AnatomyOrganismsDiseasesChemicals and DrugsAnalytical, Diagnostic and Therapeutic Techniques and EquipmentPsychiatry and PsychologyPhenomena and ProcessesInformation Science
Ankyrin RepeatAnkyrinsMolecular Sequence DataAmino Acid SequenceRepetitive Sequences, Nucleic AcidTankyrasesTrinucleotide RepeatsRepetitive Sequences, Amino AcidSpectrinProtein BindingProtein Structure, TertiaryI-kappa B ProteinsBase SequenceTandem Repeat SequencesSequence Homology, Amino AcidFowlpoxReceptors, NotchImmunoglobulin J Recombination Signal Sequence-Binding ProteinReceptor, Notch1Models, MolecularRepressor ProteinsBinding SitesSequence AlignmentAnion Exchange Protein 1, ErythrocyteMuscle ProteinsNF-kappa B p50 SubunitMinisatellite RepeatsMembrane ProteinsTrinucleotide Repeat ExpansionCloning, MolecularTransient Receptor Potential ChannelsNuclear ProteinsMutationCell LineProto-Oncogene Proteins c-relSpherocytosis, HereditaryDNA-Binding ProteinsMirabilisTranscription FactorsProtein EngineeringCarrier ProteinsMicrosatellite RepeatsRecombinant Fusion ProteinsTRPV Cation ChannelsSuppressor of Cytokine Signaling ProteinsErythrocyte MembraneCrystallography, X-RayMyxoma virusDinucleotide RepeatsPan troglodytesApe DiseasesPan paniscusGorilla gorillaTool Use BehaviorGestures
Ankyrin Repeat
Protein motif that contains a 33-amino acid long sequence that often occurs in tandem arrays. This repeating sequence of 33-amino acids was discovered in ANKYRIN where it is involved in interaction with the anion exchanger (ANION EXCHANGE PROTEIN 1, ERYTHROCYTE). Ankyrin repeats cooperatively fold into domains that mediate molecular recognition via protein-protein interactions.
Ankyrins
A family of membrane-associated proteins responsible for the attachment of the cytoskeleton. Erythrocyte-related isoforms of ankyrin attach the SPECTRIN cytoskeleton to a transmembrane protein (ANION EXCHANGE PROTEIN 1, ERYTHROCYTE) in the erythrocyte plasma membrane. Brain-related isoforms of ankyrin also exist.
Molecular Sequence Data
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
Amino Acid Sequence
The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.
Repetitive Sequences, Nucleic Acid
Sequences of DNA or RNA that occur in multiple copies. There are several types: INTERSPERSED REPETITIVE SEQUENCES are copies of transposable elements (DNA TRANSPOSABLE ELEMENTS or RETROELEMENTS) dispersed throughout the genome. TERMINAL REPEAT SEQUENCES flank both ends of another sequence, for example, the long terminal repeats (LTRs) on RETROVIRUSES. Variations may be direct repeats, those occurring in the same direction, or inverted repeats, those opposite to each other in direction. TANDEM REPEAT SEQUENCES are copies which lie adjacent to each other, direct or inverted (INVERTED REPEAT SEQUENCES).
Tankyrases
A group of telomere associated proteins that interact with TRF1 PROTEIN, contain ANKYRIN REPEATS and have poly(ADP-ribose) polymerase activity.
Trinucleotide Repeats
Microsatellite repeats consisting of three nucleotides dispersed in the euchromatic arms of chromosomes.
Repetitive Sequences, Amino Acid
A sequential pattern of amino acids occurring more than once in the same protein sequence.
Spectrin
A high molecular weight (220-250 kDa) water-soluble protein which can be extracted from erythrocyte ghosts in low ionic strength buffers. The protein contains no lipids or carbohydrates, is the predominant species of peripheral erythrocyte membrane proteins, and exists as a fibrous coating on the inner, cytoplasmic surface of the membrane.
Protein Binding
The process in which substances, either endogenous or exogenous, bind to proteins, peptides, enzymes, protein precursors, or allied compounds. Specific protein-binding measures are often used as assays in diagnostic assessments.
Protein Structure, Tertiary
The level of protein structure in which combinations of secondary protein structures (alpha helices, beta sheets, loop regions, and motifs) pack together to form folded shapes called domains. Disulfide bridges between cysteines in two different parts of the polypeptide chain along with other interactions between the chains play a role in the formation and stabilization of tertiary structure. Small proteins usually consist of only one domain but larger proteins may contain a number of domains connected by segments of polypeptide chain which lack regular secondary structure.
I-kappa B Proteins
A family of inhibitory proteins which bind to the REL PROTO-ONCOGENE PROTEINS and modulate their activity. In the CYTOPLASM, I-kappa B proteins bind to the transcription factor NF-KAPPA B. Cell stimulation causes its dissociation and translocation of active NF-kappa B to the nucleus.
Base Sequence
The sequence of PURINES and PYRIMIDINES in nucleic acids and polynucleotides. It is also called nucleotide sequence.
Tandem Repeat Sequences
Copies of DNA sequences which lie adjacent to each other in the same orientation (direct tandem repeats) or in the opposite direction to each other (INVERTED TANDEM REPEATS).
Sequence Homology, Amino Acid
The degree of similarity between sequences of amino acids. This information is useful for the analyzing genetic relatedness of proteins and species.
Fowlpox
A poxvirus infection of poultry and other birds characterized by the formation of wart-like nodules on the skin and diphtheritic necrotic masses (cankers) in the upper digestive and respiratory tracts.
Receptors, Notch
A family of conserved cell surface receptors that contain EPIDERMAL GROWTH FACTOR repeats in their extracellular domain and ANKYRIN repeats in their cytoplasmic domains. The cytoplasmic domain of notch receptors is released upon ligand binding and translocates to the CELL NUCLEUS where it acts as transcription factor.
Immunoglobulin J Recombination Signal Sequence-Binding Protein
A ubiquitously expressed sequence-specific transcriptional repressor that is normally the target of signaling by NOTCH PROTEINS.
Receptor, Notch1
A notch receptor that interacts with a variety of ligands and regulates SIGNAL TRANSDUCTION PATHWAYS for multiple cellular processes. It is widely expressed during EMBRYOGENESIS and is essential for EMBRYONIC DEVELOPMENT.
Models, Molecular
Models used experimentally or theoretically to study molecular shape, electronic properties, or interactions; includes analogous molecules, computer-generated graphics, and mechanical structures.
Repressor Proteins
Proteins which maintain the transcriptional quiescence of specific GENES or OPERONS. Classical repressor proteins are DNA-binding proteins that are normally bound to the OPERATOR REGION of an operon, or the ENHANCER SEQUENCES of a gene until a signal occurs that causes their release.
Binding Sites
The parts of a macromolecule that directly participate in its specific combination with another molecule.
Sequence Alignment
The arrangement of two or more amino acid or base sequences from an organism or organisms in such a way as to align areas of the sequences sharing common properties. The degree of relatedness or homology between the sequences is predicted computationally or statistically based on weights assigned to the elements aligned between the sequences. This in turn can serve as a potential indicator of the genetic relatedness between the organisms.
Anion Exchange Protein 1, Erythrocyte
A major integral transmembrane protein of the ERYTHROCYTE MEMBRANE. It is the anion exchanger responsible for electroneutral transporting in CHLORIDE IONS in exchange of BICARBONATE IONS allowing CO2 uptake and transport from tissues to lungs by the red blood cells. Genetic mutations that result in a loss of the protein function have been associated with type 4 HEREDITARY SPHEROCYTOSIS.
Muscle Proteins
The protein constituents of muscle, the major ones being ACTINS and MYOSINS. More than a dozen accessory proteins exist including TROPONIN; TROPOMYOSIN; and DYSTROPHIN.
NF-kappa B p50 Subunit
A component of NF-kappa B transcription factor. It is proteolytically processed from NF-kappa B p105 precursor protein and is capable of forming dimeric complexes with itself or with TRANSCRIPTION FACTOR RELA. It regulates expression of GENES involved in immune and inflammatory responses.
Minisatellite Repeats
Tandem arrays of moderately repetitive, short (10-60 bases) DNA sequences which are found dispersed throughout the GENOME, at the ends of chromosomes (TELOMERES), and clustered near telomeres. Their degree of repetition is two to several hundred at each locus. Loci number in the thousands but each locus shows a distinctive repeat unit.
Membrane Proteins
Proteins which are found in membranes including cellular and intracellular membranes. They consist of two types, peripheral and integral proteins. They include most membrane-associated enzymes, antigenic proteins, transport proteins, and drug, hormone, and lectin receptors.
Trinucleotide Repeat Expansion
An increased number of contiguous trinucleotide repeats in the DNA sequence from one generation to the next. The presence of these regions is associated with diseases such as FRAGILE X SYNDROME and MYOTONIC DYSTROPHY. Some CHROMOSOME FRAGILE SITES are composed of sequences where trinucleotide repeat expansion occurs.
Cloning, Molecular
The insertion of recombinant DNA molecules from prokaryotic and/or eukaryotic sources into a replicating vehicle, such as a plasmid or virus vector, and the introduction of the resultant hybrid molecules into recipient cells without altering the viability of those cells.
Transient Receptor Potential Channels
A broad group of eukaryotic six-transmembrane cation channels that are classified by sequence homology because their functional involvement with SENSATION is varied. They have only weak voltage sensitivity and ion selectivity. They are named after a DROSOPHILA mutant that displayed transient receptor potentials in response to light. A 25-amino-acid motif containing a TRP box (EWKFAR) just C-terminal to S6 is found in TRPC, TRPV and TRPM subgroups. ANKYRIN repeats are found in TRPC, TRPV & TRPN subgroups. Some are functionally associated with TYROSINE KINASE or TYPE C PHOSPHOLIPASES.
Nuclear Proteins
Proteins found in the nucleus of a cell. Do not confuse with NUCLEOPROTEINS which are proteins conjugated with nucleic acids, that are not necessarily present in the nucleus.
Mutation
Any detectable and heritable change in the genetic material that causes a change in the GENOTYPE and which is transmitted to daughter cells and to succeeding generations.
Cell Line
Established cell cultures that have the potential to propagate indefinitely.
Proto-Oncogene Proteins c-rel
Cellular DNA-binding proteins encoded by the rel gene (GENES, REL). They are expressed predominately in hematopoietic cells and may play a role in lymphocyte differentiation. Rel frequently combines with other related proteins (NF-KAPPA B, I-kappa B, relA) to form heterodimers that regulate transcription. Rearrangement or overexpression of c-rel can cause tumorigenesis.
Spherocytosis, Hereditary
A group of familial congenital hemolytic anemias characterized by numerous abnormally shaped erythrocytes which are generally spheroidal. The erythrocytes have increased osmotic fragility and are abnormally permeable to sodium ions.
DNA-Binding Proteins
Proteins which bind to DNA. The family includes proteins which bind to both double- and single-stranded DNA and also includes specific DNA binding proteins in serum which can be used as markers for malignant diseases.
Mirabilis
A plant genus of the family NYCTAGINACEAE. Members contain Mirabilis antiviral protein (a ribosome-inactivating protein).
Transcription Factors
Endogenous substances, usually proteins, which are effective in the initiation, stimulation, or termination of the genetic transcription process.
Protein Engineering
Procedures by which protein structure and function are changed or created in vitro by altering existing or synthesizing new structural genes that direct the synthesis of proteins with sought-after properties. Such procedures may include the design of MOLECULAR MODELS of proteins using COMPUTER GRAPHICS or other molecular modeling techniques; site-specific mutagenesis (MUTAGENESIS, SITE-SPECIFIC) of existing genes; and DIRECTED MOLECULAR EVOLUTION techniques to create new genes.
Carrier Proteins
Transport proteins that carry specific substances in the blood or across cell membranes.
Microsatellite Repeats
A variety of simple repeat sequences that are distributed throughout the GENOME. They are characterized by a short repeat unit of 2-8 basepairs that is repeated up to 100 times. They are also known as short tandem repeats (STRs).
Recombinant Fusion Proteins
Recombinant proteins produced by the GENETIC TRANSLATION of fused genes formed by the combination of NUCLEIC ACID REGULATORY SEQUENCES of one or more genes with the protein coding sequences of one or more genes.
TRPV Cation Channels
A subgroup of TRP cation channels named after vanilloid receptor. They are very sensitive to TEMPERATURE and hot spicy food and CAPSAICIN. They have the TRP domain and ANKYRIN repeats. Selectivity for CALCIUM over SODIUM ranges from 3 to 100 fold.
Suppressor of Cytokine Signaling Proteins
A family of structurally related proteins that are induced by CYTOKINES and negatively regulate cytokine-mediated SIGNAL TRANSDUCTION PATHWAYS. SOCS proteins contain a central SH2 DOMAIN and a C-terminal region of homology known as the SOCS box.
Erythrocyte Membrane
The semi-permeable outer structure of a red blood cell. It is known as a red cell 'ghost' after HEMOLYSIS.
Crystallography, X-Ray
The study of crystal structure using X-RAY DIFFRACTION techniques. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
Myxoma virus
The type species of LEPORIPOXVIRUS causing infectious myxomatosis, a severe generalized disease, in rabbits. Tumors are not always present.
Dinucleotide Repeats
The most common of the microsatellite tandem repeats (MICROSATELLITE REPEATS) dispersed in the euchromatic arms of chromosomes. They consist of two nucleotides repeated in tandem; guanine and thymine, (GT)n, is the most frequently seen.
Pan troglodytes
The common chimpanzee, a species of the genus Pan, family HOMINIDAE. It lives in Africa, primarily in the tropical rainforests. There are a number of recognized subspecies.
Ape Diseases
Diseases of chimpanzees, gorillas, and orangutans.
Pan paniscus
The pygmy chimpanzee, a species of the genus Pan, family HOMINIDAE. Its common name is Bonobo, which was once considered a separate genus by some; others considered it a subspecies of PAN TROGLODYTES. Its range is confined to the forests of the central Zaire basin. Despite its name, it is often of equal size to P. troglodytes.
Gorilla gorilla
This single species of Gorilla, which is a member of the HOMINIDAE family, is the largest and most powerful of the PRIMATES. It is distributed in isolated scattered populations throughout forests of equatorial Africa.
Tool Use Behavior
Modifying, carrying, or manipulating an item external to itself by an animal, before using it to effect a change on the environment or itself (from Beck, Animal Tool Behavior, 1980).
Gestures
Movement of a part of the body for the purpose of communication.

The ankyrin repeat-containing adaptor protein Tvl-1 is a novel substrate and regulator of Raf-1. (1/285)

Tvl-1 is a 269-amino acid ankyrin repeat protein expressed primarily in thymus, lung, and testes that was identified by screening a murine T-cell two-hybrid cDNA library for proteins that associate with the serine-threonine kinase Raf-1. The interaction of Tvl-1 with Raf-1 was confirmed by co-immunoprecipitation of the two proteins from COS-1 cells transiently transfected with Tvl-1 and Raf-1 expression constructs as well as by co-immunoprecipitation of the endogenous proteins from CV-1 and NB2 cells. Tvl-1 interacts with Raf-1 via its carboxyl-terminal ankyrin repeat domain. The same domain also mediates Tvl-1 homodimerization. Tvl-1 was detected by immunofluorescence in both the cytoplasm and the nucleus suggesting that in addition to Raf-1 it may also interact with nuclear proteins. Activated Raf-1 phosphorylates Tvl-1 both in vitro and in vivo. In baculovirus-infected Sf9 insect cells, Tvl-1 potentiates the activation of Raf-1 by Src and Ras while in COS-1 cells it potentiates the activation of Raf-1 by EGF. These data suggest that Tvl-1 is both a target as well as a regulator of Raf-1. The human homologue of Tvl-1 maps to chromosome 19p12, upstream of MEF2B with the two genes in a head to head arrangement.  (+info)

Improved sensitivity of PCR for diagnosis of human granulocytic ehrlichiosis using epank1 genes of Ehrlichia phagocytophila-group ehrlichiae. (2/285)

The agent of human granulocytic ehrlichiosis (HGE), Ehrlichia phagocytophila, and Ehrlichia equi probably comprise variants of a single Ehrlichia species now called the Ehrlichia phagocytophila genogroup. These variants share a unique 153-kDa protein antigen with ankyrin repeat motifs encoded by the epank1 gene. The epank1 gene was investigated as an improved target for PCR diagnosis of HGE compared with the currently used 16S rRNA gene target. Primers for epank1 flanking a region that spans part of the 5' ankyrin repeat coding region and part of the unique 3' region were synthesized. Blood samples from 31 patients with suspected HGE who were previously tested by 16S rRNA gene (16S) PCR and indirect immunofluorescent antibody test (IFA) were retrospectively tested with the epank1 primers. Eleven patients were 16S PCR positive and had a seroconversion detected by IFA (group A), 10 patients were 16S PCR negative but had a seroconversion detected by IFA (group B), and 10 patients were 16S PCR negative and seronegative (group C). Ten of the 11 group A patients were epank1 PCR positive, all 10 of the group B patients were epank1 PCR positive, and all of the PCR-negative and seronegative patients (group C) were epank1 PCR negative. The epank1 primers are more sensitive than the previously used 16S rRNA gene primers and therefore may be more useful in diagnostic testing for HGE.  (+info)

Alastrim smallpox variola minor virus genome DNA sequences. (3/285)

Alastrim variola minor virus, which causes mild smallpox, was first recognized in Florida and South America in the late 19th century. Genome linear double-stranded DNA sequences (186,986 bp) of the alastrim virus Garcia-1966, a laboratory reference strain from an outbreak associated with 0.8% case fatalities in Brazil in 1966, were determined except for a 530-bp fragment of hairpin-loop sequences at each terminus. The DNA sequences (EMBL Accession No. Y16780) showed 206 potential open reading frames for proteins containing >/=60 amino acids. The amino acid sequences of the putative proteins were compared with those reported for vaccinia virus strain Copenhagen and the Asian variola major strains India-1967 and Bangladesh-1975. About one-third of the alastrim viral proteins were 100% identical to correlates in the variola major strains and the remainder were >/=95% identical. Compared with variola major virus DNA, alastrim virus DNA has additional segments of 898 and 627 bp, respectively, within the left and right terminal regions. The former segment aligns well with sequences in other orthopoxviruses, particularly cowpox and vaccinia viruses, and the latter is apparently alastrim-specific.  (+info)

SKIP, a CBF1-associated protein, interacts with the ankyrin repeat domain of NotchIC To facilitate NotchIC function. (4/285)

Notch proteins are transmembrane receptors that mediate intercell communication and direct individual cell fate decisions. The activated intracellular form of Notch, NotchIC, translocates to the nucleus, where it targets the DNA binding protein CBF1. CBF1 mediates transcriptional repression through the recruitment of an SMRT-histone deacetylase-containing corepressor complex. We have examined the mechanism whereby NotchIC overcomes CBF1-mediated transcriptional repression. We identified SKIP (Ski-interacting protein) as a CBF1 binding protein in a yeast two-hybrid screen. Both CBF1 and SKIP are highly conserved evolutionarily, and the SKIP-CBF1 interaction is also conserved in assays using the Caenorhabditis elegans and Drosophila melanogaster SKIP homologs. Protein-protein interaction assays demonstrated interaction between SKIP and the corepressor SMRT. More surprisingly, SKIP also interacted with NotchIC. The SMRT and NotchIC interactions were mutually exclusive. In competition binding experiments SMRT displaced NotchIC from CBF1 and from SKIP. Contact with SKIP is required for biological activity of NotchIC. A mutation in the fourth ankyrin repeat that abolished Notch signal transduction did not affect interaction with CBF1 but abolished interaction with SKIP. Further, NotchIC was unable to block muscle cell differentiation in myoblasts expressing antisense SKIP. The results suggest a model in which NotchIC activates responsive promoters by competing with the SMRT-corepressor complex for contacts on both CBF1 and SKIP.  (+info)

Analysis of notch lacking the carboxyl terminus identified in Drosophila embryos. (5/285)

The cell surface receptor Notch is required during development of Drosophila melanogaster for differentiation of numerous tissues. Notch is often required for specification of precursor cells by lateral inhibition and subsequently for differentiation of tissues from these precursor cells. We report here that certain embryonic cells and tissues that develop after lateral inhibition, like the connectives and commissures of the central nervous system, are enriched for a form of Notch not recognized by antibodies made against the intracellular region carboxy-terminal of the CDC10/Ankyrin repeats. Western blotting and immunoprecipitation analyses show that Notch molecules lacking this region are produced during embryogenesis and form protein complexes with the ligand Delta. Experiments with cultured cells indicate that Delta promotes accumulation of a Notch intracellular fragment lacking the carboxyl terminus. Furthermore, Notch lacking the carboxyl terminus functions as a receptor for Delta. These results suggest that Notch activities during development include generation and activity of a truncated receptor we designate NDeltaCterm.  (+info)

Molecular cloning and characterization of SRAM, a novel insect rel/ankyrin-family protein present in nuclei. (6/285)

Previously, we purified a 59-kDa protein that binds to the kappaB motif of the Sarcophaga lectin gene. Here we report its cDNA cloning and some of its characteristics as a novel member of the Rel/Ankyrin-family. This protein, named SRAM, contained a Rel homology domain, a nuclear localization signal and 4 ankyrin repeats, but lacked the Ser-rich domain and PEST sequence that Relish contained. We found that SRAM was localized in the nuclei of NIH-Sape-4 cells, which are an embryonic cell line of Sarcophaga. The Sarcophaga lectin gene promoter containing tandem repeats of the kappaB motifs was activated in NIH-Sape-4 cells. In Drosophila mbn-2 cells, Dif alone activated this reporter gene and a cooperative effect was detected when SRAM and Dif were co-transfected, although SRAM alone did not activate it. This is the first report of a Rel/Ankyrin molecule that exists in the nuclei.  (+info)

The L1-type cell adhesion molecule neuroglian influences the stability of neural ankyrin in the Drosophila embryo but not its axonal localization. (7/285)

Ankyrins are linker proteins, which connect various membrane proteins, including members of the L1 family of neural cell adhesion molecules, with the submembranous actin-spectrin skeleton. Here we report the cloning and characterization of a second, novel Drosophila ankyrin gene (Dank2) that appears to be the result of a gene duplication event during arthropod evolution. The Drosophila L1-type protein neuroglian interacts with products from both Drosophila ankyrin genes. Whereas the previously described ankyrin gene is ubiquitously expressed during embryogenesis, the expression of Dank2 is restricted to the nervous system in the Drosophila embryo. The absence of neuroglian protein in a neuroglian null mutant line causes decreased levels of Dank2 protein in most neuronal cells. This suggests that neuroglian is important for the stability of Dank2 protein. However, neuroglian is not required for Dank2 axonal localization. In temperature-sensitive neuroglian mutants in which neuroglian protein is mislocated at the restrictive temperature to an intracellular location in the neuronal soma, Dank2 protein can still be detected along embryonic nerve tracts.  (+info)

Cardiac ankyrin repeat protein is a novel marker of cardiac hypertrophy: role of M-CAT element within the promoter. (8/285)

CARP, a cardiac doxorubicin (adriamycin)-responsive protein, has been identified as a nuclear protein whose expression is downregulated in response to doxorubicin. In the present study, we tested the hypothesis that CARP serves as a reliable genetic marker of cardiac hypertrophy in vivo and in vitro. CARP expression was markedly increased in 3 distinct models of cardiac hypertrophy in rats: constriction of abdominal aorta, spontaneously hypertensive rats, and Dahl salt-sensitive rats. In addition, we found that CARP mRNA levels correlate very strongly with the brain natriuretic peptide mRNA levels in Dahl rats. Transient transfection assays into primary cultures of neonatal rat cardiac myocytes indicate that transcription from the CARP and brain natriuretic peptide promoters is stimulated by overexpression of p38 and Rac1, components of the stress-activated mitogen-activated protein kinase pathways. Mutation analysis and electrophoretic mobility shift assays indicated that the M-CAT element can serve as a binding site for nuclear factors, and this element is important for the induction of CARP promoter activity by p38 and Rac1. Thus, our data suggest that M-CAT element is responsible for the regulation of the CARP gene in response to the activation of stress-responsive mitogen-activated protein kinase pathways. Moreover, given that activation of these pathways is associated with cardiac hypertrophy, we propose that CARP represents a novel genetic marker of cardiac hypertrophy.  (+info)

2020 - Calcium activates purified human TRPA1 with and without its N-terminal ankyrin repeat domain in the absence of calmodulin2020 - Calcium activates purified human TRPA1 with and without its N-terminal ankyrin repeat domain in the absence of calmodulin
Nanion offers analysis instruments for ion channel analysis, as patch clamp, impedance and bilayer recordings, used for drug development as cardiac safety and basic research.
https://www.nanion.de/en/137-home/articles/5439-2020-calcium-activates-purified-human-trpa1-with-and-without-its-n-terminal-ankyrin-repeat-domain-in-the-absence-of-calmodulin.html
Structure and stability of the ankyrin domain of the Drosophila Notch receptor<...
TY - JOUR. T1 - Structure and stability of the ankyrin domain of the Drosophila Notch receptor. AU - Zweifel, Mark E.. AU - Leahy, Daniel J.. AU - Hughson, Frederick M.. AU - Barrick, Doug. PY - 2003/11. Y1 - 2003/11. N2 - The Notch receptor contains a conserved ankyrin repeat domain that is required for Notch-mediated signal transduction. The ankyrin domain of Drosophila Notch contains six ankyrin sequence repeats previously identified as closely matching the ankyrin repeat consensus sequence, and a putative seventh C-terminal sequence repeat that exhibits lower similarity to the consensus sequence. To better understand the role of the Notch ankyrin domain in Notch-mediated signaling and to examine how structure is distributed among the seven ankyrin sequence repeats, we have determined the crystal structure of this domain to 2.0 Å resolution. The seventh, C-terminal, ankyrin sequence repeat adopts a regular ankyrin fold, but the first, N-terminal ankyrin repeat, which contains a 15-residue ...
https://jhu.pure.elsevier.com/en/publications/structure-and-stability-of-the-ankyrin-domain-of-the-drosophila-n-3
Frontiers | Orientia tsutsugamushi ankyrin repeat-containing protein family members are Type 1 secretion system substrates that...Frontiers | Orientia tsutsugamushi ankyrin repeat-containing protein family members are Type 1 secretion system substrates that...
Scrub typhus is an understudied, potentially fatal infection that threatens one billion persons in the Asia-Pacific region. How the causative obligate intracellular bacterium, Orientia tsutsugamushi facilitates its intracellular survival and pathogenesis is poorly understood. Many intracellular bacterial pathogens utilize the Type 1 (T1SS) or Type 4 secretion system (T4SS) to translocate ankyrin repeat-containing proteins (Anks) that traffic to distinct subcellular locations and modulate host cell processes. The O. tsutsugamushi genome encodes one of the largest known bacterial Ank repertoires plus T1SS and T4SS components. Whether these potential virulence factors are expressed during infection, how the Anks are potentially secreted, and to where they localize in the host cell are not known. We determined that O. tsutsugamushi transcriptionally expresses 20 unique ank genes as well as genes for both T1SS and T4SS during infection of mammalian host cells. Examination of the Anks C-termini revealed that
https://www.frontiersin.org/articles/10.3389/fcimb.2014.00186/full
KLUEDO | The Ankyrin Repeat Domain Controls Presynaptic Localization of Drosophila Ankyrin2 and Is Essential for Synaptic...KLUEDO | The Ankyrin Repeat Domain Controls Presynaptic Localization of Drosophila Ankyrin2 and Is Essential for Synaptic...
The structural integrity of synaptic connections critically depends on the interaction between synaptic cell adhesion molecules (CAMs) and the underlying actin and microtubule cytoskeleton. This interaction is mediated by giant Ankyrins, that act as specialized adaptors to establish and maintain axonal and synaptic compartments. In Drosophila, two giant isoforms of Ankyrin2 (Ank2) control synapse stability and organization at the larval neuromuscular junction (NMJ). Both Ank2-L and Ank2-XL are highly abundant in motoneuron axons and within the presynaptic terminal, where they control synaptic CAMs distribution and organization of microtubules. Here, we address the role of the conserved N-terminal ankyrin repeat domain (ARD) for subcellular localization and function of these giant Ankyrins in vivo. We used a P[acman] based rescue approach to generate deletions of ARD subdomains, that contain putative binding sites of interacting transmembrane proteins. We show that specific subdomains control synaptic
https://kluedo.ub.uni-kl.de/frontdoor/index/index/searchtype/all/rows/1/institutefq/Fachbereich+Biologie/yearfq/2019/docId/5823/start/6
KANK1 - KN motif and ankyrin repeat domain-containing protein 1 - Homo sapiens (Human) - KANK1 gene & proteinKANK1 - KN motif and ankyrin repeat domain-containing protein 1 - Homo sapiens (Human) - KANK1 gene & protein
Involved in the control of cytoskeleton formation by regulating actin polymerization. Inhibits actin fiber formation and cell migration. Inhibits RhoA activity; the function involves phosphorylation through PI3K/Akt signaling and may depend on the competetive interaction with 14-3-3 adapter proteins to sequester them from active complexes. Inhibits the formation of lamellipodia but not of filopodia; the function may depend on the competetive interaction with BAIAP2 to block its association with activated RAC1. Inhibits fibronectin-mediated cell spreading; the function is partially mediated by BAIAP2. Inhibits neurite outgrowth. Involved in the establishment and persistence of cell polarity during directed cell movement in wound healing. In the nucleus, is involved in beta-catenin-dependent activation of transcription. Potential tumor suppressor for renal cell carcinoma.
http://www.uniprot.org/uniprot/Q14678
ANKRD24 - Ankyrin repeat domain-containing protein 24 - Homo sapiens (Human) - ANKRD24 gene & proteinANKRD24 - Ankyrin repeat domain-containing protein 24 - Homo sapiens (Human) - ANKRD24 gene & protein
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class=publication>Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href=http://www.nrbook.com/b/bookcpdf.php>Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
http://www.uniprot.org/uniprot/Q8TF21
Ankyrin repeat domain-containing protein 13AAnkyrin repeat domain-containing protein 13A
Ubiquitin-binding protein that specifically recognizes and binds Lys-63-linked ubiquitin. Does not bind Lys-48-linked ubiquitin. Positively regulates the internalization of ligand-activated EGFR by binding to the Ub moiety of ubiquitinated EGFR at the cell membrane ...
https://pharos.nih.gov/idg/targets/Q8IZ07
Ankyrin repeat domain-containing protein 18AAnkyrin repeat domain-containing protein 18A
MRKLFSFGRRLGQALLSSMDQEYAGPGYDIRDWELRKIHRAAIKGDAAEVERCLTRRFRDLDARDRKDRT 1 - 70 VLHLACAHGRVQVVTLLLHRRCQIDICDRLNRTPLMKAVHSQEEACAIVLLECGANPNIEDIYGNTALHY 71 - 140 AVYNKGTSLAERLLSHHANIEALNKEGNTPLLFAINSRRQHMVEFLLKNQANIHAVDNFKRTALILAVQH 141 - 210 NLSSIVTLLLQQNIRISSQDMFGQTAEDYALCSDLRSIRQQILEHKNKMLKNHLRNDNQETAAMKPANLK 211 - 280 KRKERAKAEHNLKVASEEKQERLQRSENKQPQDSQSYGKKKDAMYGNFMLKKDIAMLKEELYAIKNDSLR 281 - 350 KEKKYIQEIKSITEINANFEKSVRLNEKMITKTVARYSQQLNDLKAENARLNSELEKEKHNKERLEAEVE 351 - 420 SLHSSLATAINEYNEIVERKDLELVLWRADDVSRHEKMGSNISQLTDKNELLTEQVHKARVKFNTLKGKL 421 - 490 RETRDALREKTLALGSVQLDLRQAQHRIKEMKQMHPNGEAKESQSIGKQNSLEERIRQQELENLLLERQL 491 - 560 EDARKEGDNKEIVINIHRDCLENGKEDLLEERNKELMKEYNYLKEKLLQCEKEKAEREVIVREFQEELVD 561 - 630 HLKTFSISESPLEGTSHCHINLNETWTSKKKLFQVEIQPEEKHEEFRKLFELISLLNYTADQIRKKNREL 631 - 700 EEEATGYKKCLEMTINMLNAFANEDFSCHGDLNTDQLKMDILFKKLKQKFNDLVAEKEAVSSECVNLAKD 701 - 770 NEVLHQELLSMRNVQEKCEKLEKDKKMLEEEVLNLKTHMEKDMVELGKLQEYKSELDERAVQEIEKLEEI 771 - 840 ...
https://pharos.nih.gov/idg/targets/Q8IVF6
The Role of Membrane-Bound Ankyrin-Repeat Protein ACD6 in Programmed Cell Death and Plant Defense | Science SignalingThe Role of Membrane-Bound Ankyrin-Repeat Protein ACD6 in Programmed Cell Death and Plant Defense | Science Signaling
Thank you for your interest in spreading the word about Science Signaling.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
https://stke.sciencemag.org/content/2004/221/pe6/tab-article-info
Alterations in the ankyrin domain of TRPV4 cause congenital distal SMA, scapuloperoneal SMA and HMSN2C.Alterations in the ankyrin domain of TRPV4 cause congenital distal SMA, scapuloperoneal SMA and HMSN2C.
Spinal muscular atrophies (SMA, also known as hereditary motor neuropathies) and hereditary motor and sensory neuropathies (HMSN) are clinically and genetically heterogeneous disorders of the peripheral nervous system. Here we report that mutations in the TRPV4 gene cause congenital distal SMA, scapuloperoneal SMA, HMSN 2C. We identified three missense substitutions (R269H, R315W and R316C) affecting the intracellular N-terminal ankyrin domain of the TRPV4 ion channel in five families. Expression of mutant TRPV4 constructs in cells from the HeLa line revealed diminished surface localization of mutant proteins. In addition, TRPV4-regulated Ca(2+) influx was substantially reduced even after stimulation with 4alphaPDD, a TRPV4 channel-specific agonist, and with hypo-osmotic solution. In summary, we describe a new hereditary channelopathy caused by mutations in TRPV4 and present evidence that the resulting substitutions in the N-terminal ankyrin domain affect channel maturation, leading to reduced ...
http://repository.ubn.ru.nl/handle/2066/88054
ANKRD1, the Gene Encoding Cardiac Ankyrin Repeat Protein, Is a Novel Dilated Cardiomyopathy Gene | JACC: Journal of the...ANKRD1, the Gene Encoding Cardiac Ankyrin Repeat Protein, Is a Novel Dilated Cardiomyopathy Gene | JACC: Journal of the...
Dilated cardiomyopathy (DCM), a primary disorder of the cardiac muscle characterized by ventricular chamber dilation and diminished cardiac contractility (1), is the most common cause of chronic heart failure (CHF) in the young and the most common indication for cardiac transplantation (2). The underlying etiologies are varied and include genetic, viral (myocarditis), toxins like alcohol, mitochondrial, and metabolic disorders (3-6).. Familial inheritance is seen in ≈30% to 40% of DCM patients (5). Autosomal dominant mode of inheritance is the most common (≈90%), followed by X-linked (5% to 10%), autosomal recessive, and mitochondrial inheritance patterns (,5%) (7). To date, mutations in ≈20 genes have been discovered in patients with DCM (8). Of these genes, the genes encoding Z-band alternatively spliced PDZ-motif protein, titin, lamin A/C, and β-myosin heavy chain may each be responsible for 5% to 10% of familial DCM cases (9-12), with dystrophin thought to contribute in 10% to 15% of ...
http://www.onlinejacc.org/content/54/4/325
A Library-Based Screening Strategy for the Identification of DARPins as Ligands for Receptor-Targeted AAV and Lentiviral...A Library-Based Screening Strategy for the Identification of DARPins as Ligands for Receptor-Targeted AAV and Lentiviral...
Delivering genes selectively to the therapeutically relevant cell type is among the prime goals of vector development. Here, we present a high-throughput selection and screening process that identifies designed ankyrin repeat proteins (DARPins) optimally suited for receptor-targeted gene delivery using adeno-associated viral (AAV) and lentiviral (LV) vectors. In particular, the process includes expression, purification, and biotinylation of the extracellular domains of target receptors as Fc fusion proteins in mammalian cells and the selection of high-affinity binders by ribosome display from DARPin libraries each covering more than 10 variants. This way, DARPins specific for the glutamate receptor subunit GluA4, the endothelial surface marker CD105, and the natural killer cell marker NKp46 were generated. The identification of DARPins best suited for gene delivery was achieved by screening small-scale vector productions. Both LV and AAV particles displaying the selected DARPins transduced only ...
https://www.zora.uzh.ch/id/eprint/153188/
RCSB PDB - Protein Feature View - Ankyrin repeat domain-containing protein 17 - Q99NH0 (ANR17 MOUSE)
The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex assemblies. As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
http://bioinformatics.sdsc.edu/pdb/protein/Q5F4T7
TCDB » SEARCHTCDB » SEARCH
8.A.114. The Huntington-interacting protein 14 (HIP14) Family. The Huntington-interacting protein 14 (HIP14) is reported to be a palmitoyltransferase required for exocytosis and targeting of the palmitoylated cysteine string protein (CSP) and the SNAP25 protein which are mislocalized in a HIP14 mutant (Ohyama et al., 2007). HIP14 also palmitoylates CSP. HIP14 may be necessary for presynaptic function including neurotransmitter release by regulating the trafficking of CSP to synapses (Ducker et al., 2004; Ohyama et al., 2007; Stowers and Isacoff, 2007; Yanai et al., 2006).. HIP14 is reported to be a divalent cation transporter capable of transporting Mg2+ found only in eukaryotes (Quamme, 2009). It has up to eight N-terminal Ankyrin repeats (residues 25-270) followed by the transmembrane domain (residues 300-560; The zfDHHC domain superfamily).. The reaction proposed for HIP14 in the second paragraph (above) is:. M2+(in) ⇌ M2+(out) ...
https://tcdb.org/search/result.php?tc=8.A.114
Development of the designed ankyrin repeat protein (DARPin) G3 for HER2 molecular imagingDevelopment of the designed ankyrin repeat protein (DARPin) G3 for HER2 molecular imaging
Radiolabelled DARPin (HE)3-G3 is a versatile radioligand with potential to allow the acquisition of whole-body HER2 scans on the day of administration.
https://pubmed.ncbi.nlm.nih.gov/25391547/
Most recent papers with the keyword Belonging | Read by QxMDMost recent papers with the keyword Belonging | Read by QxMD
Kidney ankyrin repeat-containing proteins (KANK1/2/3/4) belong to a family of scaffold proteins, playing critical roles in cytoskeleton organization, cell polarity and migration. Mutations in KANK proteins are implicated in cancers and genetic diseases, such as nephrotic syndrome. KANK proteins can bind various target proteins through different protein regions, including a highly conserved ankyrin repeat domain (ANKRD). However, the molecular basis for target recognition by the ANKRD remains elusive. In this study, we solved a high-resolution crystal structure of the ANKRD of KANK1 in complex with a short sequence of the motor protein kinesin family member 21A (KIF21A), revealing that the highly specific target-binding mode of the ANKRD involves combinatorial use of two interfaces ...
https://www.readbyqxmd.com/keyword/100556
Inhibition Of Vascular Leakage And Choroidal Neovascularization Using Vegf-inhibiting Darpins In Rodents | IOVS | ARVO JournalsInhibition Of Vascular Leakage And Choroidal Neovascularization Using Vegf-inhibiting Darpins In Rodents | IOVS | ARVO Journals
Purpose: : Vascular endothelial growth factor (VEGF) is a key controller of pathological angiogenesis and leakage in various retinal diseases. Clinically, anti-VEGF agents have revolutionized treatment of exudative age related macular degeneration (AMD), diabetic retinopathy and retinal vein occlusion. However, one of the main limitations of current VEGF inhibitors remains the need for repeated intravitreal injections. Second-generation VEGF inhibitors should thus aim at providing more efficient VEGF-inhibition to reduce injection frequency. Methods: : In the current study, we use highly potent anti-VEGF DARPins (designed ankyrin repeat proteins) to inhibit VEGF receptor phosphorylation and endothelial cell sprouting in vitro, retinal vascular leakage in rabbits and choroidal angiogenesis in the Laser CNV model in rats. Results: : Our results demonstrate the successful isolation and purification of several DARPins with picomolar affinity to VEGF. In vitro, VEGF receptor phosphorylation was ...
http://iovs.arvojournals.org/article.aspx?articleid=2354588
The left-right determinant inversin has highly conserved ankyrin repeat and IQ domains and interacts with calmodulin - Semantic...The left-right determinant inversin has highly conserved ankyrin repeat and IQ domains and interacts with calmodulin - Semantic...
All vertebrates have a left-right body axis with invariant asymmetries of the heart and the positions of the abdominal viscera. Major advances have recently been made in defining molecular components of the pathway specifying the vertebrate left-right axis, but our knowledge of the early determinants is extremely limited. In the inv mouse the left-right axis is consistently reversed, unlike other vertebrate mutants where randomisation of situs is apparent. The gene disrupted in this mouse encodes a 1062-amino-acid protein, inversin. We previously reported 16 tandem ankyrin repeats, spanning amino acids 13-557, and two putative nuclear localisation sequences, but otherwise the sequence offered few clues to the possible function. In order to identify regions likely to be functionally important, we have identified and characterised orthologous sequences in several species, including chick, Xenopus and zebrafish. Sequence comparisons show strong conservation of the ankyrin repeat region and also a lysine
https://www.semanticscholar.org/paper/The-left-right-determinant-inversin-has-highly-con-Morgan-Goodship/e9a865b197de83fe55566ed742a70e598f016b09
Pig Ankyrin repeat and BTB/POZ dom... - E07A1786-192T B-Gene - Anti...Pig Ankyrin repeat and BTB/POZ dom... - E07A1786-192T B-Gene - Anti...
Product Pig Ankyrin repeat and BTB/POZ domain containing protein BTBD11(BTBD11) ELISA kit From B-Gene - A competitive ELISA for quantitative measurement of Porcine Ankyrin repeat and BTB/POZ domain containing protein BTBD11(BTBD11) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUTION*1 vial 12. WASH SOLUTION (100 x)*1 vial 13. BALANCE SOLUTION*1 vial 14. INSTRUCTION*1
https://antibody-antibodies.com/products/e07a1786-192t/pig-ankyrin-repeat-and-btb-poz-domain-containing-protein-btbd11btbd11-elisa-kit-835603/
Site-Selective Enzymatic Labeling of Designed Ankyrin Repeat Proteins Using Protein Farnesyltransferase. - Zurich Open...Site-Selective Enzymatic Labeling of Designed Ankyrin Repeat Proteins Using Protein Farnesyltransferase. - Zurich Open...
Affinity agents coupled to a functional moiety play an ever-increasing role in modern medicine, ranging from radiolabeled selective binders in diagnosis to antibody-drug conjugates in targeted therapies. In biomedical research, protein coupling to fluorophores, surfaces and nanoparticles has become an integral part of many procedures. In addition to antibodies, small scaffold proteins with similar target binding properties are being widely explored as alternative targeting moieties. To label these binders of interest with different functional moieties, conventional chemical coupling methods can be employed, but often result in heterogeneously modified protein products. In contrast, enzymatic labeling methods are highly site-specific and efficient. Protein farnesyltransferase (PFTase) catalyzes the transfer of an isoprenoid moiety from farnesyl diphosphate (FPP) to a cysteine residue in a C-terminal CaaX motif at the C-terminus of a protein substrate. The addition of only four amino acid residues ...
https://www.zora.uzh.ch/id/eprint/174734/
Analyses of Physcomitrella patens Ankyrin Repeat Proteins by Computational ApproachAnalyses of Physcomitrella patens Ankyrin Repeat Proteins by Computational Approach
Molecular Biology International is a peer-reviewed, Open Access journal that publishes original research articles as well as review articles in all areas of molecular biology.
https://www.hindawi.com/journals/mbi/2016/9156735/abs/
KRAS-specific inhibition using a DARPin binding to a site in the allosteric lobe.
Inhibiting the RAS oncogenic protein has largely been through targeting the switch regions that interact with signalling effector proteins. Here, we report designed ankyrin repeat proteins (DARPins) macromolecules that specifically inhibit the KRAS isoform by binding to an allosteric site encompassing the region around KRAS-specific residue histidine 95 at the helix α3/loop 7/helix α4 interface. We show that these DARPins specifically inhibit KRAS/effector interactions and the dependent downstream signalling pathways in cancer cells. Binding by the DARPins at that region influences KRAS/effector interactions in different ways, including KRAS nucleotide exchange and inhibiting KRAS dimerization at the plasma membrane. These results highlight the importance of targeting the α3/loop 7/α4 interface, a previously untargeted site in RAS, for specifically inhibiting KRAS function ...
https://repository.icr.ac.uk/handle/internal/3532
Molecular architecture of the ankyrin SOCS box family of Cul5-dependent E3 ubiquitin ligases - Nuffield Department of Medicine
Multi-subunit Cullin-RING E3 ligases often use repeat domain proteins as substrate-specific adaptors. Structures of these macromolecular assemblies are determined for the F-box-containing leucine-rich repeat and WD40 repeat families, but not for the suppressor of cytokine signaling (SOCS)-box-containing ankyrin repeat proteins (ASB1-18), which assemble with Elongins B and C and Cul5. We determined the crystal structures of the ternary complex of ASB9-Elongin B/C as well as the interacting N-terminal domain of Cul5 and used structural comparisons to establish a model for the complete Cul5-based E3 ligase. The structures reveal a distinct architecture of the ASB9 complex that positions the ankyrin domain coaxial to the SOCS box-Elongin B/C complex and perpendicular to other repeat protein complexes. This alternative architecture appears favorable to present the ankyrin domain substrate-binding site to the E2-ubiquitin, while also providing spacing suitable for bulky ASB9 substrates, such as the creatine
https://www.ndm.ox.ac.uk/publications/419300
MYPT1, the targeting subunit of smooth-muscle myosin phosphatase, is a substrate for the asparaginyl hydroxylase factor...
The asparaginyl hydroxylase FIH [factor inhibiting HIF (hypoxia-inducible factor)] was first identified as a protein that inhibits transcriptional activation by HIF, through hydroxylation of an asparagine residue in the CAD (C-terminal activation domain). More recently, several ARD [AR (ankyrin repeat) domain]-containing proteins were identified as FIH substrates using FIH interaction assays. Although the function(s) of these ARD hydroxylations is unclear, expression of the ARD protein Notch1 was shown to compete efficiently with HIF CAD for asparagine hydroxylation and thus to enhance HIF activity. The ARD is a common protein domain with over 300 examples in the human proteome. However, the extent of hydroxylation among ARD proteins, and the ability of other members to compete with HIF-CAD for FIH, is not known. In the present study we assay for asparagine hydroxylation in a bioinformatically predicted FIH substrate, the targeting subunit of myosin phosphatase, MYPT1. Our results confirm hydroxylation
https://www.cardioscience.ox.ac.uk/publications/34627
Novel mutations in the sarcomeric protein myopalladin in patients with dilated cardiomyopathy - MDC RepositoryNovel mutations in the sarcomeric protein myopalladin in patients with dilated cardiomyopathy - MDC Repository
Recently, missense mutations in titin-associated proteins have been linked to the pathogenesis of dilated cardiomyopathy (DCM). The objective of this study was to search for novel disease-associated mutations in the two human titin-binding proteins myopalladin and its amino-terminal-interacting partner cardiac ankyrin-repeat protein (CARP). In a cohort of 255 cases with familial and sporadic DCM, we analyzed the coding regions and all corresponding intron flanks located in the MYPN and CARP-encoding ANKRD1 gene. Two heterozygous missense mutations were detected in the MYPN gene (p.R955W and p.P961L), but neither of these mutations was found in 300 healthy controls. Both mutations were located in the alpha-actinin-binding region of myopalladin. Endomyocardial biopsies from the p.R955W carrier showed normal subcellular localization of myopalladin and alpha-actinin in cardiac myocytes, while their regular sarcomeric staining pattern was significantly disrupted in the p.P961L carrier, indicating ...
https://edoc.mdc-berlin.de/12856/
Ankyrin Repeat (ANKRD Family) < Protein Interaction Domains and Motifs << Tertiary Structure of a Protein (Tertiary Protein...
Ankyrin Repeat (ANK Repeat) is a protein interaction motif that contains a 33-amino acid long sequence that often occurs in tandem arrays (as amino acid repetitive sequences)
https://wellnessadvantage.com/?dgl=71424
ANKS6 elisa kit | Bovine Ankyrin repeat and SAM domain-containing protein 6 (ANKS6) ELISA Kit-NP 775822.3ANKS6 elisa kit | Bovine Ankyrin repeat and SAM domain-containing protein 6 (ANKS6) ELISA Kit-NP 775822.3
Buy ANKS6 elisa kit, Bovine Ankyrin repeat and SAM domain-containing protein 6 (ANKS6) ELISA Kit-NP_775822.3 (MBS7244539) product datasheet at MyBioSource, ELISA Kits
https://www.mybiosource.com/prods/ELISA-Kit/Bovine/Ankyrin-repeat-and-SAM-domain-containing-protein-6-ANKS6/ANKS6/datasheet.php?products_id=7244539
ANKRD49 ankyrin repeat domain 49 [Homo sapiens (human)] - Gene - NCBIANKRD49 ankyrin repeat domain 49 [Homo sapiens (human)] - Gene - NCBI
These reference sequences exist independently of genome builds. Explain. These reference sequences are curated independently of the genome annotation cycle, so their versions may not match the RefSeq versions in the current genome build. Identify version mismatches by comparing the version of the RefSeq in this section to the one reported in Genomic regions, transcripts, and products above. ...
https://www.ncbi.nlm.nih.gov/gene/54851
ANKRD30A ankyrin repeat domain 30A [Homo sapiens (human)] - Gene - NCBIANKRD30A ankyrin repeat domain 30A [Homo sapiens (human)] - Gene - NCBI
These reference sequences exist independently of genome builds. Explain. These reference sequences are curated independently of the genome annotation cycle, so their versions may not match the RefSeq versions in the current genome build. Identify version mismatches by comparing the version of the RefSeq in this section to the one reported in Genomic regions, transcripts, and products above. ...
https://www.ncbi.nlm.nih.gov/gene/91074
Shank2 MGI Mouse Gene Detail - MGI:2671987 - SH3 and multiple ankyrin repeat domains 2Shank2 MGI Mouse Gene Detail - MGI:2671987 - SH3 and multiple ankyrin repeat domains 2
View mouse Shank2 Chr7:144001928-144424494 with: phenotypes, sequences, polymorphisms, proteins, references, function, expression
http://www.informatics.jax.org/marker/MGI:2671987
Bio2Vec
ID: http://www.ncbi.nlm.nih.gov/gene/22941 Type: http://bio2vec.net/ontology/gene Label: SHANK2 Synonyms: SHANK2, AUTS17, CORTBP1, CTTNBP1, ProSAP1, SHANK, SPANK-3, SH3 and multiple ankyrin repeat domains 2, SH3 and multiple ankyrin repeat domains protein 2, GKAP/SAPAP interacting protein, cortactin SH3 domain-binding protein, cortactin-binding protein 1, proline-rich synapse associated protein 1 Alternative IDs: als API: GO SPARQL: GO ...
https://bio2vec.cbrc.kaust.edu.sa/bio2vec/details/1?iri=http://www.ncbi.nlm.nih.gov/gene/22941
Atlas: SHANK2 (SH3 and multiple ankyrin repeat domains 2)
Please, confirm that you want to generate a PDF file of this page. This may take some seconds once process has started. Then it will be opened automatically. ...
https://atlasgeneticsoncology.usal.es/classic/Genes/GC_SHANK2.html
ANKS3 (ankyrin repeat and sterile alpha motif domain containing 3)ANKS3 (ankyrin repeat and sterile alpha motif domain containing 3)
ANKS3 (ankyrin repeat and sterile alpha motif domain containing 3), Authors: Dessen P. Published in: Atlas Genet Cytogenet Oncol Haematol.
http://atlasgeneticsoncology.org/Genes/GC_ANKS3.html
Ankyrin Repeat and SOCS Box Containing 8 Recombinant ProteinAnkyrin Repeat and SOCS Box Containing 8 Recombinant Protein
Ankyrin Repeat and SOCS Box Containing 8 Recombinant Protein. The ASB8 solution (0.25mg/ml) contains 20mM Tris-HCl buffer (pH8.0), 0.15M NaCl, 1mM DTT and 10% glycerol.
https://www.neuromics.com/PR27221
AGAP4 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 4 ) Blocking Peptide (the C terminal of AGAP4)(100ug) by Aviva...AGAP4 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 4 ) Blocking Peptide (the C terminal of AGAP4)(100ug) by Aviva...
AGAP4 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 4 ) Blocking Peptide (the C terminal of AGAP4)(100ug) - Read User Reviews, Features, Research Applications and get the Best Price/Quote
http://www.absave.com/products/agap4-arfgap-with-gtpase-domain-ankyrin-repeat-and-ph-domain-4-blocking-peptide-the-c-terminal-of-agap4-100ug
UACA elisa kit | Rat Uveal Autoantigen With Coiled-Coil Domains and Ankyrin Repeats Antibodies ELISA KitUACA elisa kit | Rat Uveal Autoantigen With Coiled-Coil Domains and Ankyrin Repeats Antibodies ELISA Kit
Buy UACA elisa kit, Rat Uveal Autoantigen With Coiled-Coil Domains and Ankyrin Repeats Antibodies ELISA Kit (MBS006289) product datasheet at MyBioSource, ELISA Kits
https://www.mybiosource.com/prods/ELISA-Kit/Rat/Uveal-Autoantigen-With-Coiled-Coil-Domains-and-Ankyrin-Repeats-Antibodies/UACA/datasheet.php?products_id=6289
Gentaur Molecular :GenWay \ Ankyrin repeat and SOCS box-containing protein 3 isoform a variant - \ 10-288-22178FGentaur Molecular :GenWay \ Ankyrin repeat and SOCS box-containing protein 3 isoform a variant - \ 10-288-22178F
Gentaur molecular products has all kinds of products like :search , GenWay \ Ankyrin repeat and SOCS box-containing protein 3 isoform a variant - \ 10-288-22178F for more molecular products just contact us
http://www.antibody-antibodies.com/product_det.php?id=1880931&supplier=search&name=Ankyrin%20repeat%20and%20SOCS%20box_containing%20protein%203%20isoform%20a%20variant%20_%20%20
Identification of anti-tumour biologics using primary tumour models, 3-D phenotypic screening and image-based multi-parametric...Identification of anti-tumour biologics using primary tumour models, 3-D phenotypic screening and image-based multi-parametric...
Monolayer cultures of immortalised cell lines are a popular screening tool for novel anti-cancer therapeutics, but these methods can be a poor surrogate for disease states, and there is a need for drug screening platforms which are more predictive of clinical outcome. In this study, we describe a phenotypic antibody screen using three-dimensional cultures of primary cells, and image-based multi-parametric profiling in PC-3 cells, to identify anti-cancer biologics against new therapeutic targets. ScFv Antibodies and designed ankyrin repeat proteins (DARPins) were isolated using phage display selections against primary non-small cell lung carcinoma cells. The selected molecules were screened for anti-proliferative and pro-apoptotic activity against primary cells grown in three-dimensional culture, and in an ultra-high content screen on a 3-D cultured cell line using multi-parametric profiling to detect treatment-induced phenotypic changes. The targets of molecules of interest were identified using a cell
https://molecular-cancer.biomedcentral.com/articles/10.1186/s12943-015-0415-0
PIKE-A (PIKE-activating gene differs from PIKE-S with the addition of a - Allosteric Inhibitors of the Eya2 PhosphatasePIKE-A (PIKE-activating gene differs from PIKE-S with the addition of a - Allosteric Inhibitors of the Eya2 Phosphatase
PIKE-A (PIKE-activating gene differs from PIKE-S with the addition of a 40-kDa C-terminal extension containing Arf-GAP and two ankyrin-repeat domains. and peripheral bloodstream leukocytes (4-6). Weve proven that PIKE-A is certainly coamplified with CDK4 on chromosome 12 in a number of human malignancies including sarcoma RG7112 neuroblastoma and glioblastoma (32). PIKE-A is certainly readily discovered in 12q-amplified cell lines including RMS13 rhabdomyosarcoma and OSA osteosarcoma however not in regular muscles (6). PIKE-A provides the GTPase PH ArfGAP and two Ankyrin repeats domains within PIKE-L but does not have the N-terminal proline-rich area which binds proteins 4.1N PLC-γ1 and PI3-kinase. PIKE-A particularly binds to energetic Akt and up-regulates its activity within a GTP-dependent way mediating human cancers cell invasion (32). Akt/PKB is an essential regulator of divergent cellular procedures including apoptosis proliferation fat burning capacity and differentiation. Constitutive ...
http://wirdahl.com/pike-a-pike-activating-gene-differs-from-pike-s-with-the-addition-of-a/
Mutagenetix > Incidental...Mutagenetix > Incidental...
FUNCTION: [Summary is not available for the mouse gene. This summary is for the human ortholog.] This gene is a member of the ankyrin-repeat family and is induced by lipopolysaccharide (LPS). The C-terminal portion of the encoded product which contains the ankyrin repeats, shares high sequence similarity with the I kappa B family of proteins. The latter are known to play a role in inflammatory responses to LPS by their interaction with NF-B proteins through ankyrin-repeat domains. Studies in mouse indicate that this gene product is one of the nuclear I kappa B proteins and an activator of IL-6 production. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008 ...
https://mutagenetix.utsouthwestern.edu/incidental/incidental_rec.cfm?mid=301148
FBW7 (F-box and WD Repeat Domain-Containing 7) Negatively Regulates Glucose Metabolism by Targeting the c-Myc/TXNIP ...FBW7 (F-box and WD Repeat Domain-Containing 7) Negatively Regulates Glucose Metabolism by Targeting the c-Myc/TXNIP ...
Based on the observation that even in the presence of an oxygen supply, tumor cells preferentially use glycolysis over mitochondrial oxidative phosphorylation (OXPHOS) for glucose-dependent ATP production to fuel mitochondrial respiration, Otto Warburg put forward the notion of the Warburg effect in the 1920s (29). Advances in the understanding of the biology of tumor progression and metastasis have clearly highlighted the importance of aberrant tumor metabolism. The manifestation of the Warburg effect in todays clinical setting is the use of 18F-FDG to detect tumors with an increased glucose uptake. The elevated uptake visualized by 18F-FDG PET/CT correlates with a poor prognosis and a higher metabolic burden in many types of tumors (23, 30).. Mounting evidence indicates that the reprogramming of tumor metabolism is controlled by various oncogenic signals (31, 32). In pancreatic cancer, the Ras oncoprotein has been shown to promote metabolic transformation (33-35). Although KRAS mutations ...
https://clincancerres.aacrjournals.org/content/22/15/3950?ijkey=d9c95735c97ace91e244ecb39671790463355cf3&keytype2=tf_ipsecsha
Gene Expression Literature DetailGene Expression Literature Detail
J:44447 Baumeister A, Arber S, Caroni P, Accumulation of muscle ankyrin repeat protein transcript reveals local activation of primary myotube endcompartments during muscle morphogenesis. J Cell Biol. 1997 Dec 1;139(5):1231-42 ...
http://www.informatics.jax.org/gxdlit/key/8725
ANKRD20A15P Gene - GeneCards | ANKRD20A15P PseudogeneANKRD20A15P Gene - GeneCards | ANKRD20A15P Pseudogene
Complete information for ANKRD20A15P gene (Pseudogene), Ankyrin Repeat Domain 20 Family Member A15, Pseudogene, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
http://www.genecards.org/cgi-bin/carddisp.pl?gene=ANKRD20A15P
ANKRD66 Gene - GeneCards | ANR66 Protein | ANR66 AntibodyANKRD66 Gene - GeneCards | ANR66 Protein | ANR66 Antibody
Complete information for ANKRD66 gene (Protein Coding), Ankyrin Repeat Domain 66, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
http://www.genecards.org/cgi-bin/carddisp.pl?gene=ANKRD66
Ankyrin repeat domain 3 | definition of ankyrin repeat domain 3 by Medical dictionaryAnkyrin repeat domain 3 | definition of ankyrin repeat domain 3 by Medical dictionary
Looking for online definition of ankyrin repeat domain 3 in the Medical Dictionary? ankyrin repeat domain 3 explanation free. What is ankyrin repeat domain 3? Meaning of ankyrin repeat domain 3 medical term. What does ankyrin repeat domain 3 mean?
http://medical-dictionary.thefreedictionary.com/ankyrin+repeat+domain+3
Gtf2ird1 (untagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1), transcript variant 9, ...
Gtf2ird1 (untagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1), transcript variant 9, (10ug), 10 µg.
https://www.acris-antibodies.com/cdna/mouse-cdna/gtf2ird1-untagged-mouse-general-transcription-factor-ii-i-repeat-domain-containing-1-gtf2ird1-transcript-variant-9-10ug-mc222874.htm
Ankyrin Repeat - Medical Dictionary online-medical-dictionary.orgAnkyrin Repeat - Medical Dictionary online-medical-dictionary.org
Protein Motif that contains a 33-amino acid long sequence that often occurs in tandem arrays. This repeating sequence of 33-Amino Acids was discovered in Ankyrin where it is involved in interaction with the anion exchanger (Anion Exchange Protein 1, Erythrocyte). Ankyrin repeats cooperatively fold into domains that mediate molecular recognition via protein-protein interactions ...
http://www.online-medical-dictionary.org/definitions-a/ankyrin-repeat.html
Molecular mechanism for the subversion of the retromer coat by the Legionella effector RidLMolecular mechanism for the subversion of the retromer coat by the Legionella effector RidL
Microbial pathogens employ sophisticated virulence strategies to cause infections in humans. The intracellular pathogen Legionella pneumophila encodes RidL to hijack the host scaffold protein VPS29, a component of retromer and retriever complexes critical for endosomal cargo recycling. Here, we determined the crystal structure of L. pneumophila RidL in complex with the human VPS29-VPS35 retromer subcomplex. A hairpin loop protruding from RidL inserts into a conserved pocket on VPS29 that is also used by cellular ligands, such as Tre-2/Bub2/Cdc16 domain family member 5 (TBC1D5) and VPS9-ankyrin repeat protein for VPS29 binding. Consistent with the idea of molecular mimicry in protein interactions, RidL outcompeted TBC1D5 for binding to VPS29. Furthermore, the interaction of RidL with retromer did not interfere with retromer dimerization but was essential for association of RidL with retromer-coated vacuolar and tubular endosomes. Our work thus provides structural and mechanistic evidence into how ...
http://sebbm.es/web/es/divulgacion/articulo-mes/2515-molecular-mechanism-for-the-subversion-of-the-retromer-coat-by-the-legionella-effector-ridl
JCI - WelcomeJCI - Welcome
Nephrotic syndrome (NS) results from disruption of the kidney filtration barrier and is associated with proteinuria, hypoalbuminemia, and edema. Many children with NS respond to steroid therapy; however, steroid-resistant NS (SRNS) progresses to end-stage disease that requires renal replacement therapy. In many cases, the underlying cause of SNRS is unknown; however, recent studies have identified monogenic mutations that underlie disease. Several proteins encoded by NS-associated genes localize to podocytes, which are essential for maintenance of the glomerular filtration barrier. Heon Yung Gee, Fujian Zhang, and colleagues at Harvard Medical School and Childrens National Medical Center evaluated families with NS and identified recessive mutations in the kidney ankyrin repeat-containing protein-encoding genes KANK1, KANK2, and KANK4. Additionally, an independent screen in a Drosophila model determined that the Drosophila KANK homologue (dKank) is required for nephrite function. KANK1, KANK2, ...
https://cncpart.net.mobile.jci.org/posts/290
TumorPortal
The protein encoded by this gene belongs to the Kank family of proteins, which contain multiple ankyrin repeat domains. This family member functions in cytoskeleton formation by regulating actin polymerization. This gene is a candidate tumor suppressor for renal cell carcinoma. Mutations in this gene cause cerebral palsy spastic quadriplegic type 2, a central nervous system development disorder. A t(5;9) translocation results in fusion of the platelet-derived growth factor receptor beta gene (PDGFRB) on chromosome 5 with this gene in a myeloproliferative neoplasm featuring severe thrombocythemia. Alternative splicing of this gene results in multiple transcript variants. A related pseuodgene has been identified on chromosome 20 ...
http://www.tumorportal.org/view?geneSymbol=KANK1
The Elongin BC complex interacts with the conserved SOCS-box motif present in members of the SOCS, ras, WD-40 repeat, and...The Elongin BC complex interacts with the conserved SOCS-box motif present in members of the SOCS, ras, WD-40 repeat, and...
The Elongin BC complex interacts with the conserved SOCS-box motif present in members of the SOCS, ras, WD-40 repeat, and ankyrin repeat families
http://www.readabstracts.com/Biological-sciences/The-Elongin-BC-complex-interacts-with-the-conserved-SOCS-box-motif-present-in-members-of-the-SOCS-ra.html
Mutagenetix > Incidental...Mutagenetix > Incidental...
FUNCTION: [Summary is not available for the mouse gene. This summary is for the human ortholog.] This gene encodes a protein that is a member of the Shank family of synaptic proteins that may function as molecular scaffolds in the postsynaptic density of excitatory synapses. Shank proteins contain multiple domains for protein-protein interaction, including ankyrin repeats, and an SH3 domain. This particular family member contains a PDZ domain, a consensus sequence for cortactin SH3 domain-binding peptides and a sterile alpha motif. The alternative splicing demonstrated in Shank genes has been suggested as a mechanism for regulating the molecular structure of Shank and the spectrum of Shank-interacting proteins in the postsynaptic densities of the adult and developing brain. Alterations in the encoded protein may be associated with susceptibility to autism spectrum disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014 ...
https://mutagenetix.utsouthwestern.edu/incidental/incidental_rec.cfm?mid=562099
Targeting angiogenesis in multiple myeloma by the VEGF and HGF blocking DARPin ® protein MP0250: a preclinical study |...Targeting angiogenesis in multiple myeloma by the VEGF and HGF blocking DARPin ® protein MP0250: a preclinical study |...
https://doi.org/10.18632/oncotarget.24351 Luigia Rao, Kim De Veirman, Donato Giannico, Ilaria Saltarella, Vanessa Desantis, Maria Antonia Frassanito, Antonio Giovanni Solimando, Domenico Ribatti,...
https://www.oncotarget.com/article/24351/text/
ANKRA2 Protein Human Recombinant | ANKRA Antigen | ProSpecANKRA2 Protein Human Recombinant | ANKRA Antigen | ProSpec
ANKRA2 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 336 amino acids and having a molecular mass of 36.7kDa.
https://www.prospecbio.com/ankra2_human
Tissue expression of RFXANK - Summary - The Human Protein AtlasTissue expression of RFXANK - Summary - The Human Protein Atlas
Summary of RFXANK (ANKRA1, BLS, F14150_1, MGC138628, RFX-B) expression in human tissue. Mainly nuclear expression in all tissues.
http://www.proteinatlas.org/ENSG00000064490-RFXANK/tissue
Recombinant Human RFXANK protein (ab167884) | AbcamRecombinant Human RFXANK protein (ab167884) | Abcam
Buy our Recombinant Human RFXANK protein. Ab167884 is a full length protein produced in Escherichia coli and has been validated in SDS-PAGE, MS. Abcam provides…
http://www.abcam.com/recombinant-human-rfxank-protein-ab167884.html
Konformationsänderungen von repeat Proteine... ID:15338Konformationsänderungen von repeat Proteine... ID:15338
(ID:15338) The modular architecture of repeat proteins determines the molecular folding mechanism of this class of proteins. Anykr
https://forschung-sachsen-anhalt.de/project/konformationsaenderungen-repeat-proteinen-15338
Cas 122398-33-8,ASB-14-4 | lookchemCas 122398-33-8,ASB-14-4 | lookchem
Lookchem Provide Cas No.122398-33-8 Basic information: Properties,Safety Data,Sds and Other Datebase. We also Provide Trading Suppliers & Manufacture for 122398-33-8 ASB-14-4.
https://www.lookchem.com/casno122398-33-8.html
TV | FIHTV | FIH
We use cookies to ensure that we give you the best experience on our website. If you continue without changing your settings well assume that you are happy to receive all cookies on the FIH website. To find out more about our data policy please click here. ...
http://fih.ch/events/indoor-world-cup/indoor-hockey-world-cup-poznan-2011-m/tv/
Ankyrin repeatAnkyrin repeat
Ankyrin repeats typically fold together to form a single, linear solenoid structure called ankyrin repeat domains. These ... designed ankyrin repeat protein), an engineered antibody mimetic based on the structure of ankyrin repeats PDB: 1N11​; Michaely ... A specialized family of ankyrin proteins known as muscle ankyrin repeat proteins (MARPs) are involved with the repair and ... Ankyrin repeats, by contrast, contain very few such contacts (that is, they have a low contact order). Most studies have found ...
https://en.wikipedia.org/wiki/Ankyrin_repeat
Ankyrin repeat domain 22Ankyrin repeat domain 22
"Entrez Gene: Ankyrin repeat domain 22". Retrieved 2018-07-11. Grupe A, Li Y, Rowland C, Nowotny P, Hinrichs AL, Smemo S, Kauwe ... Ankyrin repeat domain 22 is a protein that in humans is encoded by the ANKRD22 gene. GRCh38: Ensembl release 89: ...
https://en.wikipedia.org/wiki/Ankyrin_repeat_domain_22
Ankyrin repeat domain 11Ankyrin repeat domain 11
... is a protein that in humans is encoded by the ANKRD11 gene. This locus encodes an ankyrin repeat ... "Entrez Gene: Ankyrin repeat domain 11". Retrieved 2018-04-12. Zhang A, Li CW, Chen JD (July 2007). "Characterization of ... transcriptional regulatory domains of ankyrin repeat cofactor-1". Biochem. Biophys. Res. Commun. 358 (4): 1034-40. doi:10.1016/ ...
https://en.wikipedia.org/wiki/Ankyrin_repeat_domain_11
Notch regulated ankyrin repeat proteinNotch regulated ankyrin repeat protein
... is a protein that in humans is encoded by the NRARP gene. GRCh38: Ensembl release 89: ... Chu BF, Qin YY, Zhang SL, Quan ZW, Zhang MD, Bi JW (July 2016). "Downregulation of Notch-regulated Ankyrin Repeat Protein ... Imaoka T, Okutani T, Daino K, Iizuka D, Nishimura M, Shimada Y (May 2014). "Overexpression of NOTCH-regulated ankyrin repeat ... "Entrez Gene: NOTCH regulated ankyrin repeat protein". Retrieved 2018-04-27. ...
https://en.wikipedia.org/wiki/Notch_regulated_ankyrin_repeat_protein
KN motif and ankyrin repeat domains 4KN motif and ankyrin repeat domains 4
... is a protein that in humans is encoded by the KANK4 gene. GRCh38: Ensembl release 89: ... "Entrez Gene: KN motif and ankyrin repeat domains 4". Retrieved 2017-09-07. v t e (Articles with short description, Short ...
https://en.wikipedia.org/wiki/KN_motif_and_ankyrin_repeat_domains_4
B cell scaffold protein with ankyrin repeats 1B cell scaffold protein with ankyrin repeats 1
... is a protein that in humans is encoded by the BANK1 gene. The protein encoded by ... "Entrez Gene: B cell scaffold protein with ankyrin repeats 1". Retrieved 2018-06-04. Kozyrev SV, Abelson AK, Wojcik J, Zaghlool ...
https://en.wikipedia.org/wiki/B_cell_scaffold_protein_with_ankyrin_repeats_1
ANKRD33ANKRD33
"Entrez Gene: Ankyrin repeat domain 33". Retrieved 2018-04-17. v t e (Genes on human chromosome 12, All stub articles, Human ... Ankyrin repeat domain 33 is a protein that in humans is encoded by the ANKRD33 gene. GRCh38: Ensembl release 89: ...
https://en.wikipedia.org/wiki/ANKRD33
ANKRD31ANKRD31
Ankyrin repeat domain 31 is a protein that in humans is encoded by the ANKRD31 gene. GRCh38: Ensembl release 89: ... "Entrez Gene: Ankyrin repeat domain 31". Retrieved 2016-05-13. v t e (Articles with short description, Short description matches ...
https://en.wikipedia.org/wiki/ANKRD31
ANKRD17ANKRD17
Ankyrin repeat domain-containing protein 17 is a protein that in humans is encoded by the ANKRD17 gene. This gene encodes a ... "Entrez Gene: ANKRD17 ankyrin repeat domain 17". Human ANKRD17 genome location and ANKRD17 gene details page in the UCSC Genome ... protein with ankyrin repeats, which are associated with protein-protein interactions. Studies in mice suggest that this protein ...
https://en.wikipedia.org/wiki/ANKRD17
ANKRD25ANKRD25
KN motif and ankyrin repeat domain-containing protein 2 is a protein that in humans is encoded by the KANK2 gene. GRCh38: ... "Entrez Gene: ANKRD25 ankyrin repeat domain 25". Human KANK2 genome location and KANK2 gene details page in the UCSC Genome ... Zhu Y, Kakinuma N, Wang Y, Kiyama R (Jan 2008). "Kank proteins: a new family of ankyrin-repeat domain-containing proteins". ... 2007). "SIP, a novel ankyrin repeat containing protein, sequesters steroid receptor coactivators in the cytoplasm". EMBO J. 26 ...
https://en.wikipedia.org/wiki/ANKRD25
ANKRD13CANKRD13C
Ankyrin repeat domain-containing protein 13C is a protein that in humans is encoded by the ANKRD13C gene. ANKRD13C is predicted ... "Entrez Gene: ANKRD13C ankyrin repeat domain 13C". Chatr-Aryamontri A, Oughtred R, Boucher L, Rust J, Chang C, Kolas NK, ...
https://en.wikipedia.org/wiki/ANKRD13C
ANKRD15ANKRD15
KN motif and ankyrin repeat domain-containing protein 1 is a protein that in humans is encoded by the KANK1 gene. This gene ... "Entrez Gene: ANKRD15 ankyrin repeat domain 15". Human KANK1 genome location and KANK1 gene details page in the UCSC Genome ... Sarkar S, Roy BC, Hatano N, Aoyagi T, Gohji K, Kiyama R (Sep 2002). "A novel ankyrin repeat-containing gene (Kank) located at ... Zhu Y, Kakinuma N, Wang Y, Kiyama R (Jan 2008). "Kank proteins: a new family of ankyrin-repeat domain-containing proteins". ...
https://en.wikipedia.org/wiki/ANKRD15
KRIT1KRIT1
"Entrez Gene: KRIT1 KRIT1, ankyrin repeat containing". Pagenstecher A, Stahl S, Sure U, Felbor U (Mar 2009). "A two-hit ... a novel ankyrin repeat-containing protein encoded by a gene mapping to 7q21-22". Oncogene. 15 (9): 1043-9. doi:10.1038/sj.onc. ...
https://en.wikipedia.org/wiki/KRIT1
ANKRD23ANKRD23
This gene is a member of the muscle ankyrin repeat protein (MARP) family and encodes a protein with four tandem ankyrin-like ... 2003), "The muscle ankyrin repeat proteins: CARP, ankrd2/Arpp and DARP as a family of titin filament-based stress response ... Ankyrin repeat domain-containing protein 23 is a protein that in humans is encoded by the ANKRD23 gene. ... "Entrez Gene: ANKRD23 ankyrin repeat domain 23". Miller, Melanie K; Bang Marie-Louise; Witt Christian C; Labeit Dietmar; ...
https://en.wikipedia.org/wiki/ANKRD23
Molecular PartnersMolecular Partners
They are derived from natural ankyrin repeat proteins. Repeat proteins are among the most common classes of binding proteins in ... Plückthun, A (2015). "Designed ankyrin repeat proteins (DARPins): binding proteins for research, diagnostics, and therapy". ... "High-affinity binders selected from designed ankyrin repeat protein libraries". Nature Biotechnology. 22 (5): 575-582. doi: ... "Molecular Partners Gets $62.5M as Allergan Repeats on Darpins". Bioworld. August 21, 2012. "Molecular Partners and Amgen ...
https://en.wikipedia.org/wiki/Molecular_Partners
INK4INK4
They contain multiple ankyrin repeats. The INK4a/ARF/INK4b locus encodes three genes (p15INK4b, ARF, and p16INK4a) in a 35- ... P15 is also formed from four ankyrin repeat (AR) motifs. Expression of P15INK4b is induced by TGF-b indicating its role as a ... P16 is formed from four ankyrin repeat (AR) motifs that exhibit a helix-turn-helix conformation except that the first helix in ...
https://en.wikipedia.org/wiki/INK4
TRANK1TRANK1
Tetratricopeptide repeat and ankyrin repeat containing 1 is a protein that in humans is encoded by the TRANK1 gene. Through a ... "Entrez Gene: Tetratricopeptide repeat and ankyrin repeat containing 1". Mühleisen TW, Leber M, Schulze TG, Strohmaier J, ...
https://en.wikipedia.org/wiki/TRANK1
PRR32PRR32
Ankyrin repeat domain-1 was overexpressed in both groups. Underexpressed genes in both groups included myosin light chain ... This action was repeated a few more times and it seems that the PRR32 gene is only relevant in mammals. The google spreadsheet ... leucine-rich repeat kinase-2, follistatin, collagen type XIX alpha-1, ceramide kinase-like, sestrin-3 and CXorf64. No genes ... Validation analysis using RT-PCR confirmed the data for leucine-rich repeat kinase-2, follistatin, collagen type XIX alpha-1, ...
https://en.wikipedia.org/wiki/PRR32
POTEBPOTEB
These orthologs share a similarity with POTEB largely due to the presence of ankyrin repeats, suggesting that ankyrin domain- ... Its secondary structure is mainly five helical ankyrin repeat domains, which contain the TALHL motif. There is also one ... Mosavi LK, Cammett TJ, Desrosiers DC, Peng ZY (June 2004). "The ankyrin repeat as molecular architecture for protein ... "Duplication and extensive remodeling shaped POTE family genes encoding proteins containing ankyrin repeat and coiled coil ...
https://en.wikipedia.org/wiki/POTEB
CLIP4CLIP4
In addition, ankyrin repeats are known to mediate protein-protein interactions. Furthermore, CLIP1, a paralog of CLIP4 in ... In terms of conserved domains, the CLIP4 gene contains primarily ankyrin repeats and the eponymous CAP-Gly domains. The ... Li J, Mahajan A, Tsai MD (December 2006). "Ankyrin repeat: a unique motif mediating protein-protein interactions". Biochemistry ... Two CAP-Gly domains and numerous ankyrin repeats. The secondary structure of CLIP4 consists largely of random coil, with alpha ...
https://en.wikipedia.org/wiki/CLIP4
TrophosomeTrophosome
Ankyrin repeats were believe to assist in the protein-protein interactions. The ankyrin repeat proteins could interact directly ... Li J, Mahajan A, Tsai MD (December 2006). "Ankyrin repeat: a unique motif mediating protein-protein interactions". Biochemistry ...
https://en.wikipedia.org/wiki/Trophosome
ASB1ASB1
Ankyrin repeat and SOCS box protein 1 is a protein that is in humans, encoded by the ASB1 gene. The protein encoded by this ... gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence ... "Entrez Gene: ASB1 ankyrin repeat and SOCS box-containing 1". Human ASB1 genome location and ASB1 gene details page in the UCSC ... 2001). "Cloning and characterization of the genes encoding the ankyrin repeat and SOCS box-containing proteins Asb-1, Asb-2, ...
https://en.wikipedia.org/wiki/ASB1
ASB3ASB3
Ankyrin repeat and SOCS box protein 3 is a protein that in humans is encoded by the ASB3 gene. The protein encoded by this gene ... is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and ... "Entrez Gene: ASB3 ankyrin repeat and SOCS box-containing 3". Human ASB3 genome location and ASB3 gene details page in the UCSC ... Chung AS, Guan YJ, Yuan ZL, Albina JE, Chin YE (May 2005). "Ankyrin repeat and SOCS box 3 (ASB3) mediates ubiquitination and ...
https://en.wikipedia.org/wiki/ASB3
ANKRD24ANKRD24
... is in the protein family that contains ankyrin-repeat domains. Ankyrin repeats are known for mediating protein-protein ... Ankyrin repeat domain-containing protein 24 is a protein in humans that is coded for by the ANKRD24 gene. The gene is also ... "ANKRD24 ankyrin repeat domain 24 [Homo sapiens (human)] - Gene - NCBI". www.ncbi.nlm.nih.gov. Retrieved 2016-05-09. "Gene Card ... "ANKRD24 ankyrin repeat domain 24 [Homo sapiens (human)] - Gene - NCBI". www.ncbi.nlm.nih.gov. Retrieved 2016-04-27. "EST ...
https://en.wikipedia.org/wiki/ANKRD24
ASB2ASB2
Ankyrin repeat and SOCS box protein 2 is a protein that in humans is encoded by the ASB2 gene. The protein encoded by this gene ... is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and ... "Entrez Gene: ASB2 ankyrin repeat and SOCS box-containing 2". Human ASB2 genome location and ASB2 gene details page in the UCSC ... 2001). "Cloning and characterization of the genes encoding the ankyrin repeat and SOCS box-containing proteins Asb-1, Asb-2, ...
https://en.wikipedia.org/wiki/ASB2
ANKRD27ANKRD27
Ankyrin repeat domain-containing protein 27 is a protein that in humans is encoded by the ANKRD27 gene. GRCh38: Ensembl release ... "Entrez Gene: ANKRD27 ankyrin repeat domain 27 (VPS9 domain)". Human ANKRD27 genome location and ANKRD27 gene details page in ...
https://en.wikipedia.org/wiki/ANKRD27
DARPinDARPin
... s correspond to the average size of natural ankyrin repeat protein domains. Proteins with fewer than three repeats (i.e ... Typically, DARPins comprise four or five repeats, of which the first (N-capping repeat) and last (C-capping repeat) serve to ... They are derived from natural ankyrin repeat proteins, one of the most common classes of binding proteins in nature, which are ... Mosavi, L. K.; Minor, D. L.; Peng, Z. -Y. (2002). "Consensus-derived structural determinants of the ankyrin repeat motif". ...
https://en.wikipedia.org/wiki/DARPin
CLPBCLPB
Either the ankyrin repeats alone or the AAA+ domain were found to be insufficient to support disaggregation activity. With only ... Notably, the presence of ankyrin repeats replaced the first of two ATPase domains found in bacteria and fungi. Skd3 belongs to ... In humans, the presence of ankyrin repeats replaced the first of two ATPase domains found in bacteria and fungi, which might ... Mosavi LK, Cammett TJ, Desrosiers DC, Peng ZY (June 2004). "The ankyrin repeat as molecular architecture for protein ...
https://en.wikipedia.org/wiki/CLPB
ANKRD2ANKRD2
Ankyrin Repeat, PEST sequence and Proline-rich region (ARPP), also known as Ankyrin repeat domain-containing protein 2 is a ... "Altered expression of cardiac ankyrin repeat protein and its homologue, ankyrin repeat protein with PEST and proline-rich ... "Altered expression of cardiac ankyrin repeat protein and its homologue, ankyrin repeat protein with PEST and proline-rich ... ANKRD2 has nine exons, four of which encode ankyrin repeats in the middle region of the protein, a PEST-like and Lysine-rich ...
https://en.wikipedia.org/wiki/ANKRD2
ANKS4BANKS4B
The gene is also known as HARP (Harmonin-interacting, ankyrin repeat-containing protein). Ankyrin repeats mediate protein- ... Ankyrin repeat and sterile alpha motif domain containing 4B is a protein that in humans is encoded by the ANKS4B gene. ... "Ankyrin repeat and sterile alpha motif domain containing 4B". Retrieved 2011-12-06. "Dysmorphology data for Anks4b". Wellcome ... ankyrin repeat-containing protein), a novel protein that interacts with harmonin in epithelial tissues". Genes to Cells. 9 (10 ...
https://en.wikipedia.org/wiki/ANKS4B
SPTAN1SPTAN1
Ankyrin repeats of the multidomain Shank protein family interact with the cytoskeletal protein alpha-fodrin". J. Biol. Chem. ... First, a cardiac-specific, 21 amino acid sequence insert in the 21st spectrin repeat, termed alpha II-cardi+, was identified as ... Thirdly, an insert of five amino acids in the fifteenth spectrin motif bears a highly antigenic epitope resembling an ankyrin- ... Secondly, another insert of 20 amino acids in the 10th spectrin repeat, termed SH3i+, contains protein kinase A and protein ...
https://en.wikipedia.org/wiki/SPTAN1
P16P16
It is a protein with 148 amino acids and a molecular weight of 16 kDa that comprises four ankyrin repeats. The name of p16 is ...
https://en.wikipedia.org/wiki/P16
ABTB1ABTB1
Ankyrin repeat and BTB/POZ domain-containing protein 1 is a protein that in humans is encoded by the ABTB1 gene. This gene ... "Entrez Gene: ABTB1 ankyrin repeat and BTB (POZ) domain containing 1". Human ABTB1 genome location and ABTB1 gene details page ... Dai KS, Wei W, Liew CC (Sep 2000). "Molecular cloning and characterization of a novel human gene containing ankyrin repeat and ... encodes a protein with an ankyrin repeat region and two BTB/POZ domains, which are thought to be involved in protein-protein ...
https://en.wikipedia.org/wiki/ABTB1
Index of biochemistry articlesIndex of biochemistry articles
... tandem repeat sequence - taste bud - TATA box - tax gene product - taxonomy - telophase - tertiary structure - tetrodotoxin - ... ankyrin - annexin II - antibiotic - antibody - apoenzyme - apolipoprotein - apoptosis - aquaporin - archaea - arginine - ... trinucleotide repeat - triose - tropomyosin - troponin - tryptophan - tubulin - tumor necrosis factors - tumor necrosis factor ... dinucleotide repeat - diploid - disaccharide - dissociation constant - disulfide bond - disulfide bridge - DNA - DNA ...
https://en.wikipedia.org/wiki/Index_of_biochemistry_articles
Chromosome 6Chromosome 6
F-box and leucine rich repeat protein 4 (6q16.1-q16.2) FEB5: febrile convulsions 5 HACE1: HECT domain and Ankyrin repeat ... NHL repeat containing E3 ubiquitin protein ligase 1 (6p22.3) NOL7: nucleolar protein 7 (6p23) NQO2: N- ...
https://en.wikipedia.org/wiki/Chromosome_6
AxonAxon
Interactions with ankyrin G are important as it is the major organizer in the AIS. The axoplasm is the equivalent of cytoplasm ... October 2019). "Repeated mild traumatic brain injuries induce persistent changes in plasma protein and magnetic resonance ... Leterrier C, Clerc N, Rueda-Boroni F, Montersino A, Dargent B, Castets F (2017). "Ankyrin G Membrane Partners Drive the ... after repeated mild traumatic brain injuries. A nerve guidance conduit is an artificial means of guiding axon growth to enable ...
https://en.wikipedia.org/wiki/Axon
Acyl-CoA-binding proteinAcyl-CoA-binding protein
... and proteins with both an ACB domain and ankyrin repeats. The ACB domain consists of four alpha-helices arranged in a bowl ...
https://en.wikipedia.org/wiki/Acyl-CoA-binding_protein
PTK2PTK2
"Paxillin LD4 motif binds PAK and PIX through a novel 95-kD ankyrin repeat, ARF-GAP protein: A role in cytoskeletal remodeling ...
https://en.wikipedia.org/wiki/PTK2
AnkycorbinAnkycorbin
... contains an ankyrin repeat region located near the N-terminus that consists of 6 ankyrin repeats. The protein is ... Ankycorbin is an ankyrin repeat and coiled-coil domain containing protein that in humans is encoded by the RAI14 gene. It is ... portion that retains some semblance of conservation is the area near the N-terminus that is associated with the ankyrin repeat ...
https://en.wikipedia.org/wiki/Ankycorbin
NFKBIBNFKBIB
Chen Y, Wu J, Ghosh G (June 2003). "KappaB-Ras binds to the unique insert within the ankyrin repeat domain of IkappaBbeta and ...
https://en.wikipedia.org/wiki/NFKBIB
HIF1ANHIF1AN
"Posttranslational hydroxylation of ankyrin repeats in IκB proteins by the hypoxia-inducible factor (HIF) asparaginyl ... "Asparaginyl hydroxylation of the Notch ankyrin repeat domain by factor inhibiting hypoxia-inducible factor". J. Biol. Chem. 282 ...
https://en.wikipedia.org/wiki/HIF1AN
Marilyn FarquharMarilyn Farquhar
Assignment of ankyrin repeat, family A (RFXANK-like) 2 (ANKRA2) to human chromosome 5q12-q13 by radiation hybrid mapping and ...
https://en.wikipedia.org/wiki/Marilyn_Farquhar
Prickle (protein)Prickle (protein)
Prickle can compete with the ankyrin-repeat protein Diego for a binding site on Dishevelled. In Drosophila, prickle is present ...
https://en.wikipedia.org/wiki/Prickle_(protein)
ANKHD1ANKHD1
Ankyrin repeat and KH domain-containing protein 1 is a protein that in humans is encoded by the ANKHD1 gene. This gene encodes ... "Entrez Gene: ANKHD1 ankyrin repeat and KH domain containing 1". Human ANKHD1 genome location and ANKHD1 gene details page in ... Traina F, Favaro PM, Medina Sde S, Duarte Ada S, Winnischofer SM, Costa FF, Saad ST (Sep 2006). "ANKHD1, ankyrin repeat and KH ... a protein with multiple ankyrin repeat domains and a single KH domain. Co-transcription of this gene and the neighboring ...
https://en.wikipedia.org/wiki/ANKHD1
TitinTitin
November 2003). "The muscle ankyrin repeat proteins: CARP, ankrd2/Arpp and DARP as a family of titin filament-based stress ... It has a kinase domain, some Ig/Fn3 repeats, and PEVT repeats that are similarly elastic. Titin is a large abundant protein of ... modules with super-repeat segments. These have been shown to align to the 43 nm axial repeats of myosin thick filaments with ... The N-terminal (the Z-disc end) contains a "Z repeat" that recognizes Actinin alpha 2. The elasticity of the PEVK region has ...
https://en.wikipedia.org/wiki/Titin
Ion channelIon channel
The pore-forming α subunits are very large (up to 4,000 amino acids) and consist of four homologous repeat domains (I-IV) each ... and ankyrin transmembrane protein 1 (TRPA). Channels differ with respect to the ion they let pass (for example, Na+, K+, Cl−), ... Other than Ca2+ and Na+ channels that are formed by four intramolecular repeats, together forming the tetrameric channel's pore ... the new channel had just two Shaker-like repeats, each of which was equipped with one pore domain. Because of this unusual ...
https://en.wikipedia.org/wiki/Ion_channel
Orientia tsutsugamushiOrientia tsutsugamushi
Ankyrin repeat-containing proteins are secreted through a type I secretion system into the host cell. The precise role of type ... RAGE contains a number of genes including tra genes typical of type IV secretion systems and gene for ankyrin repeat-containing ... With a genome of only 2.0-2.7 Mb, it has the most repeated DNA sequences among bacterial genomes sequenced so far. The disease ... The repeated DNA sequence includes short repetitive sequences, transposable elements (including insertion sequence elements, ...
https://en.wikipedia.org/wiki/Orientia_tsutsugamushi
TRPVTRPV
... subunits contain three to five N-terminal ankyrin repeats. TRPV proteins respond to the taste of garlic (allicin). TRPV1 ...
https://en.wikipedia.org/wiki/TRPV
SHANK3SHANK3
SH3 and multiple ankyrin repeat domains 3 (Shank3), also known as proline-rich synapse-associated protein 2 (ProSAP2), is a ... A rat model of SHANK3 was developed using zinc finger nucleases targeting exon 6 of the ankyrin (ANK) repeat domain. The ... The gene encodes a protein that contains 5 interaction domains or motifs including the ankyrin repeats domain (ANK), a src 3 ... "Entrez Gene: SHANK3 SH3 and multiple ankyrin repeat domains 3". Sheng M, Kim E (June 2000). "The Shank family of scaffold ...
https://en.wikipedia.org/wiki/SHANK3
Bare lymphocyte syndrome type IIBare lymphocyte syndrome type II
... also known as ankyrin repeat-containing regulatory factor X-associated protein) has the same function(as the other genes) and ...
https://en.wikipedia.org/wiki/Bare_lymphocyte_syndrome_type_II
OSM-9OSM-9
This protein encodes a protein with ankyrin repeats and is closely related in sequence to the mammalian TRPV ion channels. OSM- ...
https://en.wikipedia.org/wiki/OSM-9
Death Domain databaseDeath Domain database
DDs can also be found with other types of domains including Ankyrin repeats, caspase-like folds, kinase domains, leucine ... zippers, leucine-rich repeats (LRR), TIR domains, and ZU5 domains. Deathdomain.org was initially created by Kwon et al. (2012) ...
https://en.wikipedia.org/wiki/Death_Domain_database
ANKRD35 ankyrin repeat domain 35 [Homo sapiens (human)] - Gene - NCBIANKRD35 ankyrin repeat domain 35 [Homo sapiens (human)] - Gene - NCBI
Ank_2; Ankyrin repeats (3 copies). pfam13637. Location:8 → 41. Ank_4; Ankyrin repeats (many copies). sd00045. Location:29 → 60 ... Ank_2; Ankyrin repeats (3 copies). pfam13637. Location:24 → 74. Ank_4; Ankyrin repeats (many copies). sd00045. Location:53 → 84 ... ANK; ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins. The number of ... ANK; ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins. The number of ...
https://www.ncbi.nlm.nih.gov/gene/148741
An ankyrin-repeat ubiquitin-binding domain determines TRABIDs specificity for atypical ubiquitin chains | Nature Structural &...An ankyrin-repeat ubiquitin-binding domain determines TRABID's specificity for atypical ubiquitin chains | Nature Structural &...
A crystal structure of the extended catalytic domain reveals an unpredicted ankyrin repeat domain that precedes an A20-like ... Structural analysis of TRABID reveals an unpredicted ankyrin-repeat domain that binds ubiquitin and is crucial for TRABID ... NMR analysis identifies the ankyrin domain as a new ubiquitin-binding fold, which we have termed AnkUBD, and DUB assays in ... An ankyrin-repeat ubiquitin-binding domain determines TRABIDs specificity for atypical ubiquitin chains. *Julien D F Licchesi1 ...
https://www.nature.com/articles/nsmb.2169?error=cookies_not_supported&code=0fce14de-6c77-4ec7-bae4-367a3c5715b0
SCOPe 2.08: Family a.118.24.1: Pseudo ankyrin repeatSCOPe 2.08: Family a.118.24.1: Pseudo ankyrin repeat
Pseudo ankyrin repeat. Timeline for Family a.118.24.1: Pseudo ankyrin repeat: *Family a.118.24.1: Pseudo ankyrin repeat first ... there are similarities in the repeat sequence and assembly with the ankyrin repeat (48404). this is a repeat family; one repeat ... Family a.118.24.1: Pseudo ankyrin repeat [140861] (1 protein). one repeat consist of 3 helices; ... Superfamily a.118.24: Pseudo ankyrin repeat-like [140860] (1 family) contains three helices per turn of the superhelix. ...
http://scop.berkeley.edu/sunid=140861
Structural and functional analysis of phosphorylation-specific binders of the kinase ERK from designed ankyrin repeat protein...Structural and functional analysis of phosphorylation-specific binders of the kinase ERK from designed ankyrin repeat protein...
We have selected designed ankyrin repeat proteins (DARPins) from a synthetic library by using ribosome display that selectively ... We have selected designed ankyrin repeat proteins (DARPins) from a synthetic library by using ribosome display that selectively ... Structural and functional analysis of phosphorylation-specific binders of the kinase ERK from designed ankyrin repeat protein ... Structural and functional analysis of phosphorylation-specific binders of the kinase ERK from designed ankyrin repeat protein ...
https://www.zora.uzh.ch/id/eprint/65200/
A primer on ankyrin repeat function in TRP channels and beyondA primer on ankyrin repeat function in TRP channels and beyond
Recent progress in the field has provided new insights into the structure and function of the ankyrin repeat motifs present in ... A primer on ankyrin repeat function in TRP channels and beyond Mol Biosyst. 2008 May;4(5):372-9. doi: 10.1039/b801481g. Epub ... Recent progress in the field has provided new insights into the structure and function of the ankyrin repeat motifs present in ... The topics addressed in this Highlight include the structural features of canonical ankyrin repeats, new clues into the ...
https://pubmed.ncbi.nlm.nih.gov/18414734/?dopt=Abstract
Association of the brain anion exchanger, AE3, with the repeat domain of ankyrin<...Association of the brain anion exchanger, AE3, with the repeat domain of ankyrin<...
Morgans, C. W. ; Kopito, R. R. / Association of the brain anion exchanger, AE3, with the repeat domain of ankyrin. In: Journal ... Morgans, C. W., & Kopito, R. R. (1993). Association of the brain anion exchanger, AE3, with the repeat domain of ankyrin. ... Morgans, CW & Kopito, RR 1993, Association of the brain anion exchanger, AE3, with the repeat domain of ankyrin, Journal of ... Association of the brain anion exchanger, AE3, with the repeat domain of ankyrin. / Morgans, C. W.; Kopito, R. R. ...
https://ohsu.pure.elsevier.com/en/publications/association-of-the-brain-anion-exchanger-ae3-with-the-repeat-doma-2
Ankrd23 branchial arch gene expressionAnkrd23 branchial arch gene expression
ankyrin repeat domain 23 MGI:1925571 .yui-skin-sam .yui-dt th{ background:url(https://www.informatics.jax.org/webshare/images/ ...
https://www.informatics.jax.org/gxd/summary?markerMgiId=MGI:1925571&structureID=EMAPA:16117&structure=branchial%20arch&tab=stagegridtab
KRIT1 gene: MedlinePlus GeneticsKRIT1 gene: MedlinePlus Genetics
KRIT1 ankyrin repeat containing To use the sharing features on this page, please enable JavaScript.. ...
https://medlineplus.gov/genetics/gene/krit1/
Schizosaccharomyces pombe Ankyrin repeat-containing protein P16F5.05c (SPBP16F5.05c) GENTAUR-58bdb282825a8 | GentaursearchSchizosaccharomyces pombe Ankyrin repeat-containing protein P16F5.05c (SPBP16F5.05c) GENTAUR-58bdb282825a8 | Gentaursearch
Schizosaccharomyces pombe Ankyrin repeat-containing protein P16F5.05c (SPBP16F5.05c) datasheet and description hight quality ... Recombinant Schizosaccharomyces pombe Ankyrin repeat-containing protein P16F5. Alternative names: Ankyrin repeat-containing ... Schizosaccharomyces pombe Ankyrin repeat protein P16F5. Short name: 05c (SPBP16F5, 05c), Schizosaccharomyces pombe Ankyrin ... Schizosaccharomyces pombe Ankyrin repeat-containing protein P16F5.05c (SPBP16F5.05c). Contact us. ...
https://gentaursearch.com/product/human/1689664/schizosaccharomyces-pombe-ankyrin-repeat-containing-protein-p16f505c-spbp16f505c.html
NF-kappa B and related proteins: Rel/dorsal homologies meet ankyrin-like repeats - WikidataNF-kappa B and related proteins: Rel/dorsal homologies meet ankyrin-like repeats - Wikidata
NF-kappa B and related proteins: Rel/dorsal homologies meet ankyrin-like repeats. scientific article published on April 1, 1992 ... NF-kappa B and related proteins: Rel/dorsal homologies meet ankyrin-like repeats (English) ...
https://m.wikidata.org/wiki/Q35875812
Fragment-based screening identifies molecules targeting the substrate-binding ankyrin repeat domains of tankyrase. | The...Fragment-based screening identifies molecules targeting the substrate-binding ankyrin repeat domains of tankyrase. | The...
Fragment-based screening identifies molecules targeting the substrate-binding ankyrin repeat domains of tankyrase.. 18/12/2019 ...
https://sguettlerlab.org/publications/fragment-based-screening-identifies-molecules-targeting-the-substrate-binding-ankyrin-repeat-domains-of-tankyrase-2/
Asparaginyl Hydroxylation of the Notch Ankyrin Repeat Domain by Factor Inhibiting Hypoxia-inducible Factor - Nuffield...
Asparaginyl Hydroxylation of the Notch Ankyrin Repeat Domain by Factor Inhibiting Hypoxia-inducible Factor Share Share Share ... Asparaginyl Hydroxylation of the Notch Ankyrin Repeat Domain by Factor Inhibiting Hypoxia-inducible Factor ...
https://www.ndm.ox.ac.uk/publications/18302
Zinc in PDB 3f6q: Crystal Structure of Integrin-Linked Kinase Ankyrin Repeat Domain in Complex with PINCH1 LIM1 Domain
Crystal Structure of Integrin-Linked Kinase Ankyrin Repeat Domain in Complex with PINCH1 LIM1 Domain ... The structure of Crystal Structure of Integrin-Linked Kinase Ankyrin Repeat Domain in Complex with PINCH1 LIM1 Domain also ... Zinc in PDB 3f6q: Crystal Structure of Integrin-Linked Kinase Ankyrin Repeat Domain in Complex with PINCH1 LIM1 Domain. ... The binding sites of Zinc atom in the Crystal Structure of Integrin-Linked Kinase Ankyrin Repeat Domain in Complex with PINCH1 ...
http://zinc.atomistry.com/pdb3f6q.html
SMART: ANK domain annotationSMART: ANK domain annotation
3ANK: A designed ankyrin repeat protein with three identical consensus repeats. 1n0r. 4ANK: A designed ankyrin repeat protein ... EuHMT1 (Glp) Ankyrin Repeat Domain (Structure 2). 3c5r. Crystal Structure of the BARD1 Ankyrin Repeat Domain and Its Functional ... Inhibition of caspase-2 by a designed ankyrin repeat protein (DARPin). 2pnn. Crystal Structure of the Ankyrin Repeat Domain of ... Ad5 knob in complex with a designed ankyrin repeat protein. 4b93. Complex of Vamp7 cytoplasmic domain with 2nd ankyrin repeat ...
https://smart.embl.de/smart/do_annotation.pl?DOMAIN=ANK&START=1130&END=1159&E_VALUE=7.59e-1&TYPE=SMART&BLAST=RKITPLMAAFRKGHVKVVRYLVKEVNQFPS
TCDB » SuperfamiliesTCDB » Superfamilies
Ankyrin Repeat Domain-containing (Ank) Superfamily. The Ankyrin Repeat Domain-containing (Ank) Superfamily is a domain found in ... 8.A.28 - The Ankyrin (Ankyrin) Family. 8.A.35 - The Mycobacterial Membrane Protein Small (MmpS) Family. 9.A.43 - The Cadmium ... Leucine-rich Repeat-containing Domain (LRRD) Superfamily. The Leucine-rich Repeat-containing Domain Family includes members ... Several members of this superfamily have internal repeat sequences of about 20-60 residues. 1.C.50 - The Amyloid β-Protein ...
https://tcdb.org/superfamily.php
The ankyrin repeat-containing adaptor protein Tvl-1 is a novel substrate and regulator of Raf-1<...The ankyrin repeat-containing adaptor protein Tvl-1 is a novel substrate and regulator of Raf-1<...
The ankyrin repeat-containing adaptor protein Tvl-1 is a novel substrate and regulator of Raf-1. In: Journal of Biological ... The ankyrin repeat-containing adaptor protein Tvl-1 is a novel substrate and regulator of Raf-1. / Lin, Jun Hsiang; Makris, ... The ankyrin repeat-containing adaptor protein Tvl-1 is a novel substrate and regulator of Raf-1. Journal of Biological ... title = "The ankyrin repeat-containing adaptor protein Tvl-1 is a novel substrate and regulator of Raf-1", ...
https://einstein.pure.elsevier.com/en/publications/the-ankyrin-repeat-containing-adaptor-protein-tvl-1-is-a-novel-su-2
Hydroxyl group news and latest updatesHydroxyl group news and latest updates
The hydroxylation of ASPP2 and other ankyrin repeat domain proteins. Factor Inhibiting Hypoxia Inducible Factor (FIH) has an ...
https://phys.org/tags/hydroxyl+group/
Browse ORF cDNA clones by species Pan troglodytes, letter g, page 1Browse ORF cDNA clones by species Pan troglodytes, letter g, page 1
G-patch domain and ankyrin repeats 1. protein-coding. GALNT13. polypeptide N-acetylgalactosaminyltransferase 13. protein-coding ...
https://www.genscript.com/gene/9598/pan-troglodytes?search=g
PDF) Combinatorial genomic data refute the human chromosome 2 evolutionary fusion and build a model of functional design for...PDF) Combinatorial genomic data refute the human chromosome 2 evolutionary fusion and build a model of functional design for...
... refute the human chromosome 2 evolutionary fusion and build a model of functional design for interstitial telomeric repeats , ... This type of ankyrin repeat protein is associated with the plasma membrane in eukaryotic cells and is implicated in the ... containing ankyrin repeats. Cell and Tissue Biology 49, no. 12:989-99. ... ITS site of 2 repeats or more. Over 5,000 ITS sites of two repeats or ...
https://www.researchgate.net/publication/329761796_Combinatorial_genomic_data_refute_the_human_chromosome_2_evolutionary_fusion_and_build_a_model_of_functional_design_for_interstitial_telomeric_repeats
MESH TREE NUMBER CHANGES - 2008 MeSHMESH TREE NUMBER CHANGES - 2008 MeSH
Ankyrin Repeat G6.184.603.790.709.610.640.80. Anterior Compartment Syndrome C14.907.553.241.63 C14.907.303.63. Anterior ...
https://decs.bvs.br/P/mnchg2008.htm
Targeted delivery of doxorubicin to HER2 positive tumor models | IJNTargeted delivery of doxorubicin to HER2 positive tumor models | IJN
... designed ankyrin repeat proteins; DMSO, dimethyl sulfoxide; MTT, 3-(4,5-Dimethylthiazol-2-Yl)-2,5-Diphenyltetrazolium Brom. ... This procedure was repeated three times to increase viral transduction efficiency. After 1 week, the selection process was ... All treatments were administered intravenously and repeated twice a week and continued for six injections. To monitor the ...
https://www.dovepress.com/targeted-delivery-of-doxorubicin-to-her2-positive-tumor-models-peer-reviewed-fulltext-article-IJN
Table - Human Granulocytic Anaplasmosis and Anaplasma phagocytophilum - Volume 11, Number 12-December 2005 - Emerging...
... an Ehrlichia phagocytophila group gene encoding a protein antigen with ankyrin-like repeats. Infect Immun. 2000;68:5277-83. DOI ...
https://wwwnc.cdc.gov/eid/article/11/12/05-0898-t1
MMRRC:040826-MUMMRRC:040826-MU
Name: ankyrin repeat domain 52. Synonyms: G431002C21Rik. Type: Gene. Species: Mus musculus (mouse) ...
https://www.mmrrc.org/catalog/sds.php?mmrrc_id=40826
Search Ageing-Associated Genes in Model OrganismsSearch Ageing-Associated Genes in Model Organisms
AnKyrin Repeat-containing protein. Saccharomyces cerevisiae. Necessary For Fitness 50% AKR1. 855205. ALD3. ALdehyde ... Baculoviral IAP Repeat-containing protein. Saccharomyces cerevisiae. Pro-Longevity BIR1. 856924. BMH1. Brain Modulosignalin ...
https://genomics.senescence.info/genes/search.php?organism=Saccharomyces+cerevisiae&show=4
ANKRD28 Antibody (NB100-41419): Novus BiologicalsANKRD28 Antibody (NB100-41419): Novus Biologicals
The immunogen recognized by this antibody maps to a region between residue 975 and 1025 of human ankyrin repeat domain 28 ( ... serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A. *Serine/threonine-protein phosphatase 6 regulatory ... ankyrin repeat domain 28. *Ankyrin repeat domain-containing protein 28. *KIAA0379PITKPP6-ARS-Aphosphatase interactor targeting ...
https://www.novusbio.com/products/ankrd28-antibody_nb100-41419
Addgene: pTNT-B18R-6HisAddgene: pTNT-B18R-6His
ankyrin repeat protein * Species. Vaccinia Virus * Promoter T7/Sp6 * Tag / Fusion Protein *His (C terminal on insert) ...
https://www.addgene.org/58979/
LOC644249 | 遺伝子情報 | J-GLOBAL 科学技術総合リンクセンターLOC644249 | 遺伝子情報 | J-GLOBAL 科学技術総合リンクセンター
ankyrin repeat domain 18A pseudogene. Gene Type： pseudo Organism： Homo sapiens Chromosome： 9 NCBI GeneID： 644249 Location： ...
https://jglobal.jst.go.jp/detail?JGLOBAL_ID=201608002954249982
ankrd10b gene cDNA ORF clone, Danio rerio(zebrafish) - GenScriptankrd10b gene cDNA ORF clone, Danio rerio(zebrafish) - GenScript
Next-day shipping cDNA ORF clones derived from ankrd10b ankyrin repeat domain 10b available at GenScript, starting from $99.00. ... ankyrin repeat domain-containing protein 10 isoform X2. XM_005167451.3. XP_005167508.1. ankyrin repeat domain-containing ... ankyrin repeat domain-containing protein 10 isoform X2. XM_005167453.3. XP_005167510.1. ankyrin repeat domain-containing ... ankyrin repeat domain-containing protein 10 isoform X3. NM_001077377.1. NP_001070845.1. ankyrin repeat domain-containing ...
https://www.genscript.com/gene/danio-rerio/559527/ankrd10b.html
AT2G03430 Result Summary | BioGRIDAT2G03430 Result Summary | BioGRID
Ankyrin repeat family protein. GO Process (0). GO Function (0). GO Component (1) ...
https://thebiogrid.org/273/summary/arabidopsis-thaliana/at2g03430.html
ankrd28 Expression [Xenopus] - Xenbase Gene Catalog ankrd28 Expression [Xenopus] - Xenbase Gene Catalog
Gene Name: ankyrin repeat domain 28 Anatomy terms bone tissue brain central nervous system ectoderm egg head mesonephric kidney ...
https://www.xenbase.org/entry/gene/expression.do?tabId=1&method=displayGenePageExpression&geneId=5857499&objId=5857499
ProteinsDesigned ankyrin repeat proteinDomain 28MotifsIkappaBalphaAnion exchangerFoldDomainsAminoInteractsMolecularFamilyHelicesInteractionPresentStructureRegionDARPinSOCSPutativeMotifDomainsAntibodyProteins involvedTandemly repeatedSpectrinChr5ReceptorsKankEncodesSpecificityGenesAmino acidsResiduesCoiled-coilArmadilloTranscriptionalDescriptionSequenceCardiacSequencesHomoStackHistone
Proteins7
  • We have selected designed ankyrin repeat proteins (DARPins) from a synthetic library by using ribosome display that selectively bind to the mitogen-activated protein kinase ERK2 (extracellular signal-regulated kinase 2) in either its nonphosphorylated (inactive) or doubly phosphorylated (active) form. (uzh.ch)
  • The topics addressed in this Highlight include the structural features of canonical ankyrin repeats, new clues into the functions these repeats perform in cells, and how this information can be applied to develop further experiments on TRP channels and other proteins containing ankyrin repeats. (nih.gov)
  • Tvl-1 is a 269-amino acid ankyrin repeat protein expressed primarily in thymus, lung, and testes that was identified by screening a murine T-cell two-hybrid cDNA library for proteins that associate with the serine-threonine kinase Raf-1. (elsevier.com)
  • Ankyrin repeat (ANK) domains are one of the most abundant motifs in eukaryotic proteins. (surrey.ac.uk)
  • Tissue distribution and subcellular localization of the family of Kidney Ankyrin Repeat Domain (KANK) proteins. (mpg.de)
  • Interacts through its N-terminal region with the ankyrin repeat region of the Notch proteins NOTCH1, NOTCH2, NOTCH3 and NOTCH4. (icr.ac.uk)
  • The relatively short intravitreal half-lives of these proteins, on the order of hours to days, often necessitates repeated administration-in many cases monthly-for maximal clinical effect and visual benefit. (medscape.com)
Designed ankyrin repeat protein1
  • A CD4-specific Designed Ankyrin Repeat Protein (DARPin) was used as a binding domain, since this molecule was shown to be small, well expressed on the cell surface, specific and not immunogenic. (tu-darmstadt.de)
Domain 281
  • The immunogen recognized by this antibody maps to a region between residue 975 and 1025 of human ankyrin repeat domain 28 (phosphatase interactor targeting K protein) using the numbering given in entry NP_056014.2 (GeneID 23243). (novusbio.com)
Motifs2
  • Recent progress in the field has provided new insights into the structure and function of the ankyrin repeat motifs present in the N-terminal cytosolic domain of many TRP channels. (nih.gov)
  • The ankyrin repeat is one of the most common protein-protein interaction motifs in nature. (embl.de)
IkappaBalpha3
  • The structure of the IkappaBalpha ankyrin repeat domain, bound to a partially truncated NF-kappaB heterodimer (p50/ p65), has been determined by X-ray crystallography at 2.7 A resolution. (embl.de)
  • It shows a stack of six IkappaBalpha ankyrin repeats facing the C-terminal domains of the NF-kappaB Rel homology regions. (embl.de)
  • The position of the sixth ankyrin repeat shows that full-length IkappaBalpha will occlude the NF-kappaB DNA-binding cleft. (rcsb.org)
Anion exchanger4
  • The 89 kDa NH2-terminal domain of erythrocyte ankyrin is composed almost entirely of 22 tandem repeats of a 33 amino acid sequence and constitutes the binding site for the cytoplasmic NH 2 -terminal domain of the erythrocyte anion exchanger, AE1. (elsevier.com)
  • Association was assessed by coimmunoprecipitation of ANK90-anion exchanger com plexes from detergent extracts of cells cotransfected with plasmids encoding the ankyrin fragment and the anion exchanger or mutants thereof. (elsevier.com)
  • Using this assay, we show that the brain anion exchanger AE3, but not the closely related homologue, AE2, is capable of binding to ankyrin. (elsevier.com)
  • This repeating sequence of 33-amino acids was discovered in ANKYRIN where it is involved in interaction with the anion exchanger (ANION EXCHANGE PROTEIN 1, ERYTHROCYTE). (bvsalud.org)
Fold3
  • NMR analysis identifies the ankyrin domain as a new ubiquitin-binding fold, which we have termed AnkUBD, and DUB assays in vitro and in vivo show that this domain is crucial for TRABID efficiency and linkage specificity. (nature.com)
  • The ankyrin fold appears to be defined by its structure rather than its function since there is no specific sequence or structure which is universally recognised by it. (embl.de)
  • Ankyrin repeats cooperatively fold into domains that mediate molecular recognition via protein-protein interactions. (bvsalud.org)
Domains3
  • PAPbeta, a protein that binds to and is phosphorylated by the non-receptor tyrosine kinase PYK2, contains several modular signaling domains including a pleckstrin homology domain, an SH3 domain, ankyrin repeats and an ARF-GAP domain. (embl.de)
  • Fragment-based screening identifies molecules targeting the substrate-binding ankyrin repeat domains of tankyrase. (sguettlerlab.org)
  • DAPK contains several domains, including eight ankyrin repeats and a C-terminal death domain. (tocris.com)
Amino2
  • Ankyrin repeats are about 33 amino acids long and occur in at least four consecutive copies. (embl.de)
  • Ankyrin repeats are tandemly repeated modules of about 33 amino acids. (embl.de)
Interacts1
  • Tvl- 1 interacts with Raf-1 via its carboxyl-terminal ankyrin repeat domain. (elsevier.com)
Molecular1
  • La anquirina repite cooperativamente el plegamiento en dominios que median el reconocimiento molecular a través de las interacciones proteína-proteína. (bvsalud.org)
Family1
  • XIII" YMR047C 3 13 3 YMR047C "Nuclear pore complex protein that is member of GLFG repeat-containing family of nucleoporins and is,XIII" YMR049C 3 13 4 YMR049C "Ymr049cp,XIII" YMR051C 3 13 5 YMR051C "TyA Gag protein. (davidson.edu)
Helices1
  • Each repeat folds into a helix-loop-helix structure with a beta-hairpin/loop region projecting out from the helices at a 90 o angle. (embl.de)
Interaction1
  • We have developed an assay to evaluate the in vivo interaction between a fragment of ankyrin corresponding to this domain (ANK90) and two non-erythroid anion exchangers, AE2 and AE3, that share considerable structural homology with AE1. (elsevier.com)
Present1
  • Four ankyrin repeats are also present, the first two of which form an extensive interface with the ARF-GAP domain. (embl.de)
Structure4
  • A crystal structure of the extended catalytic domain reveals an unpredicted ankyrin repeat domain that precedes an A20-like catalytic core. (nature.com)
  • The core of the repeat seems to be an helix-loop-helix structure. (embl.de)
  • Crystal structure of the ARF-GAP domain and ankyrin repeats of PYK2-associated protein beta. (embl.de)
  • The crystal structure of the PAPbeta ARF-GAP domain and the C-terminal ankyrin repeats has been determined at 2.1 A resolution. (embl.de)
Region1
  • They vary in size the common region of overlap is only 90 kb and comprises two candidates genes, ANKRD11 (Ankyrin Repeat Domain 11) and ZNF778 (Zinc Finger 778). (cdc.gov)
DARPin1
  • DARPin ® candidates contain multiple designed ankyrin repeat binding domains and can engage more than five targets, offering potential benefits over conventional monoclonal antibodies or other currently available protein therapeutics. (amgen.com)
SOCS2
  • Expression of testis specific ankyrin repeat and SOCS box-containing 17 gene. (nih.gov)
  • In addition to four new SOCS proteins (SOCS-4 to SOCS-7) containing an SH2 domain and a SOCS box, we describe three new families of proteins that contain either WD-40 repeats (WSB-1 and -2), SPRY domains (SSB-1 to -3) or ankyrin repeats (ASB-1 to -3) N-terminal of the SOCS box. (embl.de)
Putative3
  • putative RING zinc finger ankyrin pro. (cornell.edu)
  • encodes a novel protein with putative ankyrin and transmembrane regions. (or.jp)
  • Compositional properties of Putative ankyrin repeat protein RBE_0220 (bottom) versus UniprotKB/SwissProt (top). (ucy.ac.cy)
Motif5
  • Besides the conserved ankyrin-repeat and coiled-coil domains, there was a conserved motif at the N-terminal (KN motif) containing potential motifs for nuclear localization and export signals. (nih.gov)
  • KN motif and ankyrin repeat domains 2 (Kank2). (alzforum.org)
  • 8. Multispecific Targeting with Synthetic Ankyrin Repeat Motif Chimeric Antigen Receptors. (nih.gov)
  • GIT1 has an N-terminal Zn2+ finger-like motif involved in GTPase activating activity and multipe ankyrin repeat units. (bdbiosciences.com)
  • At the wing tips, NPR1 binds to molecules in the cell's nucleus to turn on plant immune genes, Crystal structure analysis revealed a unique zinc-finger motif in BTB for interacting with ankyrin repeats and mediating NPR1 oligomerization. (sciencemission.com)
Domains8
  • Structural basis for the recognition of kinesin family member 21A (KIF21A) by the ankyrin domains of KANK1 and KANK2 proteins. (nih.gov)
  • PAPbeta, a protein that binds to and is phosphorylated by the non-receptor tyrosine kinase PYK2, contains several modular signaling domains including a pleckstrin homology domain, an SH3 domain, ankyrin repeats and an ARF-GAP domain. (embl.de)
  • It shows a stack of six IkappaBalpha ankyrin repeats facing the C-terminal domains of the NF-kappaB Rel homology regions. (embl.de)
  • Sequence alignments and phylogenetic trees of these domains allow us to interpret the evolutionary relationship between these proteins, concluding that spectrin evolved from alpha-actinin by an elongation process that included two duplications of a block of seven repeats. (embl.de)
  • However, there are proteins where internal repeats are separated by other domains or repeats, which can result in a real mess (or in scientific language: mosaic-like architecture). (freelancingscience.com)
  • Ankyrin repeats cooperatively fold into domains that mediate molecular recognition via protein-protein interactions. (nih.gov)
  • This gene is a member of the channel, TRPV5, encoded by this gene has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats . (ichacha.net)
  • Several proteins containing ankyrin repeat domains (ARDs) have been characterised as substrates of FIH, although there is little evidence for a functional consequence of hydroxylation on these substrates. (cnrs.fr)
Antibody4
  • Genetically engineered antibody MIMETIC PROTEINS , derived from ANKYRIN PROTEINS . (bvsalud.org)
  • Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human WD Repeat Containing Domain Protein 52 (WDR52) in samples from Tissue homogenates, cell lysates and other biological fluids with no significant corss-reactivity with analogues from other species. (clinical-trial-logistics.com)
  • Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human WD Repeat Containing Domain Protein 35 (WDR35) in Tissue homogenates, cell lysates and other biological fluids. (clinical-trial-logistics.com)
  • Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human WD Repeat Containing Domain Protein 35 (WDR35) in samples from Tissue homogenates, cell lysates and other biological fluids with no significant corss-reactivity with analogues from other species. (clinical-trial-logistics.com)
Proteins involved3
  • Ankyrins are proteins involved in binding of spectrin to cell-membrane proteins. (medscape.com)
  • Similar repeats are described in the structural protein ankyrin, as well as in proteins involved in cell cycle control and lineage determination (SW14, SW16, lin2). (atlasgeneticsoncology.org)
  • Spectrin repeats [ ( PUBMED:8266097 ) ] are found in several proteins involved in cytoskeletal structure. (embl.de)
Tandemly repeated2
  • Ankyrin repeats are tandemly repeated modules of about 33 amino acids. (embl.de)
  • Spectrin, the major component of the membrane skeleton that provides elasticity to the cell, contains tandemly repeated sequences of 106 amino acid residues. (embl.de)
Spectrin7
  • The spectrin repeat forms a three-helix bundle. (embl.de)
  • The newly described crystallographic structures of two consecutive homologous repeats of human alpha-actinin, a member of the spectrin superfamily, shed new light on alpha-actinin interchain binding properties. (embl.de)
  • Evolution of the spectrin repeat. (embl.de)
  • The alpha- and beta-subunits of spectrin are made of repeated homologous units of 106 residues. (embl.de)
  • In the recently reported partial sequence of the chicken non-muscle alpha-actinin, a repetitive sequence homologous to the internal repeat in spectrin occurs several times. (embl.de)
  • Ankyrins are multifunctional adaptors that link specific proteins to the membrane-associated, spectrin- actin cytoskeleton. (umbc.edu)
  • Ankyrin G binds to ßIV spectrin and actin to create a submembranous cytoskeletal network in axons. (angioproteomie.com)
Chr51
  • ANKHD1-EIF4EBP3 (uc003lfs.1) at chr5:139761613-139909347 - ANKHD1-EIF4EBP3 protein ANKHD1 (uc010jfl.1) at chr5:139885765-139899625 - ankyrin repeat and KH domain containing 1 ANKHD1 (uc010jfk.1) at chr5:139761613-139832246 - Ankyrin repeat and KH domain-containing protein 1 (Multiple ankyrin repeats single KH domain) (hMASK) (HIV-1 Vpr-binding ankyrin repeat protein). (ucsc.edu)
Receptors1
  • Here we discuss how CRL-mediated degradation of both nucleotide-binding/leucine-rich repeat domain containing immune receptors and SA-induced transcription regulators are critical for functional PCD and SAR responses, respectively. (frontiersin.org)
Kank2
  • The human Kank gene was found as a candidate tumor suppressor for renal cell carcinoma, and encodes an ankyrin-repeat domain-containing protein, Kank. (nih.gov)
  • Tissue distribution and subcellular localization of the family of Kidney Ankyrin Repeat Domain (KANK) proteins. (mpg.de)
Encodes1
Specificity1
  • Contacts occur in discontinuous patches, suggesting a combinatorial quality for ankyrin repeat specificity. (embl.de)
Genes1
  • The number of repeats at each known site varies throughout the population and, therefore, the sequences may be used as markers for the inheritance of nearby, or linked, disease genes. (medscape.com)
Amino acids3
  • The repeat has a length of approximately 33 amino acids and is present in phylogenically diverse proteins including animal, yeast, plant, and prokaryotes. (medscape.com)
  • Ankyrin repeats are about 33 amino acids long and occur in at least four consecutive copies. (embl.de)
  • This repeating sequence of 33-amino acids was discovered in ANKYRIN where it is involved in interaction with the anion exchanger ( ANION EXCHANGE PROTEIN 1, ERYTHROCYTE ). (nih.gov)
Residues2
  • The α-latrotoxin (αLTX) is a neurotoxin with 21 ANK repeats (residues 490-1199) from the venom of the black widow spider. (tcdb.org)
  • The repeats are defined by a characteristic tryptophan (W) residue at position 17 in helix A and a leucine (L) at 2 residues from the carboxyl end of helix C. (embl.de)
Coiled-coil1
  • The encoded protein is characterized by an N-terminal motor domain a coiled-coil stalk domain and a C-terminal WD-40 repeat domain. (nih.gov)
Armadillo1
  • There's a number of protein families that have internal repeats (like TPR, Armadillo, ankyrin etc. (freelancingscience.com)
Transcriptional1
  • The authors found that, after stimulation, salicylic-acid-induced folding and docking of the salicylic-acid-binding domain onto ankyrin repeats is required for the transcriptional cofactor activity of NPR1, providing a structural explanation for a direct role of salicylic acid in regulating NPR1-dependent gene expression. (sciencemission.com)
Description1
  • Description: A sandwich ELISA kit for detection of WD Repeat Containing Domain Protein 52 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. (clinical-trial-logistics.com)
Sequence1
  • The ankyrin fold appears to be defined by its structure rather than its function since there is no specific sequence or structure which is universally recognised by it. (embl.de)
Cardiac1
  • Cardiac ankyrin repeat protein gene (ANKRD1) mutations in hypertrophic cardiomyopathy. (cdc.gov)
Sequences2
  • These sequences consist of short repeats of DNA base-pair sequences. (medscape.com)
  • Ankyrin repeats were first described as homologous sequences in cell-cycle proteins, and have since been detected in several regulatory proteins. (medscape.com)
Homo3
  • BC040231 - Homo sapiens ankyrin repeat and KH domain containing 1, mRNA (cDNA clone IMAGE:4804428), complete cds. (ucsc.edu)
  • BC004457 - Homo sapiens ankyrin repeat and KH domain containing 1, mRNA (cDNA clone IMAGE:2819955), complete cds. (ucsc.edu)
  • BC127127 - Homo sapiens ankyrin repeat and KH domain containing 1, mRNA (cDNA clone IMAGE:40069785), complete cds. (ucsc.edu)
Stack1
  • The ANK repeats are found to form a contiguous spiral stack such that ion transporters like the anion exchanger associate in a large central cavity formed by the ANK repeat spiral, while clathrin and cell adhesion molecules associate with specific regions outside this cavity. (umbc.edu)
Histone1
  • Homologs of ankyrin-repeat protein A and internalin B, which indirectly cause histone modifications in humans, as well as Rv1988 histone methyltransferase, and the DNA methyltransferases Rv2966c, Mhy1, Mhy2, and Mhy3 found in coral-associated bacteria indicate that there are potential host epigenome-modifying proteins in the coral microbiome. (edu.sa)
KRIT1 gene: MedlinePlus Genetics
KRIT1 gene: MedlinePlus Genetics (medlineplus.gov)
An ankyrin-repeat ubiquitin-binding domain determines TRABID's specificity for atypical ubiquitin chains | Nature Structural &...
An ankyrin-repeat ubiquitin-binding domain determines TRABID's specificity for atypical ubiquitin chains | Nature Structural &... (nature.com)
Discoveries in structure and physiology of mechanically activated ion channels | Nature
Discoveries in structure and physiology of mechanically activated ion channels | Nature (nature.com)
SMART: ANK domain annotation
SMART: ANK domain annotation (smart.embl.de)
Browse ORF cDNA clones by species Pan troglodytes, letter g, page 1
Browse ORF cDNA clones by species Pan troglodytes, letter g, page 1 (genscript.com)
PDF) Combinatorial genomic data refute the human chromosome 2 evolutionary fusion and build a model of functional design for...
PDF) Combinatorial genomic data refute the human chromosome 2 evolutionary fusion and build a model of functional design for... (researchgate.net)
Natural and Recombinant - Dog 9 ELISA - Page 1 - TELOS The Electronic Library of Life Science
Natural and Recombinant - Dog 9 ELISA - Page 1 - TELOS The Electronic Library of Life Science (telospub.com)
Targeted delivery of doxorubicin to HER2 positive tumor models | IJN
Targeted delivery of doxorubicin to HER2 positive tumor models | IJN (dovepress.com)
Search Ageing-Associated Genes in Model Organisms
Search Ageing-Associated Genes in Model Organisms (genomics.senescence.info)
Ankrd28 (ankyrin repeat domain 28) - Rat Genome Database
Ankrd28 (ankyrin repeat domain 28) - Rat Genome Database (rgd.mcw.edu)
Addgene: pTNT-B18R-6His
Addgene: pTNT-B18R-6His (addgene.org)
LOC644249 | 遺伝子情報 | J-GLOBAL 科学技術総合リンクセンター
LOC644249 | 遺伝子情報 | J-GLOBAL 科学技術総合リンクセンター (jglobal.jst.go.jp)
Ankrd28 Expression [Xenopus] - Xenbase Gene Catalog
Ankrd28 Expression [Xenopus] - Xenbase Gene Catalog (xenbase.org)
Publications | Max Planck Institute of Biochemistry
Publications | Max Planck Institute of Biochemistry (biochem.mpg.de)
Updates in the Management of Diabetic Macular Edema
Updates in the Management of Diabetic Macular Edema (hindawi.com)
NephMadness 2015: Genetic Nephrology Region
NephMadness 2015: Genetic Nephrology Region (medscape.com)
The Genetics of Lupus
The Genetics of Lupus (medscape.com)
Frontiers | Beyond Neuronal Heat Sensing: Diversity of TRPV1 Heat-Capsaicin Receptor-Channel Functions
Frontiers | Beyond Neuronal Heat Sensing: Diversity of TRPV1 Heat-Capsaicin Receptor-Channel Functions (frontiersin.org)
Sol Genomics Network
Sol Genomics Network (sgn.cornell.edu)
IMCD Transcriptome Database
IMCD Transcriptome Database (dir.nhlbi.nih.gov)