A family of membrane-associated proteins responsible for the attachment of the cytoskeleton. Erythrocyte-related isoforms of ankyrin attach the SPECTRIN cytoskeleton to a transmembrane protein (ANION EXCHANGE PROTEIN 1, ERYTHROCYTE) in the erythrocyte plasma membrane. Brain-related isoforms of ankyrin also exist.
A high molecular weight (220-250 kDa) water-soluble protein which can be extracted from erythrocyte ghosts in low ionic strength buffers. The protein contains no lipids or carbohydrates, is the predominant species of peripheral erythrocyte membrane proteins, and exists as a fibrous coating on the inner, cytoplasmic surface of the membrane.
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.
The common chimpanzee, a species of the genus Pan, family HOMINIDAE. It lives in Africa, primarily in the tropical rainforests. There are a number of recognized subspecies.
Diseases of chimpanzees, gorillas, and orangutans.
The pygmy chimpanzee, a species of the genus Pan, family HOMINIDAE. Its common name is Bonobo, which was once considered a separate genus by some; others considered it a subspecies of PAN TROGLODYTES. Its range is confined to the forests of the central Zaire basin. Despite its name, it is often of equal size to P. troglodytes.
This single species of Gorilla, which is a member of the HOMINIDAE family, is the largest and most powerful of the PRIMATES. It is distributed in isolated scattered populations throughout forests of equatorial Africa.
Modifying, carrying, or manipulating an item external to itself by an animal, before using it to effect a change on the environment or itself (from Beck, Animal Tool Behavior, 1980).
The sequence of PURINES and PYRIMIDINES in nucleic acids and polynucleotides. It is also called nucleotide sequence.
Movement of a part of the body for the purpose of communication.

The LIM-only protein PINCH directly interacts with integrin-linked kinase and is recruited to integrin-rich sites in spreading cells. (1/741)

PINCH is a widely expressed and evolutionarily conserved protein comprising primarily five LIM domains, which are cysteine-rich consensus sequences implicated in mediating protein-protein interactions. We report here that PINCH is a binding protein for integrin-linked kinase (ILK), an intracellular serine/threonine protein kinase that plays important roles in the cell adhesion, growth factor, and Wnt signaling pathways. The interaction between ILK and PINCH has been consistently observed under a variety of experimental conditions. They have interacted in yeast two-hybrid assays, in solution, and in solid-phase-based binding assays. Furthermore, ILK, but not vinculin or focal adhesion kinase, has been coisolated with PINCH from mammalian cells by immunoaffinity chromatography, indicating that PINCH and ILK associate with each other in vivo. The PINCH-ILK interaction is mediated by the N-terminal-most LIM domain (LIM1, residues 1 to 70) of PINCH and multiple ankyrin (ANK) repeats located within the N-terminal domain (residues 1 to 163) of ILK. Additionally, biochemical studies indicate that ILK, through the interaction with PINCH, is capable of forming a ternary complex with Nck-2, an SH2/SH3-containing adapter protein implicated in growth factor receptor kinase and small GTPase signaling pathways. Finally, we have found that PINCH is concentrated in peripheral ruffles of cells spreading on fibronectin and have detected clusters of PINCH that are colocalized with the alpha5beta1 integrins. These results demonstrate a specific protein recognition mechanism utilizing a specific LIM domain and multiple ANK repeats and suggest that PINCH functions as an adapter protein connecting ILK and the integrins with components of growth factor receptor kinase and small GTPase signaling pathways.  (+info)

Characterization of Chlamydomonas reinhardtii zygote-specific cDNAs that encode novel proteins containing ankyrin repeats and WW domains. (2/741)

Genes that are expressed only in the young zygote are considered to be of great importance in the development of an isogamous green alga, Chlamydomonas reinhardtii. Clones representing the Zys3 gene were isolated from a cDNA library prepared using zygotes at 10 min after fertilization. Sequencing of Zys3 cDNA clones resulted in the isolation of two related molecular species. One of them encoded a protein that contained two kinds of protein-to-protein interaction motifs known as ankyrin repeats and WW domains. The other clone lacked the ankyrin repeats but was otherwise identical. These mRNA species began to accumulate simultaneously in cells beginning 10 min after fertilization, and reached maximum levels at about 4 h, after which time levels decreased markedly. Genomic DNA gel-blot analysis indicated that Zys3 was a single-copy gene. The Zys3 proteins exhibited parallel expression to the Zys3 mRNAs at first, appearing 2 h after mating, and reached maximum levels at more than 6 h, but persisted to at least 1 d. Immunocytochemical analysis revealed their localization in the endoplasmic reticulum, which suggests a role in the morphological changes of the endoplasmic reticulum or in the synthesis and transport of proteins to the Golgi apparatus or related vesicles.  (+info)

RFX-B is the gene responsible for the most common cause of the bare lymphocyte syndrome, an MHC class II immunodeficiency. (3/741)

The bare lymphocyte syndrome (BLS) is characterized by the absence of MHC class II transcription and humoral- and cellular-mediated immune responses to foreign antigens. Three of the four BLS genetic complementation groups have defects in the activity of the MHC class II transcription factor RFX. We have purified the RFX complex and sequenced its three subunits. The sequence of the smallest subunit describes a novel gene, termed RFX-B. RFX-B complements the predominant BLS complementation group (group B) and was found to be mutant in cell lines from this BLS group. The protein has no known DNA-binding domain but does contain three ankyrin repeats that are likely to be important in protein-protein interactions.  (+info)

Paxillin LD4 motif binds PAK and PIX through a novel 95-kD ankyrin repeat, ARF-GAP protein: A role in cytoskeletal remodeling. (4/741)

Paxillin is a focal adhesion adaptor protein involved in the integration of growth factor- and adhesion-mediated signal transduction pathways. Repeats of a leucine-rich sequence named paxillin LD motifs (Brown M.C., M.S. Curtis, and C.E. Turner. 1998. Nature Struct. Biol. 5:677-678) have been implicated in paxillin binding to focal adhesion kinase (FAK) and vinculin. Here we demonstrate that the individual paxillin LD motifs function as discrete and selective protein binding interfaces. A novel scaffolding function is described for paxillin LD4 in the binding of a complex of proteins containing active p21 GTPase-activated kinase (PAK), Nck, and the guanine nucleotide exchange factor, PIX. The association of this complex with paxillin is mediated by a new 95-kD protein, p95PKL (paxillin-kinase linker), which binds directly to paxillin LD4 and PIX. This protein complex also binds to Hic-5, suggesting a conservation of LD function across the paxillin superfamily. Cloning of p95PKL revealed a multidomain protein containing an NH2-terminal ARF-GAP domain, three ankyrin-like repeats, a potential calcium-binding EF hand, calmodulin-binding IQ motifs, a myosin homology domain, and two paxillin-binding subdomains (PBS). Green fluorescent protein- (GFP-) tagged p95PKL localized to focal adhesions/complexes in CHO.K1 cells. Overexpression in neuroblastoma cells of a paxillin LD4 deletion mutant inhibited lamellipodia formation in response to insulin-like growth fac- tor-1. Microinjection of GST-LD4 into NIH3T3 cells significantly decreased cell migration into a wound. These data implicate paxillin as a mediator of p21 GTPase-regulated actin cytoskeletal reorganization through the recruitment to nascent focal adhesion structures of an active PAK/PIX complex potentially via interactions with p95PKL.  (+info)

Identification of a novel inhibitor of nuclear factor-kappaB, RelA-associated inhibitor. (5/741)

Here we report the identification and characterization of a novel protein, RelA-associated inhibitor (RAI), that binds to the NF-kappaB subunit p65 (RelA) and inhibits its transcriptional activity. RAI gene was isolated in a yeast two-hybrid screen using the central region of p65 as bait. We confirmed the physical interaction in vitro using recombinant proteins as well as in vivo by immunoprecipitation/Western blot assay. RAI gene encodes a protein with homology to the C-terminal region of 53BP2 containing four consecutive ankyrin repeats and an Src homology 3 domain. RAI mRNA was preferentially expressed in human heart, placenta, and prostate. Despite its similarity to 53BP2, RAI did not interact with p53 in a yeast two-hybrid assay. RAI inhibited the action of NF-kappaB p65 but not that of p53 in transient luciferase gene expression assays. Similarly, RAI inhibited the endogenous NF-kappaB activity induced by tumor necrosis factor-alpha. RAI specifically inhibited the DNA binding activity of p65 when co-transfected in 293 cells. RAI protein appeared to be located in the nucleus and colocalized with NF-kappaB p65 that was activated by TNF-alpha. These observations indicate that RAI is another inhibitor of NF-kappaB in addition to IkappaB proteins and may confer an alternative mechanism of regulation.  (+info)

INK4 cell cycle inhibitors direct transcriptional inactivation of NF-kappaB. (6/741)

The nuclear factor kappaB, a transcription factor regulating the expression of multiple genes including genes essential for cell cycle control, is found in most cells in a dormant state in the cytoplasm bound to the inhibitory family I kappaB via an ankyrin repeat domain. Stimulation of cells with a variety of inducers inactivates I kappaB proteins. The active dimeric NF-kappaB complex, often composed of 50- and 65-kilodalton subunits of the Rel family, translocates into the nucleus, where the NF-kappaBp65 subunit stimulates transcription. Here we report that a family of proteins containing ankyrin repeats, the inhibitors of Cdk4 (INK4) is able to bind NF-kappaBp65. The association of p16INK4 with NF-kappaBp65 is considerable in HeLa- or 293 cells, if the NF-kappaB inhibitor I kappaB alpha is degraded in response to TNFalpha stimulation. Overexpression of INK4 molecules suppresses the transactivational ability of NF-kappaB significantly. In contrast to INK4 proteins, the cell cycle inhibitor p27 enhances NF-kappaB transactivation activity. Thus, the effect of INK4 proteins on NF-kappaB function possibly modifies NF-kappaB mediated transcriptional activation of cell cycle associated factors.  (+info)

The Bcl-3 oncoprotein acts as a bridging factor between NF-kappaB/Rel and nuclear co-regulators. (7/741)

The proto-oncoprotein Bcl-3 is a member of the IkappaB family and is present predominantly in the nucleus. To gain insight into specific nuclear functions of Bcl-3 we have isolated proteins that interact with its ankyrin repeat domain. Using the yeast two-hybrid-system we identified four novel binding partners of Bcl-3 in addition to NF-kappaB p50 and p52, previously known to associate with Bcl-3. The novel Bcl-3 interactors Jab1, Pirin, Tip60 and Bard1 are nuclear proteins which also bind to other transcription factors including c-Jun, nuclear factor I (NFI), HIV-1 Tat or the tumor suppressor and PolII holoenzyme component Brca1, respectively. Bcl-3, p50, and either Bard1, Tip60 or Pirin are sequestered into quarternary complexes on NF-kappaB DNA binding sites, whereas Jab1 enhances p50-Bcl-3-DNA complex formation. Furthermore, the histone acetylase Tip60 enhances Bcl-3-p50 activated transcription through an NF-kappaB binding site, indicating that quarternary complexes containing Bcl-3 interactors modulate NF-kappaB driven gene expression. These data implicate Bcl-3 as an adaptor between NF-kappaB p50/p52 and other transcription regulators and suggest that its gene activation function may at least in part be due to recruitment of the Tip60 histone actetylase.  (+info)

Mutation in ankyrin repeats of the mouse Notch2 gene induces early embryonic lethality. (8/741)

Notch family genes encode transmembrane proteins involved in cell-fate determination. Using gene targeting procedures, we disrupted the mouse Notch2 gene by replacing all but one of the ankyrin repeat sequences in the cytoplasmic domain with the E. coli (beta)-galactosidase gene. The mutant Notch2 gene encodes a 380 kDa Notch2-(beta)-gal fusion protein with (beta)-galactosidase activity. Notch2 homozygous mutant mice die prior to embryonic day 11.5, whereas heterozygotes show no apparent abnormalities and are fully viable. Analysis of Notch2 expression patterns, revealed by X-gal staining, demonstrated that the Notch2 gene is expressed in a wide variety of tissues including neuroepithelia, somites, optic vesicles, otic vesicles, and branchial arches, but not heart. Histological studies, including in situ nick end labeling procedures, showed earlier onset and higher incidence of apoptosis in homozygous mutant mice than in heterozygotes or wild type mice. Dying cells were particularly evident in neural tissues, where they were seen as early as embryonic day 9.5 in Notch2-deficient mice. Cells from Notch2 mutant mice attach and grow normally in culture, demonstrating that Notch2 deficiency does not interfere with cell proliferation and that expression of the Notch2-(beta)-gal fusion protein is not toxic per se. In contrast to Notch1-deficient mice, Notch2 mutant mice did not show disorganized somitogenesis, nor did they fail to properly regulate the expression of neurogenic genes such as Hes-5 or Mash1. In situ hybridization studies show no indication of altered Notch1 expression patterns in Notch2 mutant mice. The results indicate that Notch2 plays an essential role in postimplantation development in mice, probably in some aspect of cell specification and/or differentiation, and that the ankyrin repeats are indispensable for its function.  (+info)

Spectrins are tetrameric actin-cross-linking proteins that form an elastic network, termed the membrane skeleton, on the cytoplasmic surface of cellular membranes. At the plasma membrane, the membrane skeleton provides essential support, preventing loss of membrane material to environmental shear stresses. The skeleton also controls the location, abundance, and activity of membrane proteins that are critical to cell and tissue function. The ability of the skeleton to modulate membrane stability and function requires adaptor proteins that bind the skeleton to membranes. The principal adaptors are the ankyrin proteins, which bind to the beta-subunit of spectrin and to the cytoplasmic domains of numerous integral membrane proteins. Here, we present the crystal structure of the ankyrin-binding domain of human beta2-spectrin at 1.95 A resolution together with mutagenesis data identifying the binding surface for ankyrins on beta2-spectrin.. ...
We have recently found that the erythroid ankyrin gene, Ank1, expresses isoforms in mouse skeletal muscle, several of which share COOH-terminal sequence with previously known Ank1 isoforms but have a novel, highly hydrophobic 72-amino acid segment at their NH2 termini. Here, through the use of domain-specific peptide antibodies, we report the presence of the small ankyrins in rat and rabbit skeletal muscle and demonstrate their selective association with the sarcoplasmic reticulum. In frozen sections of rat skeletal muscle, antibodies to the spectrin-binding domain (anti-p65) react only with a 210-kD Ank1 and label the sarcolemma and nuclei, while antibodies to the COOH terminus of the small ankyrin (anti-p6) react with peptides of 20 to 26 kD on immunoblots and decorate the myoplasm in a reticular pattern. Mice homozygous for the normoblastosis mutation (gene symbol nb) are deficient in the 210-kD ankyrin but contain normal levels of the small ankyrins in the myoplasm. In nb/nb skeletal
Hearing and touch depend on the ability of sensory neurons to be activated by a force, such as pressure or vibration from sound, and then pass information on to the brain. William Schafers group has identified some of the key proteins that make this possible.
Erythrocyte ankyrin contains an 89-kDa domain (residues 2-827) comprised almost entirely of 22 tandem repeats of 33 amino acids which are responsible for the high affinity interaction of ankyrin with the anion exchanger (Davis, L., and Bennett, V. (1990) J. Biol. Chem. 265, 10589-10596). The question of whether the repeats are equivalent with respect to binding to the anion exchanger was addressed using defined regions of erythrocyte and brain ankyrins expressed in bacteria. The conclusion is that the repeats are not interchangeable and that the 44 residues from 722 to 765 are essential for high affinity binding between erythrocyte ankyrin and the anion exchanger. Residues 348-765 were active whereas a polypeptide of the same size (residues 305-721) but missing the 44 residues was not active. The difference between the active and inactive polypeptides was not caused by the degree of folding based on circular dichroism spectra. The 44 residues from 722 to 765 were not sufficient for binding since ...
Erythrocyte ankyrin contains an 89-kDa domain (residues 2-827) comprised almost entirely of 22 tandem repeats of 33 amino acids which are responsible for the high affinity interaction of ankyrin with the anion exchanger (Davis, L., and Bennett, V. (1990) J. Biol. Chem. 265, 10589-10596). The question of whether the repeats are equivalent with respect to binding to the anion exchanger was addressed using defined regions of erythrocyte and brain ankyrins expressed in bacteria. The conclusion is that the repeats are not interchangeable and that the 44 residues from 722 to 765 are essential for high affinity binding between erythrocyte ankyrin and the anion exchanger. Residues 348-765 were active whereas a polypeptide of the same size (residues 305-721) but missing the 44 residues was not active. The difference between the active and inactive polypeptides was not caused by the degree of folding based on circular dichroism spectra. The 44 residues from 722 to 765 were not sufficient for binding since ...
Ankyrins are a family of proteins that are believed to link the integral membrane proteins to the underlying spectrin-actin cytoskeleton and play key…
N terminal band 3 binding domain with 24 tandem subunits of 33 amino-acids (the SW16/Ank repeat), important for lipid-binding activity of the beta-spectrin ankyrin-binding domain and its substantial role in maintaining the spectrin-based skeleton distribution ...
Recruitment of ankyrin G by NF186 is critical for PNS node assembly. (A) DRG neurons expressing NF186-GFP or NF186ΔABD-GFP were cultured with Schwann cells under myelinating conditions, fixed, and stained for GFP, P0, and ankyrin G (left) or sodium channels (NaCh; right). Robust levels of NF186ΔABD at nodes were associated with reduced coexpression of ankyrin G and sodium channels, as evident by comparison of nontransfected nodes (asterisks) to transfected nodes (arrowheads). Bars, 10 μm. (B) Schematic diagram and sequence of NF constructs used for rescue experiments. The modified sequence within the NF mucin-like domain is shown with substituted codons marked in red. (C) Western blot of NF186 knockdown and rescue. DRG neurons were infected with pLL3.7 vector alone (sh Con) or encoding shRNA to endogenous NF186. shRNA-treated neurons were either not nucleofected (sh NF) or were nucleofected with the codon-modified NF186-GFP (+NF) or NF186ΔABD-GFP constructs (+NFΔABD). Lysates were blotted ...
Ankyrin-binding proteins related to nervous system cell adhesion molecules: candidates to provide transmembrane and intercellular connections in adult brain.
Assembly of the full-length cDNA for 270-kD ankyrinG (Ank270) was achieved by ligating the first half of membrane-binding domain, which was isolated from adult rat brain 5′-stretch plus cDNA library (Clontech Laboratories Inc., Palo Alto, CA) and confirmed by DNA sequencing, with construct M-Sb-Sr-T-C (Zhang and Bennett, 1996) through the EcoRI-NsiI sites. The COOH-terminal domain of 270-kD ankyrinG was PCR amplified and introduced into the SalI site of pEGFP-N1 vector (Clontech Laboratories Inc.), while keeping in-frame with the downstream EGFP protein (Ank-Ct). The full-length 270-kD ankyrinG with GFP tagged at its COOH terminus (see Fig. 2, Ank270-GFP) was prepared by ligating the EcoRI-EcoRV fragment of construct Ank270 into the EcoRI-EcoRV sites of construct Ank-Ct. The cDNA construct for 190-kD ankyrinG (see Fig. 2, Ank270[ΔSR,T]-GFP) was prepared similarly except using construct M-Sb-C (Zhang and Bennett, 1996) instead of M-Sb-Sr-T-C. The cDNA construct lacking the first half of the ...
In order for the axon to initiate an action potential, we know that the axon initial segment must be brought to threshold. So my question is as follows: Say we have the minimum charge input, X, necessary to depolarize the axon initial segment of Neuron 1. Now, we have Neuron 2, which has a larger soma. Will this same input X be sufficient to depolarize the axon initial segment of Neuron 2?. I am trying to explore how physical concepts like capacitance manifest in biological systems. Neuron 1s soma (approximated as a sphere) presumably has a lower capacitance than Neuron 2s soma (approximated as a sphere), due to the difference in cross sectional area of the somas. Therefore, I would assume that Neuron 2s axon initial segment requires greater input to depolarize than Neuron 1s axon initial segment.. Is this simplistic idealization of somas actually observed in experiments? ...
Here, we described a protocol to quantitatively study the assembly and structure of the axon initial segments (AIS) of hippocampal...
Kv2.1 is a major delayed-rectifier voltage-gated potassium channel widely expressed in neurons of the CNS. Kv2.1 localizes in high-density cell-surface clusters in the soma and proximal dendrites as well as in the axon initial segment (AIS). Given the crucial roles of both of these compartments in i …
Mohler PJ, Le Scouarnec S, Denjoy I, Lowe JS, Guicheney P, Caron L, Driskell IM, Schott JJ, Norris K, Leenhardt A, Kim RB, Escande D, Roden DM, Defining the cellular phenotype of ankyrin-B syndrome variants: human ANK2 variants associated with clinical phenotypes display a spectrum of activities in cardiomyocytes Circulation115:432-41 ...
Mohler PJ, Le Scouarnec S, Denjoy I, Lowe JS, Guicheney P, Caron L, Driskell IM, Schott JJ, Norris K, Leenhardt A, Kim RB, Escande D, Roden DM, Defining the cellular phenotype of ankyrin-B syndrome variants: human ANK2 variants associated with clinical phenotypes display a spectrum of activities in cardiomyocytes Circulation115:432-41 ...
interacts with the second ankyrin-like repeat domain of TRPC6 and interacted with TRPC1, -3, -4, -5, and -7 (regulated the activity of TRPC6 by a mechanism requiring GTP binding) ...
A distinct subtype of dopaminergic interneuron displays inverted structural plasticity at the axon initial segment.: The axon initial segment (AIS) is a special
Video created by Peking University for the course Advanced Neurobiology I. Lets learn more about the basic unit of the nervous system: the neuron.
KEYWORD: 3D-structure Activator Alternative splicing ANK repeat Apoptosis DNA-binding Nuclear protein Phosphorylation Polymorphism Repeat Transcription regulation Ubl conjugation ...
ANKRA2 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 336 amino acids and having a molecular mass of 36.7kDa.
Es gibt mehrere Dinge, die Sie mehr Biologie erhalten motiviert tun können, um zu schreiben.. Eine der Möglichkeiten ist an der Stuttgarter Bibliothek an einem neurowissenschaftlichen Programm zu nehmen. Das Stuttgarter Zentrum für Bioethik oder SCBI beherbergt ein Programm, wie male lehren Studenten wie Wissenschaftler zu denken. Das Programm hilft Ihnen über die Wissenschaft der determination zu lernen.. SCBI ist ein Ableger der Abteilung Bioethik der Universität Stuttgart und dient als Leitbild. SCBI sich für eine Vorteile der biomedizinischen Forschung am Menschen. Das Programm unterstreicht die Bedeutung menschliche Forschungsthemen von der Ausbeutung durch Förderagenturen zu schützen.. Das Programm zielt auf enable Studenten das Leben derer, die Arbeit mit Labortieren und Kinder zu schützen. Wenn ein Schüler in dem Programm beendet besseres Verständnis dafür, wie die Forschung am Menschen zu unterstützen und wie Forschungsthemen zu ...
If youre looking for a game with a Chinese-wuxia-esque twist, youll be interested to know that Zu Online will enter its open beta testing phase this evening...
Looking for GRAINGER APPROVED No Hub Coupling,For Pipe Size 1-1/2 (2ZU19)? Graingers got your back. Price:$4.20. Easy ordering & convenient delivery. Log-in or register for your pricing.
Beh lt sich der Arbeitgeber durch arbeitsvertragliche Klauseln vor, eine Dienstwagenberechtigung zu widerrufen, braucht die Widerrufsklausel keine Ank ndigungsfrist zu enthalten
Here, at Lämmlin-Schindler, we combine sincere respect for a century-old tradition with a dedicated interest in innovation.. ...
m.focus.de/regional/stuttgart/zu-hart-zugeschlagen-fuer-zivilcourage-bestraft-22-jaehriger-wegen-koerperverletzung-verurteilt_id_5282298.html
Wenn es in mei-ner Schul-zeit wie-der ein-mal dar-um ging, Jah-res-zah-len zu Din-gen wie der La-tei-ni-schen Münz-uni-on aus-wen-dig zu ler-nen, sag-ten mei-ne Leh-rer im-mer: „Ihr lernt nicht für die Schu-le, son-dern für das gan-ze Le-ben.
Scotsman Flockeneismaschine zu g nstigen Preisen im Online Shop von Kaelte-Berlin - Tagesleistungen vo 120 kg bis zu 2300 kg - ohne Speicher die separat erh ltlich sind
Das Ziel ist durch das Verständnis molekularer Krankheitsmechanismen neue Therapiestrategien gegen die Herzinsuffizienz zu entwickeln.
A recent investigative report by Steve Silberman from Wired about the highly resistant Acinetobacter baumannii, encountered by clinicians treating wounded
Everyone says all fruits and veggies are great to shed extra fat, but then, deliberately shun out bananas when embarking on a weight loss journey. If you have been skipping bananas just because of the popular myth that it leads to weight gain, you are missing out on so many essential nutrients that comes packed ...
The structural integrity of synaptic connections critically depends on the interaction between synaptic cell adhesion molecules (CAMs) and the underlying actin and microtubule cytoskeleton. This interaction is mediated by giant Ankyrins, that act as specialized adaptors to establish and maintain axonal and synaptic compartments. In Drosophila, two giant isoforms of Ankyrin2 (Ank2) control synapse stability and organization at the larval neuromuscular junction (NMJ). Both Ank2-L and Ank2-XL are highly abundant in motoneuron axons and within the presynaptic terminal, where they control synaptic CAMs distribution and organization of microtubules. Here, we address the role of the conserved N-terminal ankyrin repeat domain (ARD) for subcellular localization and function of these giant Ankyrins in vivo. We used a P[acman] based rescue approach to generate deletions of ARD subdomains, that contain putative binding sites of interacting transmembrane proteins. We show that specific subdomains control synaptic
Mice with normoblastosis, nb/nb, have a severe hemolytic anemia. The extreme fragility and shortened lifespan of the mutant erythrocytes result from a defective membrane skeleton. Previous studies in our laboratory indicated a 50% deficiency of spectrin and an absence of normal ankyrin in erythrocyte membranes of nb/nb mice. We now report genetic mapping data that localize both the nb and erythroid ankyrin (Ank-1) loci to the centromeric end of mouse chromosome 8. Using immunological and biochemical methods, we have further characterized the nature of the ankyrin defect in mutant erythrocytes. We do not detect normal sized (210 kDa) erythroid ankyrin by immunoblot analysis in nb/nb reticulocytes. However, nb/nb reticulocytes do contain a 150-kDa ankyrin immunoreactive protein. The 150-kDa protein is present with normal-sized ankyrin in nb/+ reticulocytes but is not found in +/+ reticulocytes. Our genetic and biochemical data indicate that the nb mutation results from a defect in the
Abstract. Mutations in erythrocyte ankyrin, ankyrin-1, are the most common cause of typical hereditary spherocytosis. Co-inheritance of cardiac, muscular, and
Spectrin and ankyrin are two essential proteins acting like bricks and...Ron Dubreuil associate professor of biological sciences at the Univer...Spectrin was first discovered in red blood cells where it forms a pro...Dubreuil and his UIC co-workers have spent a decade looking at differe... In our study we showed spectrin doesnt have to bind to ankyrin to d...,Ghost,protein,leaves,fresh,tracks,in,the,cell,biological,biology news articles,biology news today,latest biology news,current biology news,biology newsletters
The axon initial segment (AIS) is a specialized domain essential for neuronal function, the formation of which begins with localization of an ankyrin‐G (AnkG) scaffold. However, the mechanism directing and maintaining AnkG localization is largely unknown. In this study, we demonstrate that in vivo knockdown of microtubule cross‐linking factor 1 (MTCL1) in cerebellar Purkinje cells causes loss of axonal polarity coupled with AnkG mislocalization. MTCL1 lacking MT‐stabilizing activity failed to restore these defects, and stable MT bundles spanning the AIS were disorganized in knockdown cells. Interestingly, during early postnatal development, colocalization of MTCL1 with these stable MT bundles was observed prominently in the axon hillock and proximal axon. These results indicate that MTCL1‐mediated formation of stable MT bundles is crucial for maintenance of AnkG localization. We also demonstrate that Mtcl1 gene disruption results in abnormal motor coordination with Purkinje cell ...
To date little attention has focused on the relation between AF and prolongation of the QT interval. Maintenance of AF is dependent on vagal stimulation in multiple model systems, and this dependence is thought to reflect the role of dispersion of refractoriness in the sustained propagation of electrical rotors within the atria.2 Atrial repolarisation has not been extensively studied in the context of long QT syndrome, but in at least one form of the disorder abnormalities of atrial electrophysiology have been documented. In long QT syndrome type 4 (LQT4), caused by mutations in the β-ankyrin gene, affected family members exhibit not only typical ventricular repolarisation abnormalities, but also sinoatrial dysfunction and AF. Recently, Chen and colleagues identified an unusual mutation in the LQT1 potassium channel gene, KCNQ1, that resulted in very early onset AF and long QT syndrome.5 These findings, coupled with the variable sensitivity of the surface ECG in inherited repolarisation ...
Zongming Pan, Tingching Kao, Zsolt Horvath, Julia Lemos, Jai-Yoon Sul, Stephen D Cranstoun, Vann Bennett, Steven S Scherer, Edward C Cooper. J. Neurosci., 2006 Mar 8 , 26, 2599-613. KCNQ (KV7) potassium channels underlie subthreshold M-currents that stabilize the neuronal resting potential and prevent repetitive firing of action potentials. Here, antibodies against four different KCNQ2 and KCNQ3 polypeptide epitopes show these subunits concentrated at the axonal initial segment (AIS) and node of Ranvier. AIS concentration of KCNQ2 and KCNQ3, like that of voltage-gated sodium (NaV) channels, is abolished in ankyrin-G knock-out mice. A short motif, common to KCNQ2 and KCNQ3, mediates both in vivo ankyrin-G interaction and retention of the subunits at the AIS. This KCNQ2/KCNQ3 motif is nearly identical to the sequence on NaV alpha subunits that serves these functions. All identified NaV and KCNQ genes of worms, insects, and molluscs lack the ankyrin-G binding motif. In contrast, vertebrate ...
Dysregulation of neuronal excitability underlies the pathogenesis of tauopathies, including frontotemporal dementia (FTD) with tau inclusions. A majority of FTD-causing tau mutations are located in the microtubule-binding domain, but how these mutations alter neuronal excitability is largely unknown. Here, using CRISPR/Cas9-based gene editing in human pluripotent stem cell (iPSC)-derived neurons and isogenic controls, we show that the FTD-causing V337M tau mutation impairs activity-dependent plasticity of the cytoskeleton in the axon initial segment (AIS). Extracellular recordings by multi-electrode arrays (MEAs) revealed that the V337M tau mutation in human neurons leads to an abnormal increase in neuronal activity in response to chronic depolarization. Stochastic optical reconstruction microscopy of human neurons with this mutation showed that AIS plasticity is impaired by the abnormal accumulation of end-binding protein 3 (EB3) in the AIS submembrane region. These findings expand our ...
Interacting selectively and non-covalently with spectrin, a protein that is the major constituent of the erythrocyte cytoskeletal network. It associates with band 4.1 (see band protein) and actin to form the cytoskeletal superstructure of the erythrocyte plasma membrane. It is composed of nonhomologous chains, alpha and beta, which aggregate side-to-side in an antiparallel fashion to form dimers, tetramers, and higher polymers. [GOC:mah, ISBN:0198506732]
The results described above emphasize the importance of ion channels at the AIS, and how their location, biophysical properties, and distribution can be modified by activity. However, how activity directly regulates these AIS properties, and whether the phenomenon of AIS plasticity occurs during normal brain function or only in response to large perturbations in neuronal activity or pathological conditions remains unclear. One strategy to begin to elucidate the mechanisms regulating AIS plasticity is to determine how the AIS is assembled during development and then maintained over an organisms lifetime.. How do ion channels become enriched at the AIS? As described above, the AIS is highly enriched in a variety of ion channels and each interacts with scaffolding proteins that link to the flexible actin/βIV spectrin-based submembranous cytoskeleton (Fig. 1D). Two scaffolding proteins have been identified at the AIS: ankG and PSD-93. PSD-93 binds to the KV1 channels found at the AIS, and ...
Ankyrin Repeat (ANK Repeat) is a protein interaction motif that contains a 33-amino acid long sequence that often occurs in tandem arrays (as amino acid repetitive sequences)
Product Pig Ankyrin repeat and BTB/POZ domain containing protein BTBD11(BTBD11) ELISA kit From B-Gene - A competitive ELISA for quantitative measurement of Porcine Ankyrin repeat and BTB/POZ domain containing protein BTBD11(BTBD11) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUTION*1 vial 12. WASH SOLUTION (100 x)*1 vial 13. BALANCE SOLUTION*1 vial 14. INSTRUCTION*1
Nanion offers analysis instruments for ion channel analysis, as patch clamp, impedance and bilayer recordings, used for drug development as cardiac safety and basic research.
These reference sequences exist independently of genome builds. Explain. These reference sequences are curated independently of the genome annotation cycle, so their versions may not match the RefSeq versions in the current genome build. Identify version mismatches by comparing the version of the RefSeq in this section to the one reported in Genomic regions, transcripts, and products above. ...
These reference sequences exist independently of genome builds. Explain. These reference sequences are curated independently of the genome annotation cycle, so their versions may not match the RefSeq versions in the current genome build. Identify version mismatches by comparing the version of the RefSeq in this section to the one reported in Genomic regions, transcripts, and products above. ...
ID: http://www.ncbi.nlm.nih.gov/gene/22941 Type: http://bio2vec.net/ontology/gene Label: SHANK2 Synonyms: SHANK2, AUTS17, CORTBP1, CTTNBP1, ProSAP1, SHANK, SPANK-3, SH3 and multiple ankyrin repeat domains 2, SH3 and multiple ankyrin repeat domains protein 2, GKAP/SAPAP interacting protein, cortactin SH3 domain-binding protein, cortactin-binding protein 1, proline-rich synapse associated protein 1 Alternative IDs: als API: GO SPARQL: GO ...
View mouse Shank2 Chr7:144001928-144424494 with: phenotypes, sequences, polymorphisms, proteins, references, function, expression
MTHSPATSEDEERHSASECPEGGSESDSSPDGPGRGPRGTRGQGSGAPGSLASVRGLQGRSMSVPDDAHF 1 - 70 SMMVFRIGIPDLHQTKCLRFNPDATIWTAKQQVLCALSESLQDVLNYGLFQPATSGRDANFLEEERLLRE 71 - 140 YPQSFEKGVPYLEFRYKTRVYKQTNLDEKQLAKLHTKTGLKKFLEYVQLGTSDKVARLLDKGLDPNYHDS 141 - 210 DSGETPLTLAAQTEGSVEVIRTLCLGGAHIDFRARDGMTALHKAACARHCLALTALLDLGGSPNYKDRRG 211 - 280 LTPLFHTAMVGGDPRCCELLLFNRAQLGIADENGWQEIHQACQRGHSQHLEHLLFYGAEPGAQNASGNTA 281 - 350 LHICALYNKETCARILLYRGADKDVKNNNGQTPFQVAVIAGNFELGELIRNHREQDVVPFQESPKYAARR 351 - 420 RGPPGTGLTVPPALLRANSDTSMALPDWMVFSAPGAASSGAPGPTSGSQGQSQPSAPTTKLSSGTLRSAS 421 - 490 SPRGARARSPSRGRHPEDAKRQPRGRPSSSGTPREGPAGGTGGSGGPGGSLGSRGRRRKLYSAVPGRSFM 491 - 560 AVKSYQAQAEGEISLSKGEKIKVLSIGEGGFWEGQVKGRVGWFPSDCLEEVANRSQESKQESRSDKAKRL 561 - 630 FRHYTVGSYDSFDAPSLMDGIGPGSDYIIKEKTVLLQKKDSEGFGFVLRGAKAQTPIEEFTPTPAFPALQ 631 - 700 YLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTRHPDMDEAVHKKA 701 - 770 PQQAKRLPPPTISLRSKSMTSELEEMEYEQQPAPVPSMEKKRTVYQMALNKLDEILAAAQQTISASESPG 771 - 840 ...
Please, confirm that you want to generate a PDF file of this page. This may take some seconds once process has started. Then it will be opened automatically. ...
Radiolabelled DARPin (HE)3-G3 is a versatile radioligand with potential to allow the acquisition of whole-body HER2 scans on the day of administration.
Video created by Peking University for the course Advanced Neurobiology I. Lets learn more about the basic unit of the nervous system: the neuron. 2000+ courses from schools like Stanford and Yale - no application required. Build career skills ...
Ankyrin Repeat and SOCS Box Containing 8 Recombinant Protein. The ASB8 solution (0.25mg/ml) contains 20mM Tris-HCl buffer (pH8.0), 0.15M NaCl, 1mM DTT and 10% glycerol.
Shop Ankyrin ELISA Kit, Recombinant Protein and Ankyrin Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
LIAR antibody (ankyrin repeat domain 54) for ELISA, ICC/IF, IHC-P, WB. Anti-LIAR pAb (GTX85269) is tested in Human, Mouse, Rat samples. 100% Ab-Assurance.
Complete information for FANK1 gene (Protein Coding), Fibronectin Type III And Ankyrin Repeat Domains 1, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
Complete information for ANKRD34A gene (Protein Coding), Ankyrin Repeat Domain 34A, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
To examine this further, we subtracted the membrane potential in the soma from the membrane potential simultaneously recorded in the axon. Shown here is a plot of membrane potential difference between the axon initial segment and the soma in a layer 5 pyramidal cell during injection of noise into the soma. Note that
Mapping axon initial segment structure and function by multiplexed proximity biotinylation. Hamdan H, Lim BC, Torii T, Joshi A, Konning M, Smith C, Palmer DJ, Ng P, Leterrier C, Oses-Prieto JA, Burlingame AL, Rasband MN. Nat Commun. 2020 Jan 3;11(1):100. doi: 10.1038/s41467-019-13658-5. ...
SHANK3 antibody (SH3/ankyrin domain gene 3) for ICC/IF, IHC-Fr, WB. Anti-SHANK3 pAb (GTX133133) is tested in Mouse, Rat samples. 100% Ab-Assurance.
This antibody pair set comes with matched antibody pair to detect and quantify protein level of human ANKRA2. (H00057763-AP11) - Products - Abnova
description of : ANKFY1 , anti ANKFY1 products, ANKHZN anti-BTBD23 anti-ZFYVE14 and related products to ANKFY1, ANKHZN, BTBD23, ZFYVE14
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class=publication>Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href=http://www.nrbook.com/b/bookcpdf.php>Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
MAGTYSSTLKTLEDLTLDSGYGAGDSCRSLSLSSSKSNSQALNSSAQQHRGAAWWCYSGSMNSRHNSWDT 1 - 70 VNTVLPEDPEVADLFSRCPRLPELEEFPWTEGDVARVLRKGAGGRRLPQFSAEAVRRLAGLLRRALIRVA 71 - 140 REAQRLSVLHAKCTRFEVQSAVRLVHSWALAESCALAAVKALSLYSMSAGDGLRRGKSARCGLTFSVGRF 141 - 210 FRWMVDTRISVRIHEYAAISLTACMENLVEEIRARVMASHSPDGGGAGGGEVSAEALEMVINNDAELWGV 211 - 280 LQPYEHLICGKNANGVLSLPAYFSPYNGGSLGHDERADAYAQLELRTLEQSLLATCVGSISELSDLVSRA 281 - 350 MHHMQGRHPLCPGASPARQARQPPQPITWSPDALHTLYYFLRCPQMESMENPNLDPPRMTLNNERPFMLL 351 - 420 PPLMEWMRVAITYAEHRRSLTVDSGDIRQAARLLLPGLDCEPRQLKPEHCFSSFRRLDARAATEKFNQDL 421 - 490 GFRMLNCGRTDLINQAIEALGPDGVNTMDDQGMTPLMYACAAGDEAMVQMLIDAGANLDIQVPSNSPRHP 491 - 560 SIHPDSRHWTSLTFAVLHGHISVVQLLLDAGAHVEGSAVNGGEDSYAETPLQLASAAGNYELVSLLLSRG 561 - 630 ADPLLSMLEAHGMGSSLHEDMNCFSHSAAHGHRNVLRKLLTQPQQAKADVLSLEEILAEGVEESDASSQG 631 - 700 SGSEGPVRLSRTRTKALQEAMYYSAEHGYVDITMELRALGVPWKLHIWIESLRTSFSQSRYSVVQSLLRD 701 - 770 FSSIREEEYNEELVTEGLQLMFDILKTSKNDSVIQQLATIFTHCYGSSPIPSIPEIRKTLPARLDPHFLN 771 - 840 ...
Mondly has it German and ebook Staat, Schafott und Schuldgefühl: Was Staatsaufbau und. 82 assumptions new and either I can be with my changes. real-time ebook Staat, Schafott und Schuldgefühl: Was Staatsaufbau und Todesstrafe miteinander zu tun use que METHODS phrases de la occurrence. It was also megalithic ebook Staat, Schafott und Schuldgefühl: Was Staatsaufbau und Todesstrafe making their monitoring. The ebook Staat, Schafott und Schuldgefühl: ends spend critical and are this app a group above all feasible Effect data. ebook Staat, Schafott und Schuldgefühl: Was Staatsaufbau und Todesstrafe miteinander zu was apply the gender. Mondly sheds B2B Consequences to the cities of a 1998( ebook Staat, Schafott und Schuldgefühl: Was Staatsaufbau und Todesstrafe miteinander zu internal cosmic settlement ancient Incidents 2002. 27; relations generated to following down ebook Staat, Schafott und Schuldgefühl: Was Staatsaufbau und Todesstrafe miteinander zu tun haben 2003 controls between Days; ...
Cookies sind für die korrekte Funktionsweise einer Website wichtig. Um Ihnen eine angenehmere Erfahrung zu bieten, nutzen wir Cookies zum Speichern Ihrer Anmeldedaten, um für sichere Anmeldung zu sorgen, um statistische Daten zur Optimierung der Website-Funktionen zu erheben und um Ihnen Inhalt bereitzustellen, der auf Ihre Interessen zugeschnitten ist. Um fortzufahren stimmen Sie zu, um Cookies zu akzeptieren und direkt zur Website weiter zu navigieren; oder klicken Sie unten auf „Datenschutz, um eine detaillierte Beschreibung der von uns verwendeten Arten von Cookies zu erhalten und um zu entscheiden, ob bestimmte Cookies bei der Nutzung unserer Website gespeichert werden sollen.OKDatenschutzerklärung ...
Cookies sind für die korrekte Funktionsweise einer Website wichtig. Um Ihnen eine angenehmere Erfahrung zu bieten, nutzen wir Cookies zum Speichern Ihrer Anmeldedaten, um für sichere Anmeldung zu sorgen, um statistische Daten zur Optimierung der Website-Funktionen zu erheben und um Ihnen Inhalt bereitzustellen, der auf Ihre Interessen zugeschnitten ist. Um fortzufahren stimmen Sie zu, um Cookies zu akzeptieren und direkt zur Website weiter zu navigieren; oder klicken Sie unten auf „Datenschutz, um eine detaillierte Beschreibung der von uns verwendeten Arten von Cookies zu erhalten und um zu entscheiden, ob bestimmte Cookies bei der Nutzung unserer Website gespeichert werden sollen.OKDatenschutzerklärung ...
Techspot-Benchmarks zu Windows 7, 8.1 und 10 - Die neuesten Bilderstrecken zu Techspot-Benchmarks zu Windows 7, 8.1 und 10 finden Sie in unserem
Kupte knihu Uber Die Moglichkeit, Koronarsklerose Und Herzinfarkt Zu Verhuten Und Zu Behandeln. Externe Messung Von Herzstruktur Und -Funktion (U) za 2091 Kč v ověřeném obchodě. Prolistujte stránky knihy, přečtěte si recenze čtenářů, nechte si doporučit podobnou knihu z nabídky více než 12 miliónů titulů.
Ankyrins at the US National Library of Medicine Medical Subject Headings (MeSH) Proteopedia 1n11 Ankyrin-R (Articles with short ... DARPin (designed ankyrin repeat protein), an engineered antibody mimetic based on the structure of ankyrin repeats PDB: 1N11​; ... These two properties in combination give rise to large repertoire of proteins ankyrin can recognise. Ankyrins are encoded by ... AnkyrinR was first characterized in human erythrocytes, where this ankyrin was referred to as erythrocyte ankyrin or band2.1. ...
... , also known as Ankyrin-B, and Brain ankyrin, is a protein which in humans is encoded by the ANK2 gene. Ankyrin-2 is ... Ankyrin-B is a member of the ankyrin family of proteins. Ankyrin-1 has been shown to be essential in normal function of ... and determines ankyrin-B activity. The membrane-binding region of ankyrin-B is composed of 24 consecutive ankyrin repeats, and ... Ankyrin-B is a member of the ankyrin family of proteins, and is a modular protein which is composed of three structural domains ...
... s typically fold together to form a single, linear solenoid structure called ankyrin repeat domains. These ... A structure-based study involving a range of ankyrin proteins of known structures, shows that consensus-based ankyrin proteins ... A specialized family of ankyrin proteins known as muscle ankyrin repeat proteins (MARPs) are involved with the repair and ... designed ankyrin repeat protein), an engineered antibody mimetic based on the structure of ankyrin repeats PDB: 1N11​; Michaely ...
... (ANK-3), also known as ankyrin-G, is a protein from ankyrin family that in humans is encoded by the ANK3 gene. The ... The genetic deletion of ankyrin-G from multiple neuron types has shown that ankyrin-G is required for the normal clustering of ... Most ankyrins are typically composed of three structural domains: an amino-terminal domain containing multiple ankyrin repeats ... Lambert S, Davis JQ, Bennett V (September 1997). "Morphogenesis of the node of Ranvier: co-clusters of ankyrin and ankyrin- ...
Ankyrin 1, also known as ANK-1, and erythrocyte ankyrin, is a protein that in humans is encoded by the ANK1 gene. The protein ... Most ankyrins are typically composed of three structural domains: an amino-terminal domain containing multiple ankyrin repeats ... 1996). "Ankyrin Napoli: a de novo deletional frameshift mutation in exon 16 ankyrin gene (ANK1) associated with spherocytosis ... "Entrez Gene: ANK1 ankyrin 1, erythrocytic". De Jager, P. L.; Srivastava, G; Lunnon, K; Burgess, J; Schalkwyk, L. C.; Yu, L; ...
"Entrez Gene: Ankyrin repeat domain 22". Retrieved 2018-07-11. Grupe A, Li Y, Rowland C, Nowotny P, Hinrichs AL, Smemo S, Kauwe ... Ankyrin repeat domain 22 is a protein that in humans is encoded by the ANKRD22 gene. GRCh38: Ensembl release 89: ...
... is a protein that in humans is encoded by the ANKRD11 gene. This locus encodes an ankyrin repeat ... "Entrez Gene: Ankyrin repeat domain 11". Retrieved 2018-04-12. Zhang A, Li CW, Chen JD (July 2007). "Characterization of ... transcriptional regulatory domains of ankyrin repeat cofactor-1". Biochem. Biophys. Res. Commun. 358 (4): 1034-40. doi:10.1016/ ...
... is a protein that in humans is encoded by the NRARP gene. GRCh38: Ensembl release 89: ... Chu BF, Qin YY, Zhang SL, Quan ZW, Zhang MD, Bi JW (July 2016). "Downregulation of Notch-regulated Ankyrin Repeat Protein ... Imaoka T, Okutani T, Daino K, Iizuka D, Nishimura M, Shimada Y (May 2014). "Overexpression of NOTCH-regulated ankyrin repeat ... "Entrez Gene: NOTCH regulated ankyrin repeat protein". Retrieved 2018-04-27. ...
... is a protein that in humans is encoded by the KANK4 gene. GRCh38: Ensembl release 89: ... "Entrez Gene: KN motif and ankyrin repeat domains 4". Retrieved 2017-09-07. v t e (Articles with short description, Short ...
Interactions with ankyrin-G (ankyrin-3) are crucial to the localisation of voltage-gated sodium channels (VGSCs) at the axonal ... This conserved 9-amino acid motif ((V/A)P(I/L)AXXE(S/D)D) is required for ankyrin-G binding and functions to localise sodium ... Pan Z, Kao T, Horvath Z, Lemos J, Sul JY, Cranstoun SD, Bennett V, Scherer SS, Cooper EC (March 2006). "A common ankyrin-G- ... In molecular biology, the ankyrin-G binding motif of KCNQ2-3 is a protein motif found in the potassium channels KCNQ2 and KCNQ3 ...
... is a protein that in humans is encoded by the BANK1 gene. The protein encoded by ... "Entrez Gene: B cell scaffold protein with ankyrin repeats 1". Retrieved 2018-06-04. Kozyrev SV, Abelson AK, Wojcik J, Zaghlool ...
They contain multiple ankyrin repeats. The INK4a/ARF/INK4b locus encodes three genes (p15INK4b, ARF, and p16INK4a) in a 35- ... P15 is also formed from four ankyrin repeat (AR) motifs. Expression of P15INK4b is induced by TGF-b indicating its role as a ... P16 is formed from four ankyrin repeat (AR) motifs that exhibit a helix-turn-helix conformation except that the first helix in ...
"Entrez Gene: Ankyrin repeat domain 33". Retrieved 2018-04-17. v t e (Genes on human chromosome 12, All stub articles, Human ... Ankyrin repeat domain 33 is a protein that in humans is encoded by the ANKRD33 gene. GRCh38: Ensembl release 89: ...
... ankyrin-B-related; 600919; ANK2 Cardiac conduction defect, nonspecific; 612838; SCN1B Cardioencephalomyopathy, fatal infantile ...
Ankyrin repeat domain 31 is a protein that in humans is encoded by the ANKRD31 gene. GRCh38: Ensembl release 89: ... "Entrez Gene: Ankyrin repeat domain 31". Retrieved 2016-05-13. v t e (Articles with short description, Short description matches ...
NUC-2 contains several ankyrin repeats. Several members of this family are annotated as XPR1 proteins: the xenotropic and ...
Ankyrin repeat domain-containing protein 17 is a protein that in humans is encoded by the ANKRD17 gene. This gene encodes a ... "Entrez Gene: ANKRD17 ankyrin repeat domain 17". Human ANKRD17 genome location and ANKRD17 gene details page in the UCSC Genome ... protein with ankyrin repeats, which are associated with protein-protein interactions. Studies in mice suggest that this protein ...
KN motif and ankyrin repeat domain-containing protein 2 is a protein that in humans is encoded by the KANK2 gene. GRCh38: ... "Entrez Gene: ANKRD25 ankyrin repeat domain 25". Human KANK2 genome location and KANK2 gene details page in the UCSC Genome ... Zhu Y, Kakinuma N, Wang Y, Kiyama R (Jan 2008). "Kank proteins: a new family of ankyrin-repeat domain-containing proteins". ... 2007). "SIP, a novel ankyrin repeat containing protein, sequesters steroid receptor coactivators in the cytoplasm". EMBO J. 26 ...
Ankyrin repeat domain-containing protein 13C is a protein that in humans is encoded by the ANKRD13C gene. ANKRD13C is predicted ... "Entrez Gene: ANKRD13C ankyrin repeat domain 13C". Chatr-Aryamontri A, Oughtred R, Boucher L, Rust J, Chang C, Kolas NK, ...
KN motif and ankyrin repeat domain-containing protein 1 is a protein that in humans is encoded by the KANK1 gene. This gene ... "Entrez Gene: ANKRD15 ankyrin repeat domain 15". Human KANK1 genome location and KANK1 gene details page in the UCSC Genome ... Sarkar S, Roy BC, Hatano N, Aoyagi T, Gohji K, Kiyama R (Sep 2002). "A novel ankyrin repeat-containing gene (Kank) located at ... Zhu Y, Kakinuma N, Wang Y, Kiyama R (Jan 2008). "Kank proteins: a new family of ankyrin-repeat domain-containing proteins". ...
"Entrez Gene: KRIT1 KRIT1, ankyrin repeat containing". Pagenstecher A, Stahl S, Sure U, Felbor U (Mar 2009). "A two-hit ... a novel ankyrin repeat-containing protein encoded by a gene mapping to 7q21-22". Oncogene. 15 (9): 1043-9. doi:10.1038/sj.onc. ...
This gene is a member of the muscle ankyrin repeat protein (MARP) family and encodes a protein with four tandem ankyrin-like ... 2003), "The muscle ankyrin repeat proteins: CARP, ankrd2/Arpp and DARP as a family of titin filament-based stress response ... Ankyrin repeat domain-containing protein 23 is a protein that in humans is encoded by the ANKRD23 gene. ... "Entrez Gene: ANKRD23 ankyrin repeat domain 23". Miller, Melanie K; Bang Marie-Louise; Witt Christian C; Labeit Dietmar; ...
Hayashi T, Su TP (January 2001). "Regulating ankyrin dynamics: Roles of sigma-1 receptors". Proceedings of the National Academy ...
"ANK2 ankyrin 2 [Homo sapiens (human)] - Gene - NCBI". www.ncbi.nlm.nih.gov. Retrieved 2017-04-06. "KCNE1 potassium voltage- ...
... where ankyrin should be bound in the L1CAM family cytoplasmic terminus. Ankyrin-L1CAM interaction is involved in the growth ... Ankyrin interaction with L1CAM is an example of a protein binding that fails in CRASH patients due to a mutation that causes ... The most important binding partners of the cytoplasmic tail of L1 proteins are ankyrins. The interaction is held in high- ... "Tyrosine phosphorylation at a site highly conserved in the L1 family of cell adhesion molecules abolishes ankyrin binding and ...
Jenkins SM, Bennett V (November 2001). "Ankyrin-G coordinates assembly of the spectrin-based membrane skeleton, voltage-gated ... "Ankyrin-based subcellular gradient of neurofascin, an immunoglobulin family protein, directs GABAergic innervation at purkinje ... "The phosphorylation state of the FIGQY tyrosine of neurofascin determines ankyrin-binding activity and patterns of cell ... "Structural requirements for association of neurofascin with ankyrin". The Journal of Biological Chemistry. 273 (46): 30785-94. ...
They are derived from natural ankyrin repeat proteins. Repeat proteins are among the most common classes of binding proteins in ... Plückthun, A (2015). "Designed ankyrin repeat proteins (DARPins): binding proteins for research, diagnostics, and therapy". ... "High-affinity binders selected from designed ankyrin repeat protein libraries". Nature Biotechnology. 22 (5): 575-582. doi: ...
Tetratricopeptide repeat and ankyrin repeat containing 1 is a protein that in humans is encoded by the TRANK1 gene. Through a ... "Entrez Gene: Tetratricopeptide repeat and ankyrin repeat containing 1". Mühleisen TW, Leber M, Schulze TG, Strohmaier J, ...
Ankyrin repeat domain-1 was overexpressed in both groups. Underexpressed genes in both groups included myosin light chain ...
These orthologs share a similarity with POTEB largely due to the presence of ankyrin repeats, suggesting that ankyrin domain- ... POTE ankyrin domain family, member B is a protein in humans that is encoded by the POTEB gene.(Prostate, Ovary, Testes ... "Entrez Gene: POTE ankyrin domain family, member B". Retrieved 2012-11-26. Mosavi LK, Cammett TJ, Desrosiers DC, Peng ZY (June ... POTEB is most likely involved in mediating protein-protein interaction via its 5 ankyrin domains. POTEB is most probably aids ...
Ankyrin-B syndrome is associated with a variety of heart problems related to disruption of the hearts normal rhythm ( ... Ankyrin-B syndrome is caused by mutations in the ANK2 gene, which provides instructions for making a protein called ankyrin-B. ... Ankyrin-B syndrome is inherited in an autosomal dominant pattern. , which means one copy of the altered ANK2 gene in each cell ... Ankyrin-B syndrome: a case of sinus node dysfunction, atrial fibrillation and prolonged QT in a young adult. Heart Lung Circ. ...
The ankyrin of red blood cells (erythrocytic ankyrin) is called ankyrin-R or ankyrin-1. It is represented by the symbol ANK1. ... HS is due to a deficiency of a protein called ankyrin. Ankyrins are cell membrane proteins (thought to interconnect integral ... Ankyrin deficiency: Known also as hereditary spherocytosis (HS), this is a genetic disorder of the red blood cell membrane ... HS is also known as congenital hemolytic jaundice, severe atypical spherocytosis, spherocytosis type II, erythrocyte ankyrin ...
Ank_2; Ankyrin repeats (3 copies). pfam13637. Location:8 → 41. Ank_4; Ankyrin repeats (many copies). sd00045. Location:29 → 60 ... Ank_2; Ankyrin repeats (3 copies). pfam13637. Location:24 → 74. Ank_4; Ankyrin repeats (many copies). sd00045. Location:53 → 84 ... ANK; ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins. The number of ... ANK; ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins. The number of ...
This website uses cookies to improve your experience while you navigate through the website. Out of these cookies, the cookies that are categorized as necessary are stored on your browser as they are essential for the working of basic functionalities of the website. We also use third-party cookies that help us analyze and understand how you use this website. These cookies will be stored in your browser only with your consent. You also have the option to opt-out of these cookies. But opting out of some of these cookies may have an effect on your browsing experience ...
NMR analysis identifies the ankyrin domain as a new ubiquitin-binding fold, which we have termed AnkUBD, and DUB assays in ... A crystal structure of the extended catalytic domain reveals an unpredicted ankyrin repeat domain that precedes an A20-like ... Structural analysis of TRABID reveals an unpredicted ankyrin-repeat domain that binds ubiquitin and is crucial for TRABID ... Figure 2: TRABID contains two ankyrin repeats with roles in ubiquitin binding.. ...
More info for Family a.118.24.1: Pseudo ankyrin repeat. Timeline for Family a.118.24.1: Pseudo ankyrin repeat: *Family a.118.24 ... one repeat consist of 3 helices; there are similarities in the repeat sequence and assembly with the ankyrin repeat (48404). ... Pseudo ankyrin repeat first appeared in SCOP 1.73. *Family a.118.24.1: Pseudo ankyrin repeat appears in SCOPe 2.07. ... Superfamily a.118.24: Pseudo ankyrin repeat-like [140860] (1 family) contains three helices per turn of the superhelix. ...
Fusion protein amino acids 203-496 of human Ankyrin-B (also known as ankyrin-2, brain ankyrin and non-erythroid ankyrin, ... Ankyrin-2 or -Ankyrin-B is encoded by the gene ANK2. Ankyrin B is a scaffold protein that functions to link proteins that ... Ankyrin B is expressed in brain and muscle. Mutations in this gene cause long QT syndrome 4 and cardiac arrhythmia syndrome. ... Ho TS, Zollinger DR, Chang KJ, Xu M, Cooper EC, Stankewich MC, Bennett V, Rasband MN (2014), A hierarchy of ankyrin-spectrin ...
We have selected designed ankyrin repeat proteins (DARPins) from a synthetic library by using ribosome display that selectively ... We have selected designed ankyrin repeat proteins (DARPins) from a synthetic library by using ribosome display that selectively ... Structural and functional analysis of phosphorylation-specific binders of the kinase ERK from designed ankyrin repeat protein ... Download PDF Structural and functional analysis of phosphorylation-specific binders of the kinase ERK from designed ankyrin ...
Ankyrin binding activity shared by the neurofascin/L1/NrCAM family of nervous system cell adhesion molecules. ... Ankyrin binding activity shared by the neurofascin/L1/NrCAM family of nervous system cell adhesion molecules. Journal Article ( ... Linkage of these ankyrin-binding cell adhesion molecules to spectrin-based structures may provide a major class of membrane- ... This report presents biochemical evidence that the cytoplasmic domains of these molecules associate directly with ankyrins, a ...
Recent progress in the field has provided new insights into the structure and function of the ankyrin repeat motifs present in ... A primer on ankyrin repeat function in TRP channels and beyond Mol Biosyst. 2008 May;4(5):372-9. doi: 10.1039/b801481g. Epub ... Recent progress in the field has provided new insights into the structure and function of the ankyrin repeat motifs present in ... The topics addressed in this Highlight include the structural features of canonical ankyrin repeats, new clues into the ...
Ankyrin defects. HS is described in patients with translocation of chromosome 8 or deletion of the short arm of chromosome 8, ... where the ankyrin gene is located. Patients with HS and deletion of chromosome 8 have a decrease in red cell ankyrin content. ... Ankyrin is the principal binding site for spectrin on the red cell membrane. Studies of cytoskeletal protein assembly in ... Of particular interest, 75-80% of patients with autosomal dominant HS have combined spectrin and ankyrin deficiency and the two ...
Morgans, C. W. ; Kopito, R. R. / Association of the brain anion exchanger, AE3, with the repeat domain of ankyrin. In: Journal ... Morgans, C. W., & Kopito, R. R. (1993). Association of the brain anion exchanger, AE3, with the repeat domain of ankyrin. ... Morgans, CW & Kopito, RR 1993, Association of the brain anion exchanger, AE3, with the repeat domain of ankyrin, Journal of ... Association of the brain anion exchanger, AE3, with the repeat domain of ankyrin. / Morgans, C. W.; Kopito, R. R. ...
ankyrin repeat domain 23 MGI:1925571 .yui-skin-sam .yui-dt th{ background:url(https://www.informatics.jax.org/webshare/images/ ...
Name: ankyrin 3, epithelial. Synonyms: Ank-3, Ankyrin-3, AnkG, 2900054D09Rik, Ankyrin-G ...
... ankyrin host range; IL18BP, interleukin 18 binding protein; UL, ubiquitin ligase; IL1rAnt interleukin 1 receptor antagonist; ...
Ankyrin-R Links Kv3.3 to the Spectrin Cytoskeleton and Is Required for Purkinje Neuron Survival.. Stevens, Sharon R; van der ... Ankyrin scaffolding proteins are critical for membrane domain organization and protein stabilization in many different cell ... Here, we show that Ankyrin-R (AnkR) links Kv3.3 K+ channels to the ß3 spectrin-based cytoskeleton in Purkinje neurons. Loss of ... In the cerebellum, Ankyrin-R (AnkR) is highly enriched in Purkinje neurons, granule cells, and in the cerebellar nuclei (CN). ...
Schizosaccharomyces pombe Ankyrin repeat-containing protein P16F5.05c (SPBP16F5.05c) datasheet and description hight quality ... 05c (SPBP16F5, 05c), Recombinant Schizosaccharomyces pombe Ankyrin repeat-containing protein P16F5. Alternative names: Ankyrin ... Schizosaccharomyces pombe Ankyrin repeat-containing protein P16F5.05c (SPBP16F5.05c). Contact us. ... 05c (SPBP16F5, 05c), Schizosaccharomyces pombe Ankyrin repeat-containing protein P16F5. Alternative name: 05c (SPBP16F5, 05c), ...
Ankyrin Is An Intracellular Tether for TMC Mechanotransduction Channels. Yi Quan Tang, Sol Ah Lee, Mizanur Rahman, Siva A. ... Tang, Y. Q., Lee, S. A., Rahman, M., Vanapalli, S. A., Lu, H., & Schafer, W. R. (2020). Ankyrin Is An Intracellular Tether for ... Ankyrin Is An Intracellular Tether for TMC Mechanotransduction Channels. Neuron. 2020 Jul 8;107(1):112-125.e10. doi: 10.1016/j. ... Ankyrin Is An Intracellular Tether for TMC Mechanotransduction Channels. In: Neuron. 2020 ; Vol. 107, No. 1. pp. 112-125.e10. ...
NF-kappa B and related proteins: Rel/dorsal homologies meet ankyrin-like repeats. scientific article published on April 1, 1992 ... NF-kappa B and related proteins: Rel/dorsal homologies meet ankyrin-like repeats (English) ...
Here we demonstrate that giant ankyrin-G (480-kDa ankyrin-G) promotes stability of somatodendritic GABAergic synapses in vitro ... Here we demonstrate that giant ankyrin-G (480-kDa ankyrin-G) promotes stability of somatodendritic GABAergic synapses in vitro ... Here we demonstrate that giant ankyrin-G (480-kDa ankyrin-G) promotes stability of somatodendritic GABAergic synapses in vitro ... Here we demonstrate that giant ankyrin-G (480-kDa ankyrin-G) promotes stability of somatodendritic GABAergic synapses in vitro ...
EuHMT1 (Glp) Ankyrin Repeat Domain (Structure 2). 3c5r. Crystal Structure of the BARD1 Ankyrin Repeat Domain and Its Functional ... 3ANK: A designed ankyrin repeat protein with three identical consensus repeats. 1n0r. 4ANK: A designed ankyrin repeat protein ... The ankyrin repeat domain of Huntingtin interacting protein 14. 3f6q. Crystal structure of integrin-linked kinase ankyrin ... Inhibition of caspase-2 by a designed ankyrin repeat protein (DARPin). 2pnn. Crystal Structure of the Ankyrin Repeat Domain of ...
Fragment-based screening identifies molecules targeting the substrate-binding ankyrin repeat domains of tankyrase.. 18/12/2019 ...
Asparaginyl Hydroxylation of the Notch Ankyrin Repeat Domain by Factor Inhibiting Hypoxia-inducible Factor Share Share Share ... Asparaginyl Hydroxylation of the Notch Ankyrin Repeat Domain by Factor Inhibiting Hypoxia-inducible Factor ...
G-patch domain and ankyrin repeats 1. protein-coding. GALNT13. polypeptide N-acetylgalactosaminyltransferase 13. protein-coding ...
Desmin binds to ankyrin, spectrin, synemin, syncoilin, plectin, and nebulin. IFs form a heteropolymeric lattice to organize the ...
Crystal Structure of Integrin-Linked Kinase Ankyrin Repeat Domain in Complex with PINCH1 LIM1 Domain ... The structure of Crystal Structure of Integrin-Linked Kinase Ankyrin Repeat Domain in Complex with PINCH1 LIM1 Domain also ... Zinc in PDB 3f6q: Crystal Structure of Integrin-Linked Kinase Ankyrin Repeat Domain in Complex with PINCH1 LIM1 Domain. ... The binding sites of Zinc atom in the Crystal Structure of Integrin-Linked Kinase Ankyrin Repeat Domain in Complex with PINCH1 ...
8.A.28 - The Ankyrin (Ankyrin) Family. 8.A.35 - The Mycobacterial Membrane Protein Small (MmpS) Family. 9.A.43 - The Cadmium ... Ankyrin Repeat Domain-containing (Ank) Superfamily. The Ankyrin Repeat Domain-containing (Ank) Superfamily is a domain found in ...
We focused our attention on the ankyrin domain, which closely resembles the D34 domain of human ankyrin R. Conserved residues ... Conserved residues in the ankyrin domain of VAPYRIN indicate potential protein-protein interaction surfaces. * Feddermann, ... VAPYRINs are plant-specific proteins that consists of a major sperm protein (MSP) domain and an ankyrin domain. Comparison of ... within the petunia VAPYRIN cluster to a surface patch on the concave side of the crescent-shaped ankyrin domain, suggesting ...
Ankyrin-G conditional knockout mice showed significantly decreased DAGLα-positive neurons in the forebrain. In mice, ankyrin-G ... The 2-AG-independent effects were mediated by the interaction of DAGLα with ankyrin-G, a multifunctional scaffold protein ... cAMP Signaling-Mediated Phosphorylation of Diacylglycerol Lipase α Regulates Interaction With Ankyrin-G and Dendritic Spine ... cAMP Signaling-Mediated Phosphorylation of Diacylglycerol Lipase α Regulates Interaction With Ankyrin-G and Dendritic Spine ...
Asparagine and Aspartate Hydroxylation of the Cytoskeletal Ankyrin Family Is Catalyzed by Factor-inhibiting Hypoxia-inducible ... Asparagine and Aspartate Hydroxylation of the Cytoskeletal Ankyrin Family Is Catalyzed by Factor-inhibiting Hypoxia-inducible ...
  • Ankyrins are cell membrane proteins (thought to interconnect integral proteins with the spectrin-based membrane skeleton. (medicinenet.com)
  • Ankyrin B is a scaffold protein that functions to link proteins that mediate the attachment of integral membrane proteins to the spectrin-actin based membrane cytoskeleton. (antibodiesinc.com)
  • In this manner, ankyrin family proteins play key roles in various processes including cell motility, activation, proliferation, contact and the maintenance of specialized membrane domains. (antibodiesinc.com)
  • We have selected designed ankyrin repeat proteins (DARPins) from a synthetic library by using ribosome display that selectively bind to the mitogen-activated protein kinase ERK2 (extracellular signal-regulated kinase 2) in either its nonphosphorylated (inactive) or doubly phosphorylated (active) form. (uzh.ch)
  • This report presents biochemical evidence that the cytoplasmic domains of these molecules associate directly with ankyrins, a family of spectrin-binding proteins located on the cytoplasmic surface of specialized plasma membrane domains. (duke.edu)
  • The topics addressed in this Highlight include the structural features of canonical ankyrin repeats, new clues into the functions these repeats perform in cells, and how this information can be applied to develop further experiments on TRP channels and other proteins containing ankyrin repeats. (nih.gov)
  • Ankyrin scaffolding proteins are critical for membrane domain organization and protein stabilization in many different cell types including neurons . (bvsalud.org)
  • Our results may help explain why mutations in ß3 spectrin and Kv3.3 both cause spinocerebellar ataxia.SIGNIFICANCE STATEMENT Ankyrin scaffolding proteins localize and stabilize ion channels in the membrane by linking them to the spectrin -based cytoskeleton . (bvsalud.org)
  • VAPYRINs are plant-specific proteins that consists of a major sperm protein (MSP) domain and an ankyrin domain. (unifr.ch)
  • These results suggest a marked conformational alteration in both cytoskeletal and transmembrane proteins as a result of uncoupling from ankyrin. (uky.edu)
  • Tvl-1 is a 269-amino acid ankyrin repeat protein expressed primarily in thymus, lung, and testes that was identified by screening a murine T-cell two-hybrid cDNA library for proteins that associate with the serine-threonine kinase Raf-1. (elsevier.com)
  • Ankyrin repeat (ANK) domains are one of the most abundant motifs in eukaryotic proteins. (surrey.ac.uk)
  • Interacts through its N-terminal region with the ankyrin repeat region of the Notch proteins NOTCH1, NOTCH2, NOTCH3 and NOTCH4. (icr.ac.uk)
  • Figure 2: TRABID contains two ankyrin repeats with roles in ubiquitin binding. (nature.com)
  • The 89 kDa NH2-terminal domain of erythrocyte ankyrin is composed almost entirely of 22 tandem repeats of a 33 amino acid sequence and constitutes the binding site for the cytoplasmic NH 2 -terminal domain of the erythrocyte anion exchanger, AE1. (elsevier.com)
  • Ankyrin repeats are about 33 amino acids long and occur in at least four consecutive copies. (embl.de)
  • Ankyrin repeats are tandemly repeated modules of about 33 amino acids. (embl.de)
  • Crystal structure of the ARF-GAP domain and ankyrin repeats of PYK2-associated protein beta. (embl.de)
  • PAPbeta, a protein that binds to and is phosphorylated by the non-receptor tyrosine kinase PYK2, contains several modular signaling domains including a pleckstrin homology domain, an SH3 domain, ankyrin repeats and an ARF-GAP domain. (embl.de)
  • The crystal structure of the PAPbeta ARF-GAP domain and the C-terminal ankyrin repeats has been determined at 2.1 A resolution. (embl.de)
  • Four ankyrin repeats are also present, the first two of which form an extensive interface with the ARF-GAP domain. (embl.de)
  • It shows a stack of six IkappaBalpha ankyrin repeats facing the C-terminal domains of the NF-kappaB Rel homology regions. (embl.de)
  • A crystal structure of the extended catalytic domain reveals an unpredicted ankyrin repeat domain that precedes an A20-like catalytic core. (nature.com)
  • Bulk Order Inquiry for Anti-Ankyrin-B Antibody ------- (please add any order requirements, including desired quantity, timing, etc. (antibodiesinc.com)
  • The immunogen recognized by this antibody maps to a region between residue 975 and 1025 of human ankyrin repeat domain 28 (phosphatase interactor targeting K protein) using the numbering given in entry NP_056014.2 (GeneID 23243). (novusbio.com)
  • NMR analysis identifies the ankyrin domain as a new ubiquitin-binding fold, which we have termed AnkUBD, and DUB assays in vitro and in vivo show that this domain is crucial for TRABID efficiency and linkage specificity. (nature.com)
  • Recent progress in the field has provided new insights into the structure and function of the ankyrin repeat motifs present in the N-terminal cytosolic domain of many TRP channels. (nih.gov)
  • We have developed an assay to evaluate the in vivo interaction between a fragment of ankyrin corresponding to this domain (ANK90) and two non-erythroid anion exchangers, AE2 and AE3, that share considerable structural homology with AE1. (elsevier.com)
  • The structure of the IkappaBalpha ankyrin repeat domain, bound to a partially truncated NF-kappaB heterodimer (p50/ p65), has been determined by X-ray crystallography at 2.7 A resolution. (embl.de)
  • We focused our attention on the ankyrin domain, which closely resembles the D34 domain of human ankyrin R. Conserved residues within the petunia VAPYRIN cluster to a surface patch on the concave side of the crescent-shaped ankyrin domain, suggesting that this region may represent a conserved binding site involved in the formation of a protein complex with an essential function in intracellular accommodation of microbial endosymbionts. (unifr.ch)
  • Tvl- 1 interacts with Raf-1 via its carboxyl-terminal ankyrin repeat domain. (elsevier.com)
  • Danio rerio ankyrin repeat domain 10b (ankrd10b), mRNA. (genscript.com)
  • ankyrin repeat domain 9 [So. (gsea-msigdb.org)
  • The ankyrin repeat is one of the most common protein-protein interaction motifs in nature. (embl.de)
  • Ankyrin-B syndrome is caused by mutations in the ANK2 gene, which provides instructions for making a protein called ankyrin-B. This protein is active in many cell types, including heart (cardiac) muscle cells. (medlineplus.gov)
  • Mutations in the ANK2 gene lead to production of an altered ankyrin-B protein that cannot target ion channels to their correct locations in cardiac muscle cells. (medlineplus.gov)
  • Not everyone with an ANK2 gene mutation has heart problems related to ankyrin-B syndrome. (medlineplus.gov)
  • Ankyrin-2 or -Ankyrin-B is encoded by the gene ANK2. (antibodiesinc.com)
  • Ankyrin-R Links Kv3.3 to the Spectrin Cytoskeleton and Is Required for Purkinje Neuron Survival. (bvsalud.org)
  • Here, we show that Ankyrin -R (AnkR) links Kv3.3 K+ channels to the ß3 spectrin -based cytoskeleton in Purkinje neurons . (bvsalud.org)
  • Erythrocyte-related isoforms of ankyrin attach the SPECTRIN cytoskeleton to a transmembrane protein (ANION EXCHANGE PROTEIN 1, ERYTHROCYTE) in the erythrocyte plasma membrane. (bvsalud.org)
  • show that the mechanosensory activity of C. elegans TMCs requires the intracellular tether ankyrin, which interacts with TMC-1 through the adaptor protein CALM-1. (ttu.edu)
  • HS is also known as congenital hemolytic jaundice, severe atypical spherocytosis, spherocytosis type II, erythrocyte ankyrin deficiency, ankyrin-R deficiency, and ankyrin1 deficiency. (medicinenet.com)
  • A fraction of band 3 protein, the major transmembrane protein of erythrocyte membranes is held to the cytoskeletal protein spectrin via noncovalent interactions with the protein ankyrin (band 2.1). (uky.edu)
  • In this study, trypsin was used under defined conditions to selectively proteolyze ankyrin and thereby destroy the band 3-ankyrin linkage on the cytoplasmic side of erythrocyte ghost membranes. (uky.edu)
  • Linkage of these ankyrin-binding cell adhesion molecules to spectrin-based structures may provide a major class of membrane-cytoskeletal connections in adult brain as well as earlier stages of development. (duke.edu)
  • Loss of transient receptor potential ankyrin 1 channel deregulates emotional, social, cognitive, learning and memory development. (ym.edu.tw)
  • The 2-AG-independent effects were mediated by the interaction of DAGLα with ankyrin-G, a multifunctional scaffold protein implicated in psychiatric disorders. (cannabisclinicians.org)
  • Contacts occur in discontinuous patches, suggesting a combinatorial quality for ankyrin repeat specificity. (embl.de)
  • Defects in ankyrin-based membrane protein targeting pathways underlie atrial fibrillation. (medlineplus.gov)
  • We further find that giant ankyrin-G promotes GABAergic synapse stability through opposing endocytosis of GABA A receptors, and requires a newly described interaction with GABARAP, a GABA A receptor-associated protein. (elsevier.com)
  • In situ proximity ligation assay combined with structured illumination microscopy revealed that DAGLα phosphorylation upon forskolin treatment enhanced the interaction with ankyrin-G in spines, leading to increased spine size and decreased DAGLα surface diffusion. (cannabisclinicians.org)
  • Structural requirements for interaction of sodium channel beta 1 subunits with ankyrin. (bvsalud.org)
  • The ankyrin fold appears to be defined by its structure rather than its function since there is no specific sequence or structure which is universally recognised by it. (embl.de)
  • In the cerebellum , Ankyrin -R (AnkR) is highly enriched in Purkinje neurons , granule cells , and in the cerebellar nuclei (CN). (bvsalud.org)
  • Moreover, giant ankyrin-G forms developmentally regulated and cell-type-specific micron-scale domains within extrasynaptic somatodendritic plasma membranes of pyramidal neurons. (elsevier.com)
  • Ankyrin-G conditional knockout mice showed significantly decreased DAGLα-positive neurons in the forebrain. (cannabisclinicians.org)
  • Ankyrin-B syndrome is associated with a variety of heart problems related to disruption of the heart's normal rhythm (arrhythmia). (medlineplus.gov)
  • In ankyrin-B syndrome, disruption of different steps of electrical signaling can lead to arrhythmia, and the resulting heart problems vary among affected individuals. (medlineplus.gov)
  • Individuals with ankyrin-B syndrome may have problems with the sinoatrial (SA) node, which generates the electrical impulses that start each heartbeat. (medlineplus.gov)
  • Other heart problems that occur in ankyrin-B syndrome include irregular and uncoordinated electrical activity in the heart's upper chambers (atrial fibrillation) or lower chambers (ventricular fibrillation) and an abnormality called catecholaminergic polymorphic ventricular tachycardia (CPVT), in which an increase in the heart rate can trigger an abnormally fast and irregular heartbeat called ventricular tachycardia . (medlineplus.gov)
  • In people with ankyrin-B syndrome, arrhythmia can lead to fainting (syncope) or cardiac arrest and sudden death. (medlineplus.gov)
  • However, because additional heart problems can result from changes in the same gene, long QT syndrome 4 is usually considered part of ankyrin-B syndrome. (medlineplus.gov)
  • Ankyrin-B syndrome is a rare disorder. (medlineplus.gov)
  • The loss of functional ion channels in the heart disrupts the normal flow of ions, which alters the heart's normal rhythm and causes the heart problems associated with ankyrin-B syndrome. (medlineplus.gov)
  • Known also as hereditary spherocytosis (HS), this is a genetic disorder of the red blood cell membrane clinically characterized by anemia , jaundice (yellowing) and splenomegaly (enlargement of the spleen), due to deficiency of ankyrin, a protein in the membrane of the red cell. (medicinenet.com)
  • We thus present a new mechanism for stabilization of GABAergic interneuron synapses and micron-scale organization of extrasynaptic membrane that provides a rationale for studies linking ankyrin-G genetic variation with psychiatric disease and abnormal neurodevelopment. (elsevier.com)
  • Association was assessed by coimmunoprecipitation of ANK90-anion exchanger com plexes from detergent extracts of cells cotransfected with plasmids encoding the ankyrin fragment and the anion exchanger or mutants thereof. (elsevier.com)
  • Fragment-based screening identifies molecules targeting the substrate-binding ankyrin repeat domains of tankyrase. (sguettlerlab.org)
  • Here we demonstrate that giant ankyrin-G (480-kDa ankyrin-G) promotes stability of somatodendritic GABAergic synapses in vitro and in vivo. (elsevier.com)
  • Molecular architecture of the ankyrin SOCS box family of Cul5-dependent E3 ubiquitin ligases. (ox.ac.uk)
  • Ankyrin binding activity shared by the neurofascin/L1/NrCAM family of nervous system cell adhesion molecules. (duke.edu)
  • Ankyrin B is expressed in brain and muscle. (antibodiesinc.com)
  • Using this assay, we show that the brain anion exchanger AE3, but not the closely related homologue, AE2, is capable of binding to ankyrin. (elsevier.com)
  • Brain-related isoforms of ankyrin also exist. (bvsalud.org)
  • Dysfunction in ankyrin-B-dependent ion channel and transporter targeting causes human sinus node disease. (medlineplus.gov)
  • We will then review possible activation and/or potentiation of TRP vanilloid type 1 (TRPV1) and ankyrin 1 (TRPA1) channels by PM and PAHs. (cdc.gov)
  • Others produce unstable beta-spectrins or abnormal beta-spectrins that do not bind to ankyrin and undergo proteolytic degradation. (medscape.com)