exchange on Rac1 by ankyrin-associated Tiam1 and tumor-specific phenotypes. (rupress.org)
  • Together, these considerations suggest the membrane lipid environment and in particular phosphoinositides and protein palmitoylation are likely to work in concert with ankyrin- and spectrin-based protein interactions in establishing and/or regulating membrane domains. (rupress.org)
  • In this study, we have cloned the ankB gene, encoding an ankyrin-like protein in Pseudomonas aeruginosa . (asm.org)
  • The ankB gene is composed of 549 bp encoding a protein of 183 amino acids that possesses four 33-amino-acid ankyrin repeats that are a hallmark of erythrocyte and brain ankyrins. (asm.org)
  • Here we report that ankyrin-B (AnkB), a well-characterized adaptor protein involved in linking the spectrin-actin cytoskeleton to integral membrane proteins, is required for membrane association of Prx in lens fibers and colocalizes with Prx in hexagonal fiber cells. (sigmaaldrich.com)
  • Phytochrome-interacting ankyrin repeat protein 2 (PIA2) was found to interact with phytochrome interacting factor 3 (PIF3), a well-known repressor of plant photomorphogenesis in response to phytochrome-mediated light signalling. (ovid.com)
  • The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. (creative-biogene.com)
  • Site-Selective Enzymatic Labeling of Designed Ankyrin Repeat Proteins Using Protein Farnesyltransferase. (uzh.ch)
  • Ankyrin-Like Protein AnkB Interacts with CatB, Affects Catalase Activity, and Enhances Resistance of Xanthomonas oryzae pv. (asm.org)
  • A member of the adaptor protein family, ankyrin protein, has been investigated largely in humans but rarely in plant-pathogenic bacteria. (asm.org)
  • In this study, a novel ankyrin-like protein, AnkB, was identified in X. oryzae pv. (asm.org)
  • Together our results indicate that the ankyrin-like protein AnkB has important and conserved roles in antioxidant systems and pathogenicity in X. oryzae pv. (asm.org)
  • IMPORTANCE This study demonstrates that the ankyrin protein AnkB directly interacts with catalase CatB in Xanthomonas oryzae pv. (asm.org)
  • Ankyrin protein AnkB can affect the gene expression of catB , catalase activity, and sensitivity to H 2 O 2 . (asm.org)
  • Tankyrase 1 and tankyrase 2 are poly(ADP-ribosyl)ases that are distinguishable from other members of the enzyme family by the structural features of the catalytic domain, and the presence of a sterile α-motif multimerization domain and an ankyrin repeat protein-interaction domain. (gopubmed.org)
  • Here we report that ankyrin-B (AnkB), through integrating all three systems, functions as a critical node in the protein circuitry underlying polarized recycling of α5β1-integrin in mouse embryonic fibroblasts, which enables persistent fibroblast migration along fibronectin gradients. (elifesciences.org)
  • discover that a protein called ankyrin-B coordinates the directional transport of specific vesicles within migrating cells. (elifesciences.org)
  • Ankyrin-B then recruits molecular motors and another protein called RabGAP1L, which regulates the activity of GTPases, to direct the movements of the vesicles. (elifesciences.org)
  • Ankyrin B is a scaffold protein that functions to link proteins that mediate the attachment of integral membrane proteins to the spectrin-actin based membrane cytoskeleton. (antibodiesinc.com)
  • In this study, we mapped the major immunodeterminants of the E. chaffeensis 200-kDa ankyrin protein (Ank200) and the minor immunodeterminants in the N- and C-terminal regions of E. chaffeensis TRP47. (asm.org)
  • formerly named VLPT [variable-length PCR target]), TRP47, TRP120, and Ank200 (200-kDa ankyrin protein), and all are strongly recognized by sera from HME patients and E. chaffeensis -infected dogs ( 6 , 9 - 11 , 17 ). (asm.org)
  • To explore this question, we identified and characterized ankyrin-B associated macromolecular complexes from the mouse lens since this scaffolding protein has been found to be essential for lens architecture and transparency. (arvojournals.org)
  • These ongoing studies aimed at elucidating the molecular mechanisms regulating lens fiber cell membrane organization and stability identify ankyrin-B as a crucial scaffolding protein which serves to link and organize various cytoskeletal proteins, adaptor proteins, cell adhesive proteins and channel proteins to the fiber cell plasma membrane. (arvojournals.org)
  • Phosphorylation of ankyrin down-regulates its cooperative interaction with spectrin and protein 3. (semanticscholar.org)
  • Below are the list of possible Ankyrin repeat and KH domain-containing protein products. (mybiosource.com)
  • Also known as Ankyrin repeat and KH domain-containing protein 1 (HIV-1 Vpr-binding ankyrin repeat protein) (Multiple ankyrin repeats single KH domain) (hMASK). (mybiosource.com)
  • This gene encodes a protein with multiple ankyrin repeat domains and a single KH-domain. (mybiosource.com)
  • Also known as Ankyrin repeat and KH domain-containing protein mask (Multiple ankyrin repeat single KH domain-containing protein). (mybiosource.com)
  • NrCAM is expressed specifically at node of ranvier where it interacts with the cytoskeletal adaptor protein ankyrin-G with the conserved motif F1272IGQY. (reactome.org)
  • In this study, we determined the role of the adaptor protein ankyrin-G which localizes exclusively to ROS in targeting and maintenance of the CNG channels. (arvojournals.org)
  • We determined the role of ankyrin-G in localizing CNG channels to ROS in vivo by protein knockdown which was accomplished by electroporation of shRNA into mouse retina. (arvojournals.org)
  • Erythrocyte-related isoforms of ankyrin attach the SPECTRIN cytoskeleton to a transmembrane protein (ANION EXCHANGE PROTEIN 1, ERYTHROCYTE) in the erythrocyte plasma membrane. (sickkids.ca)
  • Hundreds of ankyrin-like repeats in functionally diverse proteins: mobile modules that cross phyla horizontally? (ebi.ac.uk)
  • Ankyrins are a family of proteins that mediate the attachment of integral membrane proteins to the spectrin-actin based membrane cytoskeleton. (wikipedia.org)
  • Ankyrins have binding sites for the beta subunit of spectrin and at least 12 families of integral membrane proteins. (wikipedia.org)
  • Ankyrins contain four functional domains: an N-terminal domain that contains 24 tandem ankyrin repeats, a central domain that binds to spectrin, a death domain that binds to proteins involved in apoptosis, and a C-terminal regulatory domain that is highly variable between different ankyrin proteins. (wikipedia.org)
  • The 24 tandem ankyrin repeats are responsible for the recognition of a wide range of membrane proteins. (wikipedia.org)
  • These non-specific interactions give ankyrin the property to recognise a large range of proteins as the sequence doesn't have to be conserved, just the properties of the amino acids. (wikipedia.org)
  • These two properties in combination give rise to large repertoire of proteins ankyrin can recognise. (wikipedia.org)
  • The ankyrin repeat is a 33-residue motif in proteins consisting of two alpha helices separated by loops, first discovered in signaling proteins in yeast Cdc10 and Drosophila Notch. (wikipedia.org)
  • Ankyrin repeat proteins, though absent in most viruses, are common among poxviruses. (wikipedia.org)
  • A structure-based study involving a range of ankyrin proteins of known structures, shows that consensus-based ankyrin proteins are very stable since they maximize the energetic gap between the folding and unfolding structures, encoding a densely connected network of favourable interactions among conserved sequence motifs, like the TPLX motif. (wikipedia.org)
  • Ankyrin-repeat proteins have been associated with a number of human diseases. (wikipedia.org)
  • A specialized family of ankyrin proteins known as muscle ankyrin repeat proteins (MARPs) are involved with the repair and regeneration of muscle tissue following damage due to injury and stress. (wikipedia.org)
  • Ankyrins are a family of proteins that are believed to link the integral membrane proteins to the underlying spectrin-actin cytoskeleton and play key roles in activities such as cell motility, activation, proliferation, contact, and the maintenance of specialized membrane domains. (nih.gov)
  • Multiple isoforms of ankyrin with different affinities for various target proteins are expressed in a tissue-specific, developmentally regulated manner. (nih.gov)
  • Ankyrin (ANK) repeat containing proteins are evolutionary conserved and have functions in crucial cellular processes like cell cycle regulation and signal transduction. (hindawi.com)
  • Ankyrin repeats were first identified in ankyrin, which tethers different proteins (e.g., nuclear and cytoplasmic proteins), helping regulate gene expression and embryonic development. (thefreedictionary.com)
  • The active ingredient, which comprises several DARPins (designed ankyrin repeat proteins), is also easy to produce. (thefreedictionary.com)
  • Conformation-dependent recognition of HIV gp120 by designed ankyrin repeat proteins provides access to novel HIV entry inhibitors," Journal of Virology 87(10): 5868-5881. (thefreedictionary.com)
  • Spectrin and ankyrin are two essential proteins acting like bricks and. (bio-medicine.org)
  • Spectrin and ankyrin are two essential proteins acting like bricks and mortar to shape and fortify cell membranes. (bio-medicine.org)
  • The Rh antigens are expressed as part of an ankyrin complex in the red blood cell (RBC) membrane as a heterotrimer consisting of one molecule of Rh-associated glycoprotein (RhAG) and two molecules of Rh proteins. (thefreedictionary.com)
  • Heavier proteins in our SDS-PAGE assays that coimmunoprecipitate with each of the RPeL27 and RPeL43 proteins (Figure 2(b)) were later identified as POTE Ankyrin Family Member E- tubulin alpha 1A (POTEE-TUBA1A) and beta actin-beta actin-like 2 (ACTB-ACTBL2) complexes via the MALDI-TOF analysis (Table 2). (thefreedictionary.com)
  • In den letzten fünf Jahren wurden von uns "Designed Ankyrin Repeat Proteins" (DARPins) entwickelt, die eine neue Klasse von vielversprechenden Proteintherapeutika darstellen. (grstiftung.ch)
  • Selection and Characterization of Her2 Binding-designed Ankyrin Repeat Proteins. (grstiftung.ch)
  • Ankyrin G 480/270 kDa and three ankyrin-binding integral membrane proteins (neurofascin, NrCAM, and the voltage-dependent sodium channel) colocalize within a specialized domain of the spectrin-actin network found at axonal segments of nodes of Ranvier in myelinated axons. (jneurosci.org)
  • We found that the intracellular pathogens Legionella pneumophila and Coxiella burnetii use a type IV secretion system to deliver into eukaryotic cells a large number of different bacterial proteins containing ankyrin repeat homology domains called Anks. (sciencemag.org)
  • Many bacterial pathogens and endosymbionts use TFSSs to regulate host processes important for survival and replication ( 2 ), and several of these organisms have a large number of genes encoding proteins with multiple ankyrin repeat homology domains (ARHDs) ( 3 - 7 ). (sciencemag.org)
  • Ankyrins are structural proteins in human erythrocytes and brain that bridge the spectrin exoskeleton to the cytoplasmic surface of the plasma membrane ( 5 ). (asm.org)
  • Integral membrane proteins that associate with ankyrin both in vivo and in vitro include the band III anion exchanger ( 15 ), Na + /K + -ATPase ( 15 ), and multiple sodium channels ( 51 , 52 ). (asm.org)
  • Many intracellular bacterial pathogens utilize the Type 1 (T1SS) or Type 4 secretion system (T4SS) to translocate ankyrin repeat-containing proteins (Anks) that traffic to distinct subcellular locations and modulate host cell processes. (frontiersin.org)
  • We show here that with very small high-affinity proteins such as designed ankyrin repeat proteins (DARPins), these limits can be overcome. (aacrjournals.org)
  • We show here that with very small high-affinity proteins such as designed ankyrin repeat proteins (DARPins), these limits can be overcome, and we present a systematic approach that establishes the observed tumor accumulation and targeting contrast as a function of affinity, targeting molecule size, and pharmacokinetics. (aacrjournals.org)
  • Recently, we have developed combinatorial libraries of a new class of small proteins, termed "designed ankyrin repeat proteins" ( 19 , 20 ) that can act as an alternative to antibodies, as they are particularly robust to engineering. (aacrjournals.org)
  • In this protocol, we present a detailed procedure for labeling Designed Ankyrin Repeat Proteins (DARPins) engineered with a C-terminal CVIA sequence using an azide-containing FPP analog by yeast PFTase (yPFTase). (uzh.ch)
  • In this manner, ankyrin family proteins play key roles in various processes including cell motility, activation, proliferation, contact and the maintenance of specialized membrane domains. (antibodiesinc.com)
  • Designed ankyrin repeat proteins (DARPins) are engineered scaffold proteins with high potential as probes for radionuclide molecular imaging. (diva-portal.org)
  • Nuclear import may be a conserved property of ankyrin repeat domains (ARDs), as the ARDs from two other ARD-containing proteins, 53BP2 and GABPbeta , are also able to function as nuclear import sequences. (caltech.edu)
  • Single-channel electrophysiological recordings of heterologously expressed and purified Anopheles gambiae TRPA1 (AgTRPA1), with and without the N-terminal ankyrin repeat domain, demonstrate that both proteins are functional because they responded to the electrophilic compounds allyl isothiocyanate and cinnamaldehyde as well as heat. (lu.se)
  • We have identified two Nicotiana plumbaginifolia ankyrin-repeat proteins, designated $$\underline{G}$$ lucanohydrolase $$\underline{B}$$ inding $$\underline{P}$$ roteins (GBP) 1 and 2, that bind GLU I and CHN I both in vitro and when expressed in yeast cells. (deepdyve.com)
  • Lenses obtained from 3 to 4 week-old BL6 strain mice were used to isolate Ankyrin B-associated proteins by immunoprecipitation (IP) using Ankyrin-B monoclonal antibody. (arvojournals.org)
  • Two independent analyses of ankyrin-B antibody derived IP complexes from detergent solubilized mouse lens homogenates revealed abundant amounts of several proteins including spectrin (both α and β), ankyrin B, plectin-1, filensin and phakinin. (arvojournals.org)
  • Many of these proteins were also confirmed to present in the Ankyrin-B immunoprecipitates by immunoblot analysis. (arvojournals.org)
  • Ongoing studies are focused on determining the nature of Ankyrin-B interaction with filensin, and on characterizing the stability and organization of several of the proteins which were found to co-exist with Ankyrin-B, using Ankyrin-B and Filensin KO mouse lenses. (arvojournals.org)
  • The membrane binding domain of ankyrin has two distinct binding sites for neurofascin and is proposed to form lateral complexes between ion channels and cell adhesion molecules as well as to couple these proteins to the spectrin based membrane skeleton. (reactome.org)
  • Using transgenic expression in Xenopus tadpoles, we found that ankyrin-G binding defective CNG-ß1 human mutant proteins localize to photoreceptor cell bodies in marked contrast to the wild type ß subunit which localized to ROS. (arvojournals.org)
  • The mechanisms responsible for concentrating sodium channels in these specialized membrane domains in axons are not established, but are likely to involve specialized members of the ankyrin family of spectrin-binding proteins. (rupress.org)
  • The principal adaptors are the ankyrin proteins, which bind to the beta-subunit of spectrin and to the cytoplasmic domains of numerous integral membrane proteins. (scienceexchange.com)
  • Ankyrin repeats are tandemly repeated modules of about 33 amino acids. (ebi.ac.uk)
  • Ankyrin repeats typically fold together to form a single, linear solenoid structure called ankyrin repeat domains. (wikipedia.org)
  • Considering the atomic structures of individual ankyrin repeats, the loop is often a type 1 beta bulge loop, while both alpha-helices commonly have a Schellman loop at their N-terminus. (wikipedia.org)
  • The same study shows that insertions in the canonical framework of ankyrin repeats are enriched in conflictive interactions, that are related to function. (wikipedia.org)
  • Ankyrin repeats, by contrast, contain very few such contacts (that is, they have a low contact order). (wikipedia.org)
  • Most studies have found that ankyrin repeats fold in a two-state folding mechanism, suggesting a high degree of folding cooperativity despite the local inter-residue contacts and the evident need for successful folding with varying numbers of repeats. (wikipedia.org)
  • The beta strands on adjacent ankyrin repeats combine to form a short antiparallel beta sheet. (thefreedictionary.com)
  • ANKYRIN repeats are found in TRPC, TRPV & TRPN subgroups. (bioportfolio.com)
  • Isoform 1 (1327 amino acids) contains region with homopolymeric runs of His, Pro, and Ser (HPS domain, aa 1-181), 15 ankyrin repeats (ANK 1 to 15, aa 215-934), multimerization domain homologous to the sterile alpha motif (SAM domain, aa 1030-1089) and PARP catalytic domain (aa 1112-1317). (atlasgeneticsoncology.org)
  • The α subunit contains a DNA-binding domain that is a member of the ETS family, whereas the β subunit contains a series of ankyrin repeats. (sciencemag.org)
  • GABPβ contains four-and-a-half ankyrin repeats at its NH 2 -terminus that mediate heterodimerization with GABPα ( 17 ). (sciencemag.org)
  • Induction of T-ALL correlated with the transactivation activity of each Notch1 polypeptide when fused to the DNA-binding domain of GAL4, with the exception of polypeptides deleted of the ankyrin repeats, which lacked transforming activity while retaining strong transactivation activity. (asm.org)
  • C terminal to the RAM domain lie six interated ankyrin repeats (ANK) (amino acids 1860 to 2155), a highly conserved domain necessary for all known Notch functions ( 1 ). (asm.org)
  • We propose that the Ikappa Balpha ankyrin repeats define a novel class of cis-acting nuclear import sequences. (caltech.edu)
  • Heteromeric TRPC3 with TRPC1 formed via its ankyrin repeats regulates the resting cytosolic Ca 2+ levels in skeletal muscle. (bentham.co.uk)
  • The ankyrin domain of Drosophila Notch contains six ankyrin sequence repeats previously identified as closely matching the ankyrin repeat consensus sequence, and a putative seventh C-terminal sequence repeat that exhibits lower similarity to the consensus sequence. (elsevier.com)
  • To better understand the role of the Notch ankyrin domain in Notch-mediated signaling and to examine how structure is distributed among the seven ankyrin sequence repeats, we have determined the crystal structure of this domain to 2.0 Å resolution. (elsevier.com)
  • Biopharmaceutical company Cubist Pharmaceuticals Inc (NASDAQ:CBST) and Hydra Biosciences Inc announced on Tuesday the joint proposal to commence a Phase 1 clinical study for a small molecule antagonist of the human Transient Receptor Potential Ankyrin repeat 1 (TRPA1) ion channel. (thefreedictionary.com)
  • today announced plans to begin a Phase 1 clinical trial for a small molecule antagonist of the human Transient Receptor Potential Ankyrin repeat 1 (TRPA1) ion channel discovered in a collaboration between Cubist and Hydra. (thefreedictionary.com)
  • Transient receptor potential vanilloid 4 (TRPV4) and transient receptor potential ankyrin 1 (TRPA1) have already been main focuses for comparatively mature studies currently. (thefreedictionary.com)
  • Other studies show that transient receptor potential vanilloid 1 (TRPV1) and ankyrin 1 (TRPA1), heat and cold sensors, respectively (Andrade et al. (thefreedictionary.com)
  • Transient receptor potential ankyrin 1 (TRPA1) is an ion channel known to mediate nociception and neurogenic inflammation, and to be activated by reactive oxygen and nitrogen species (ROS and RNS) produced at the sites of inflammation. (bioportfolio.com)
  • Transient Receptor Potential Ankyrin-1 (TRPA1) Channel Contributes to Myocardial Ischemia-Reperfusion Injury. (bioportfolio.com)
  • Ionic channels such as the transient receptor potential ankyrin 1 (TRPA1) are essential for the detection and transmission of painful stimuli. (bioportfolio.com)
  • In particular, one type of sensor named Transient Receptor Potential Ankyrin 1 (TRPA1) is studied. (lu.se)
  • Transient receptor potential ankyrin 1 (TRPA1) is coexpressed with TRPV1. (aspetjournals.org)
  • Important and extensively investigated are TRP vanilloid 1 (TRPV1) and TRP ankyrin 1 (TRPA1). (aspetjournals.org)
  • Transient receptor potential ankyrin 1 (TRPA1) channel plays an important role in pain and inflammation. (biomedcentral.com)
  • The role of the transient receptor potential ankyrin type-1 (TRPA1) channel in migraine pain: evaluation in an animal model. (physiciansweekly.com)
  • Clinical and experimental studies have pointed to the possible involvement of the transient receptor potential ankyrin type-1 (TRPA1) channels in migraine pain. (physiciansweekly.com)
  • The transient receptor potential ankyrin 1 (TRPA1) is a calcium-permeable cation channel that is expressed on capsaicin-sensitive sensory neurons, endothelial and inflammatory cells. (biomedcentral.com)
  • o-Chlorobenzylidene malononitrile (CS) is a selective and potent agonist of the transient receptor potential ankyrin repeat 1 (TRPA1), which is a transducer molecule in nociceptors sensing reactive chemical species. (ovid.com)
  • Here, we demonstrate based on Förster resonance energy transfer (FRET) and bilayer patch-clamp studies, a direct calmodulin-independent action of calcium on the purified human TRPA1 (hTRPA1), causing structural changes and activation without immediate subsequent desensitization of hTRPA1 with and without its N-terminal ankyrin repeat domain (N-ARD). (nanion.de)
  • There are currently no images for Ankyrin Brain Antibody (NBP2-22407IR). (novusbio.com)
  • Ankyrin antibody LS-C710038 is an HRP-conjugated rabbit polyclonal antibody to human Ankyrin (ANK1) (aa32-369). (lsbio.com)
  • Ankyrin 1 links membrane receptor CD44 to the inositol triphosphate receptor and the cytoskeleton. (wikipedia.org)
  • Ankyrin serves as the mortar that attaches spectrin to the red blood cell membrane. (bio-medicine.org)
  • A laboratory fly was genetically engineered so that spectrin could no longer bind to ankyrin -- which, Dubreuil assumed, meant that spectrin should no longer attach to the membrane. (bio-medicine.org)
  • These effects were rescued by expressing a recombinant AIS-targeted Nav or by a minimal construct containing the ankyrin-binding domain of Nav1.2 and a membrane anchor (mABD). (frontiersin.org)
  • Ankyrin-G and βII-spectrin colocalize at sites of cell-cell contact in columnar epithelial cells and promote lateral membrane assembly. (rupress.org)
  • We identify aspartate-histidine-histidine-cysteine 5/8 (DHHC5/8) as ankyrin-G palmitoyltransferases required for ankyrin-G lateral membrane localization and for assembly of lateral membranes. (rupress.org)
  • We also find that βII-spectrin functions as a coincidence detector that requires recognition of both ankyrin-G and phosphoinositide lipids for its lateral membrane localization. (rupress.org)
  • DHHC5/8 and βII-spectrin colocalize with ankyrin-G in micrometer-scale subdomains within the lateral membrane that are likely sites for palmitoylation of ankyrin-G. Loss of either DHHC5/8 or ankyrin-G-βII-spectrin interaction or βII-spectrin-phosphoinositide recognition through its pleckstrin homology domain all result in failure to build the lateral membrane. (rupress.org)
  • Interestingly, unlike the spherical nature of ankyrin-deficient erythrocytes, the cellular morphology of an ankB mutant was identical to that of wild-type bacteria, yet the mutant produced more membrane vesicles. (asm.org)
  • Ankyrin-B directs membrane tethering of periaxin and is required for maintenance of lens fiber cell hexagonal shape and mechanics. (sigmaaldrich.com)
  • Contribution of the band 3-ankyrin interaction to erythrocyte membrane mechanical stability. (semanticscholar.org)
  • In an effort to evaluate the role of the band 3-ankyrin linkage in maintenance of red blood cell membrane integrity, solution conditions were sought that would selectively dissociate the band 3-ankyrin linkage, leaving other membrane skeletal interactions intact. (semanticscholar.org)
  • Ankyrin G (−/−) neurons fail to concentrate voltage-sensitive sodium channels and neurofascin at their axon proximal segments, suggesting that ankyrin G is a key component of a structural pathway involved in assembly of specialized membrane domains at axon proximal segments and possibly nodes of Ranvier (Zhou, D., S. Lambert, D.L. Malen, S. Carpenter, L. Boland, and V. Bennett, manuscript submitted for publication). (rupress.org)
  • A conclusion is that multiple ankyrin G -specific domains, in addition to the conserved membrane-binding domain, contribute to restriction of ankyrin G to the axonal plasma membrane in dorsal root ganglion neurons. (rupress.org)
  • The ankyrin G -specific spectrin-binding and tail domains are capable of binding directly to sites on the plasma membrane of neuronal cell bodies and axon proximal segments, and presumably have yet to be identified docking sites. (rupress.org)
  • The membrane-binding, spectrin-binding, and tail domains of ankyrin G also contribute to limiting the lateral mobility of ankyrin G -neurofascin complexes. (rupress.org)
  • Ankyrins are cytoskeletal scaffolds traditionally associated with Na(+) channel clustering in neurons and are important for membrane domain establishment and maintenance in many cell types. (mysciencework.com)
  • Complex patterns of alternative splicing in the regulatory domain, giving rise to different isoforms of ankyrin 1 have been described, however, the precise functions of the various isoforms are not known. (acris-antibodies.com)
  • Truncated muscle-specific isoforms of ankyrin 1 resulting from usage of an alternate promoter have also been identified. (acris-antibodies.com)
  • Brain-related isoforms of ankyrin also exist. (sickkids.ca)
  • Not everyone with an ANK2 gene mutation has heart problems related to ankyrin-B syndrome. (medlineplus.gov)
  • Ankyrins are encoded by three genes (ANK1, ANK2 and ANK3) in mammals. (wikipedia.org)
  • Following identification of deceased ACM probands possessing ANK2 rare variants and evidence of ankyrin-B loss of function on cardiac tissue analysis, an ANK2 mouse model was found to develop dramatic structural abnormalities reflective of human ACM, including biventricular dilation, reduced ejection fraction, cardiac fibrosis, and premature death. (jci.org)
  • Ankyrin-2 or -Ankyrin-B is encoded by the gene ANK2. (antibodiesinc.com)
  • This study has resolved intermediate stages in the developmental transition from a continuous distribution of ankyrin G 480/270 kDa in all axons to a highly polarized localization at the node of Ranvier in the developing rat sciatic nerve. (jneurosci.org)
  • Here, we provide evidence that Nup358 associates selectively with the axon initial segment (AIS) of mature neurons and mediated by the AIS scaffold ankyrin-G. The N-terminus of Nup358 is found to be sufficient for its localization at the AIS. (biologists.org)
  • We now report that nuclear localization of Ikappa Balpha is mediated by a novel nuclear import sequence within the second ankyrin repeat. (caltech.edu)
  • Here, we address the role of the conserved N-terminal ankyrin repeat domain (ARD) for subcellular localization and function of these giant Ankyrins in vivo. (uni-kl.de)
  • This paper addresses the mechanism for restriction of 270-kD ankyrin G to axon proximal segments by evaluation of localization of GFP-tagged ankyrin G constructs transfected into cultured dorsal root ganglion neurons, as well as measurements of fluorescence recovery after photobleaching of neurofascin- GFP-tagged ankyrin G complexes in nonneuronal cells. (rupress.org)
  • Localization and structure of the ankyrin-binding site on beta2-spectrin. (scienceexchange.com)
  • AnkyrinR was first characterized in human erythrocytes, where this ankyrin was referred to as erythrocyte ankyrin or band2.1. (wikipedia.org)
  • Also known as Ankyrin-1 (ANK-1) (Ankyrin-R) (Erythrocyte ankyrin). (mybiosource.com)
  • The redox state of cysteines 201 and 317 of the erythrocyte anion exchanger is critical for ankyrin binding. (semanticscholar.org)
  • The structure of GABPalpha/beta: an ETS domain- ankyrin repeat heterodimer bound to DNA. (ebi.ac.uk)
  • Your search returned 20 Ankyrin repeat domain 12 ELISA ELISA Kit across 6 suppliers. (biocompare.com)
  • Your search returned 13 Ankyrin repeat domain 29 ELISA ELISA Kit across 1 supplier. (biocompare.com)
  • Source:RefSeq mRNA;Acc :NM_001109946] ENSSSCG00000005 607 RALGPS 1 Ral GEF with PH domain and SH3 binding motif 1 [Source:HGNC Symbol;Acc:16851] ENSSSCG00000005 679 ASB6 Sus scrofa ankyrin repeat and SOCS box containing 6 (ASB6), mRNA. (thefreedictionary.com)
  • Ankyrin repeat domain 30A (NY-BR-1) is another newly described marker useful in identifying a breast primary, although in limited publications. (thefreedictionary.com)
  • Ankyrin Repeat Domain 33B Recombin. (novusbio.com)
  • Discover related pathways, diseases and genes to Ankyrin Repeat Domain 33B. (novusbio.com)
  • We identified three missense substitutions (R269H, R315W and R316C) affecting the intracellular N-terminal ankyrin domain of the TRPV4 ion channel in five families. (nih.gov)
  • In summary, we describe a new hereditary channelopathy caused by mutations in TRPV4 and present evidence that the resulting substitutions in the N-terminal ankyrin domain affect channel maturation, leading to reduced surface expression of functional TRPV4 channels. (nih.gov)
  • The AFLP2 fragment showed a significant level of similarity with the porcine ankyrin repeat domain 16 (ANKRD16) gene (GenBank accession no. (thefreedictionary.com)
  • The crystal structure of a ternary complex containing a GABPα/β ETS domain-ankyrin repeat heterodimer bound to DNA was determined at 2.15 angstrom resolution. (sciencemag.org)
  • To investigate how the structurally dissimilar GABP α and β subunits form a tight heterodimer with enhanced DNA-binding affinity, we determined the crystal structure of the GABPα/β ETS domain-ankyrin repeat heterodimer bound to DNA. (sciencemag.org)
  • In particular, the ankyrin repeat domain (ARD) of ankyrin is responsible for Tiam1 binding. (rupress.org)
  • Biochemical studies and deletion mutation analyses indicate that the 11-amino acid sequence between amino acids 717 and 727 of Tiam1 ( 717 GEGTDAVKRS 727 L) is the ankyrin-binding domain. (rupress.org)
  • Using an Escherichia coli -derived calmodulin-binding peptide (CBP)-tagged recombinant Tiam1 (amino acids 393-728) fragment that contains the ankyrin-binding domain, we have detected a specific binding interaction between the Tiam1 (amino acids 393-738) fragment and ankyrin in vitro. (rupress.org)
  • They contain ankyrin repeat sequence and SOCS box domain. (creative-biogene.com)
  • Both the ankyrin repeat and C-terminal transactivation domains were required for T-cell leukemogenesis, whereas the N-terminal RAM domain and a C-terminal domain that includes a PEST sequence were nonessential. (asm.org)
  • Binding to ankyrin and to the cytoplasmic domain of band 3. (semanticscholar.org)
  • We describe the structure of the cytosolic ankyrin repeat domain (ARD) of TRPV1 and identify a multiligand-binding site important in regulating channel sensitivity within the TRPV1-ARD. (semanticscholar.org)
  • Crystal structure of the human TRPV2 channel ankyrin repeat domain. (semanticscholar.org)
  • Structure of the N-terminal ankyrin repeat domain of the TRPV2 ion channel. (semanticscholar.org)
  • Ankyrin-G co-immunoprecipitates with CNG channels and binds directly to the C-terminal domain of the CNG ß-subunit. (arvojournals.org)
  • The Notch receptor contains a conserved ankyrin repeat domain that is required for Notch-mediated signal transduction. (elsevier.com)
  • However, the Notch ankyrin domain remains largely monomeric in solution, demonstrating that this interface alone is not sufficient to promote tight association. (elsevier.com)
  • Using the structure, we have classified reported mutations within the Notch ankyrin domain that are known to disrupt signaling into those that affect buried residues and those restricted to surface residues. (elsevier.com)
  • The serine-rich domain, which is present only in 480- and 270-kD ankyrin G polypeptides, contributes to restriction of ankyrin G to axon proximal segments as well as limiting lateral diffusion of ankyrin G -neurofascin complexes. (rupress.org)
  • Here, we present the crystal structure of the ankyrin-binding domain of human beta2-spectrin at 1.95 A resolution together with mutagenesis data identifying the binding surface for ankyrins on beta2-spectrin. (scienceexchange.com)
  • The cytoplasmic domains of neurofascin contains a highly conserved sequence (F1315IGQY) that binds ankyrin. (reactome.org)
  • Thymol activates human transient receptor potential family Ankyrin subtype 1 (hTRPA1) and modulates the thermo-transient receptor potential (thermoTPP) (4,5). (thefreedictionary.com)
  • A distinct role for transient receptor potential ankyrin 1, in addition to transient receptor potential vanilloid 1, in tumor necrosis factor a-induced inflammatory hyperalgesia and Freund's complete adjuvant-induced monarthritis. (thefreedictionary.com)
  • Ji, "Oxidative stress induces itch via activation of transient receptor potential subtype ankyrin 1 in mice," Neuroscience Bulletin, vol. (thefreedictionary.com)
  • Transient Receptor Potential Ankyrin 1 Enhances Ovalbumin-Induced Acute Allergic Inflammation in Murine Models. (bioportfolio.com)
  • Based on response to the transient receptor potential ankyrin 1 antagonists after plantar incision, we hypothesized that H 2 O 2 exerts nociceptive effects via the transient receptor potential ankyrin 1 in muscle. (asahq.org)
  • These H 2 O 2 -induced behaviors were blocked by transient receptor potential ankyrin 1 antagonists. (asahq.org)
  • Nociceptive time after intramuscular H 2 O 2 in transient receptor potential ankyrin 1 knockout mice was shorter (173 ± 156 s) compared with wild-type mice (931 ± 629 s). (asahq.org)
  • Canonical-type transient receptor potential 3 (TRPC3) contains an ankyrin repeat (AR) region at the N-terminus (38-188 amino acids) and forms extracellular Ca2 +- entry channels by homo or heteromerization with other TRP subtypes in various cells including skeletal myotubes. (bentham.co.uk)
  • Transient receptor potential channel ankyrin-1 is not a cold sensor for autonomic thermoregulation in rodents. (painresearchforum.org)
  • Desmosomal structure and function appeared preserved in diseased human and murine specimens in the presence of markedly abnormal β-catenin expression and patterning, leading to identification of a previously unknown interaction between ankyrin-B and β-catenin. (jci.org)
  • These findings suggest that ankyrin-Tiam1 interaction plays a pivotal role in regulating Rac1 signaling and cytoskeleton function required for oncogenic signaling and metastatic breast tumor cell progression. (rupress.org)
  • This interaction is mediated by giant Ankyrins, that act as specialized adaptors to establish and maintain axonal and synaptic compartments. (uni-kl.de)
  • To study interaction between CNG channels and ankyrin-G, we performed immunoprecipitation from isolated bovine ROS. (arvojournals.org)
  • Also, these studies provide genetic evidence of an interaction between NrCAM and ankyrin-B. (rupress.org)
  • Mutations in erythrocytic ankyrin 1 have been associated in approximately half of all patients with hereditary spherocytosis. (acris-antibodies.com)
  • This constellation of traits is known as ankyrin-B syndrome, which may have important implications for humans possessing functional ankyrin-B mutations. (duke.edu)
  • The ankyrin-repeat sequence motif has been studied using multiple sequence alignment to determine conserved amino acid residues critical for folding and stability. (wikipedia.org)
  • We next demonstrated that the deletion of 28 carboxyl terminal amino acids from CNG-ß1, which causes retinitis pigmentosa in humans, abolishes ankyrin-G binding. (arvojournals.org)
  • Further analysis indicated that ankyrin-G binding is abolished by mutating just two of these 28 amino acids at positions IL1237. (arvojournals.org)
  • Specifically, we generated knockin mice that express either the human ankyrin-B variant R1788W, which is present in 0.3% of North Americans of mixed European descent and is associated with T2D, or L1622I, which is present in 7.5% of African Americans. (jci.org)
  • GLUT4 trafficking was altered in animals expressing mutant forms of ankyrin-B, and we propose that increased cell surface expression of GLUT4 in skeletal muscle and fatty tissue of Ankb R1788W/R1788W mice leads to the observed age-dependent adiposity. (jci.org)
  • In transgenic mice, flanking a mutant -108/-153 ankyrin gene promoter with the well-characterized chicken HS4 barrier insulator restored position-independent, uniform expression at levels comparable to wild-type. (luriechildrens.org)
  • Impaired echinocytic transformation of ankyrin- and spectrin-deficient erythrocytes in mice. (semanticscholar.org)
  • Ankyrin-B(+/-) mice also display postprandial hyperglycemia, consistent with impaired parasympathetic potentiation of glucose-stimulated insulin secretion. (duke.edu)
  • This complex behavior explains ability of ankyrin B and ankyrin G to sort to distinct sites in neurons and the fact that these ankyrins do not compensate for each other in ankyrin gene knockouts in mice. (rupress.org)
  • Furthermore, analysis of lenses of ankyrin-B mutant mice also reveals a disorganization of lens fibers at postnatal day 1, indistinguishable from that generated by the absence of NrCAM, indicating that NrCAM and ankyrin-B are required to maintain contact between lens fiber cells. (rupress.org)
  • Conditional knockout of ankyrins in oligodendrocytes disrupts paranodal junction assembly and delays nerve conduction during early development in mice. (mysciencework.com)
  • Clustering of neurofascin and NrCAM precedes redistribution of ankyrin G 480/270 kDa and the voltage-dependent sodium channel, suggesting that the adhesion molecules define the initial site for subsequent assembly of ankyrin and the voltage-dependent sodium channel. (jneurosci.org)
  • Here we show that ankyrin-B, expressed by Schwann cells, and ankyrin-G, expressed by oligodendrocytes, are highly enriched at the glial side of paranodal junctions where they interact with the essential glial junctional component neurofascin 155. (mysciencework.com)
  • Binding to ankyrin appears to be a common feature of L1 subfamily members and requires a highly conserved sequence within their cytoplasmic tails ( Davis and Bennett, 1994 ). (rupress.org)
  • Title: L1 coupling to ankyrin and the spectrin-actin cytoskeleton modulates ethanol inhibition of L1 adhesion and ethanol teratogenesis. (nih.gov)
  • Functional characterization of these animals will allow us to better understand the relationship between human ankyrin-B variants and ankyrin-B syndrome. (duke.edu)
  • In people with ankyrin-B syndrome, arrhythmia can lead to fainting (syncope) or cardiac arrest and sudden death. (medlineplus.gov)
  • Our findings introduce what we believe to be a new pathway for ACM, a role of ankyrin-B in cardiac structure and signaling, a molecular link between ankyrin-B and β-catenin, and evidence for targeted activation of the WNT/β-catenin pathway as a potential treatment for this disease. (jci.org)
  • Rare functional variants of ankyrin-B have been implicated in human disease, including hereditary cardiac arrhythmia and type 2 diabetes (T2D). (jci.org)
  • Studies in the ankyrin-B+/- mouse reveal that ankyrin-B deficiency is associated with both the benefits of enhanced cardiac contractility and the costs of arrhythmia, early senescence, reduced lifespan, and impaired glucose tolerance. (duke.edu)
  • Dysfunction in ankyrin-B-dependent ion channel and transporter targeting causes human sinus node disease. (medlineplus.gov)
  • Mammalian Expression Plasmid of anti-Ankyrin-R (Human). (addgene.org)
  • These data indicate that an upstream region of the ankyrin-1 erythroid promoter acts as a barrier insulator and identify disruption of the barrier element as a potential pathogenetic mechanism of human disease. (luriechildrens.org)
  • We found that ankyrin-B variants are surprisingly common, ranging from 2 percent of European individuals to 8 percent in individuals from West Africa. (duke.edu)
  • The ankyrin fold appears to be defined by its structure rather than its function since there is no specific sequence or structure which is universally recognised by it. (ebi.ac.uk)
  • Furthermore, a region encompassing the second ankyrin repeat of Ikappa Balpha is able to function as a discrete nuclear import sequence. (caltech.edu)
  • The seventh, C-terminal, ankyrin sequence repeat adopts a regular ankyrin fold, but the first, N-terminal ankyrin repeat, which contains a 15-residue insertion, appears to be largely disordered. (elsevier.com)
  • In vivo, the ankyrin erythroid promoter and its upstream region direct position-independent, uniform expression, a property of barrier insulators. (luriechildrens.org)
  • It has been suggested that Ankyrin 1 interacts with KAHRP (shown via selective pull-downs, SPR and ELISA). (wikipedia.org)
  • The NgCAM-related cell adhesion molecule (NrCAM) is an immunoglobulin superfamily member of the L1 subgroup that interacts intracellularly with ankyrins. (rupress.org)
  • The structure reveals a substantial interface between ankyrin polypeptides, showing a high degree of shape and charge complementarity, which may be related to homotypic interactions suggested from indirect studies. (elsevier.com)
  • Biochemical experiments in cells isolated from mouse embryos show that ankyrin-B recognizes vesicles containing specific phosphoinositide lipids and attaches to them. (elifesciences.org)
  • Ankyrin 1, the prototype of this family, was first discovered in the erythrocytes, but since has also been found in brain and muscles. (acris-antibodies.com)
  • Immunoblot against crude membranes from adult rat brain (RBM) and wild-type (WT) and Ankyrin-R knockout (KO) mouse brains probed with N388A/60 (left) and K58/35 (right) TC supe. (acris-antibodies.com)
  • Also known as Ankyrin-2 (ANK-2) (Ankyrin-B) (Brain ankyrin). (mybiosource.com)
  • Ankyrin B is expressed in brain and muscle. (antibodiesinc.com)
  • Ankyrin 3 is an immunologically distinct gene product from ankyrins 1 and 2, and was originally found at the axonal initial segment and nodes of Ranvier of neurons in the central and peripheral nervous systems. (nih.gov)
  • Before myelination in embryonic nerves, ankyrin G 480/270 kDa and the related ankyrin isoform ankyrin B 440 kDa are co-expressed along with NrCAM in an abundant, continuous distribution along the length of axons. (jneurosci.org)
  • Ankyrin gene silencers are available as Ankyrin CRISPR/Cas9 Knockout plasmids and Ankyrin Double Nickase Plasmids. (scbt.com)