Dictionaries, MedicalAnkyrin Repeat: Protein motif that contains a 33-amino acid long sequence that often occurs in tandem arrays. This repeating sequence of 33-amino acids was discovered in ANKYRIN where it is involved in interaction with the anion exchanger (ANION EXCHANGE PROTEIN 1, ERYTHROCYTE). Ankyrin repeats cooperatively fold into domains that mediate molecular recognition via protein-protein interactions.Dictionaries as Topic: Lists of words, usually in alphabetical order, giving information about form, pronunciation, etymology, grammar, and meaning.Ankyrins: A family of membrane-associated proteins responsible for the attachment of the cytoskeleton. Erythrocyte-related isoforms of ankyrin attach the SPECTRIN cytoskeleton to a transmembrane protein (ANION EXCHANGE PROTEIN 1, ERYTHROCYTE) in the erythrocyte plasma membrane. Brain-related isoforms of ankyrin also exist.Anion Exchange Protein 1, Erythrocyte: A major integral transmembrane protein of the ERYTHROCYTE MEMBRANE. It is the anion exchanger responsible for electroneutral transporting in CHLORIDE IONS in exchange of BICARBONATE IONS allowing CO2 uptake and transport from tissues to lungs by the red blood cells. Genetic mutations that result in a loss of the protein function have been associated with type 4 HEREDITARY SPHEROCYTOSIS.SLC4A Proteins: Bicarbonate transporters that move BICARBONATE IONS in exchange of CHLORIDE IONS or SODIUM IONS across membranes. They regulate acid-base HOMEOSTASIS, cell volume and intracellular pH. Members include CHLORIDE-BICARBONATE ANTIPORTERS (SLC4A1, 2, 3, and 9); SODIUM-COUPLED BICARBONATE TRANSPORTERS (SLC4A4 and 5, 7, 8 and 10); and a sodium borate cotransporter (SLC4A11 protein).Molecular Sequence Data: Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.Amino Acid Sequence: The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.Anion Transport Proteins: Membrane proteins whose primary function is to facilitate the transport of negatively charged molecules (anions) across a biological membrane.Antiporters: Membrane transporters that co-transport two or more dissimilar molecules in the opposite direction across a membrane. Usually the transport of one ion or molecule is against its electrochemical gradient and is "powered" by the movement of another ion or molecule with its electrochemical gradient.Bryopsida: A class of plants within the Bryophyta comprising the mosses, which are found in both damp (including freshwater) and drier situations. Mosses possess erect or prostrate leafless stems, which give rise to leafless stalks bearing capsules. Spores formed in the capsules are released and grow to produce new plants. (Concise Dictionary of Biology, 1990). Many small plants bearing the name moss are in fact not mosses. The "moss" found on the north side of trees is actually a green alga (CHLOROPHYTA). Irish moss is really a red alga (RHODOPHYTA). Beard lichen (beard moss), Iceland moss, oak moss, and reindeer moss are actually LICHENS. Spanish moss is a common name for both LICHENS and an air plant (TILLANDSIA usneoides) of the pineapple family. Club moss is an evergreen herb of the family LYCOPODIACEAE.Periodicals as Topic: A publication issued at stated, more or less regular, intervals.Access to Information: Individual's rights to obtain and use information collected or generated by others.Journal Impact Factor: A quantitative measure of the frequency on average with which articles in a journal have been cited in a given period of time.Bibliometrics: The use of statistical methods in the analysis of a body of literature to reveal the historical development of subject fields and patterns of authorship, publication, and use. Formerly called statistical bibliography. (from The ALA Glossary of Library and Information Science, 1983)Publishing: "The business or profession of the commercial production and issuance of literature" (Webster's 3d). It includes the publisher, publication processes, editing and editors. Production may be by conventional printing methods or by electronic publishing.Peer Review, Research: The evaluation by experts of the quality and pertinence of research or research proposals of other experts in the same field. Peer review is used by editors in deciding which submissions warrant publication, by granting agencies to determine which proposals should be funded, and by academic institutions in tenure decisions.Bryophyta: A division of the plant kingdom. Bryophyta contains the subdivision, Musci, which contains the classes: Andreaeopsida, BRYOPSIDA, and SPHAGNOPSIDA.Protein Structure, Tertiary: The level of protein structure in which combinations of secondary protein structures (alpha helices, beta sheets, loop regions, and motifs) pack together to form folded shapes called domains. Disulfide bridges between cysteines in two different parts of the polypeptide chain along with other interactions between the chains play a role in the formation and stabilization of tertiary structure. Small proteins usually consist of only one domain but larger proteins may contain a number of domains connected by segments of polypeptide chain which lack regular secondary structure.Muridae: A family of the order Rodentia containing 250 genera including the two genera Mus (MICE) and Rattus (RATS), from which the laboratory inbred strains are developed. The fifteen subfamilies are SIGMODONTINAE (New World mice and rats), CRICETINAE, Spalacinae, Myospalacinae, Lophiomyinae, ARVICOLINAE, Platacanthomyinae, Nesomyinae, Otomyinae, Rhizomyinae, GERBILLINAE, Dendromurinae, Cricetomyinae, MURINAE (Old World mice and rats), and Hydromyinae.Histone-Lysine N-Methyltransferase: An enzyme that catalyzes the methylation of the epsilon-amino group of lysine residues in proteins to yield epsilon mono-, di-, and trimethyllysine. EC 2.1.1.43.Protein Binding: The process in which substances, either endogenous or exogenous, bind to proteins, peptides, enzymes, protein precursors, or allied compounds. Specific protein-binding measures are often used as assays in diagnostic assessments.Molecular Sequence Annotation: The addition of descriptive information about the function or structure of a molecular sequence to its MOLECULAR SEQUENCE DATA record.Base Sequence: The sequence of PURINES and PYRIMIDINES in nucleic acids and polynucleotides. It is also called nucleotide sequence.Tankyrases: A group of telomere associated proteins that interact with TRF1 PROTEIN, contain ANKYRIN REPEATS and have poly(ADP-ribose) polymerase activity.Amino Acid Motifs: Commonly observed structural components of proteins formed by simple combinations of adjacent secondary structures. A commonly observed structure may be composed of a CONSERVED SEQUENCE which can be represented by a CONSENSUS SEQUENCE.Monomeric GTP-Binding Proteins: A class of monomeric, low molecular weight (20-25 kDa) GTP-binding proteins that regulate a variety of intracellular processes. The GTP bound form of the protein is active and limited by its inherent GTPase activity, which is controlled by an array of GTPase activators, GDP dissociation inhibitors, and guanine nucleotide exchange factors. This enzyme was formerly listed as EC 3.6.1.47Armadillo Domain Proteins: A family of proteins that contain several 42-amino acid repeat domains and are homologous to the Drosophila armadillo protein. They bind to other proteins through their armadillo domains and play a variety of roles in the CELL including SIGNAL TRANSDUCTION, regulation of DESMOSOME assembly, and CELL ADHESION.Receptor, EphA8: An eph family receptor found exclusively in BRAIN. EphA8 receptors may play a role in the axonal guidance of a subset of tectal commissural NEURONS.I-kappa B Proteins: A family of inhibitory proteins which bind to the REL PROTO-ONCOGENE PROTEINS and modulate their activity. In the CYTOPLASM, I-kappa B proteins bind to the transcription factor NF-KAPPA B. Cell stimulation causes its dissociation and translocation of active NF-kappa B to the nucleus.Sequence Homology, Amino Acid: The degree of similarity between sequences of amino acids. This information is useful for the analyzing genetic relatedness of proteins and species.NF-kappa B p50 Subunit: A component of NF-kappa B transcription factor. It is proteolytically processed from NF-kappa B p105 precursor protein and is capable of forming dimeric complexes with itself or with TRANSCRIPTION FACTOR RELA. It regulates expression of GENES involved in immune and inflammatory responses.TRPV Cation Channels: A subgroup of TRP cation channels named after vanilloid receptor. They are very sensitive to TEMPERATURE and hot spicy food and CAPSAICIN. They have the TRP domain and ANKYRIN repeats. Selectivity for CALCIUM over SODIUM ranges from 3 to 100 fold.

The ankyrin repeat-containing adaptor protein Tvl-1 is a novel substrate and regulator of Raf-1. (1/285)

Tvl-1 is a 269-amino acid ankyrin repeat protein expressed primarily in thymus, lung, and testes that was identified by screening a murine T-cell two-hybrid cDNA library for proteins that associate with the serine-threonine kinase Raf-1. The interaction of Tvl-1 with Raf-1 was confirmed by co-immunoprecipitation of the two proteins from COS-1 cells transiently transfected with Tvl-1 and Raf-1 expression constructs as well as by co-immunoprecipitation of the endogenous proteins from CV-1 and NB2 cells. Tvl-1 interacts with Raf-1 via its carboxyl-terminal ankyrin repeat domain. The same domain also mediates Tvl-1 homodimerization. Tvl-1 was detected by immunofluorescence in both the cytoplasm and the nucleus suggesting that in addition to Raf-1 it may also interact with nuclear proteins. Activated Raf-1 phosphorylates Tvl-1 both in vitro and in vivo. In baculovirus-infected Sf9 insect cells, Tvl-1 potentiates the activation of Raf-1 by Src and Ras while in COS-1 cells it potentiates the activation of Raf-1 by EGF. These data suggest that Tvl-1 is both a target as well as a regulator of Raf-1. The human homologue of Tvl-1 maps to chromosome 19p12, upstream of MEF2B with the two genes in a head to head arrangement.  (+info)

Improved sensitivity of PCR for diagnosis of human granulocytic ehrlichiosis using epank1 genes of Ehrlichia phagocytophila-group ehrlichiae. (2/285)

The agent of human granulocytic ehrlichiosis (HGE), Ehrlichia phagocytophila, and Ehrlichia equi probably comprise variants of a single Ehrlichia species now called the Ehrlichia phagocytophila genogroup. These variants share a unique 153-kDa protein antigen with ankyrin repeat motifs encoded by the epank1 gene. The epank1 gene was investigated as an improved target for PCR diagnosis of HGE compared with the currently used 16S rRNA gene target. Primers for epank1 flanking a region that spans part of the 5' ankyrin repeat coding region and part of the unique 3' region were synthesized. Blood samples from 31 patients with suspected HGE who were previously tested by 16S rRNA gene (16S) PCR and indirect immunofluorescent antibody test (IFA) were retrospectively tested with the epank1 primers. Eleven patients were 16S PCR positive and had a seroconversion detected by IFA (group A), 10 patients were 16S PCR negative but had a seroconversion detected by IFA (group B), and 10 patients were 16S PCR negative and seronegative (group C). Ten of the 11 group A patients were epank1 PCR positive, all 10 of the group B patients were epank1 PCR positive, and all of the PCR-negative and seronegative patients (group C) were epank1 PCR negative. The epank1 primers are more sensitive than the previously used 16S rRNA gene primers and therefore may be more useful in diagnostic testing for HGE.  (+info)

Alastrim smallpox variola minor virus genome DNA sequences. (3/285)

Alastrim variola minor virus, which causes mild smallpox, was first recognized in Florida and South America in the late 19th century. Genome linear double-stranded DNA sequences (186,986 bp) of the alastrim virus Garcia-1966, a laboratory reference strain from an outbreak associated with 0.8% case fatalities in Brazil in 1966, were determined except for a 530-bp fragment of hairpin-loop sequences at each terminus. The DNA sequences (EMBL Accession No. Y16780) showed 206 potential open reading frames for proteins containing >/=60 amino acids. The amino acid sequences of the putative proteins were compared with those reported for vaccinia virus strain Copenhagen and the Asian variola major strains India-1967 and Bangladesh-1975. About one-third of the alastrim viral proteins were 100% identical to correlates in the variola major strains and the remainder were >/=95% identical. Compared with variola major virus DNA, alastrim virus DNA has additional segments of 898 and 627 bp, respectively, within the left and right terminal regions. The former segment aligns well with sequences in other orthopoxviruses, particularly cowpox and vaccinia viruses, and the latter is apparently alastrim-specific.  (+info)

SKIP, a CBF1-associated protein, interacts with the ankyrin repeat domain of NotchIC To facilitate NotchIC function. (4/285)

Notch proteins are transmembrane receptors that mediate intercell communication and direct individual cell fate decisions. The activated intracellular form of Notch, NotchIC, translocates to the nucleus, where it targets the DNA binding protein CBF1. CBF1 mediates transcriptional repression through the recruitment of an SMRT-histone deacetylase-containing corepressor complex. We have examined the mechanism whereby NotchIC overcomes CBF1-mediated transcriptional repression. We identified SKIP (Ski-interacting protein) as a CBF1 binding protein in a yeast two-hybrid screen. Both CBF1 and SKIP are highly conserved evolutionarily, and the SKIP-CBF1 interaction is also conserved in assays using the Caenorhabditis elegans and Drosophila melanogaster SKIP homologs. Protein-protein interaction assays demonstrated interaction between SKIP and the corepressor SMRT. More surprisingly, SKIP also interacted with NotchIC. The SMRT and NotchIC interactions were mutually exclusive. In competition binding experiments SMRT displaced NotchIC from CBF1 and from SKIP. Contact with SKIP is required for biological activity of NotchIC. A mutation in the fourth ankyrin repeat that abolished Notch signal transduction did not affect interaction with CBF1 but abolished interaction with SKIP. Further, NotchIC was unable to block muscle cell differentiation in myoblasts expressing antisense SKIP. The results suggest a model in which NotchIC activates responsive promoters by competing with the SMRT-corepressor complex for contacts on both CBF1 and SKIP.  (+info)

Analysis of notch lacking the carboxyl terminus identified in Drosophila embryos. (5/285)

The cell surface receptor Notch is required during development of Drosophila melanogaster for differentiation of numerous tissues. Notch is often required for specification of precursor cells by lateral inhibition and subsequently for differentiation of tissues from these precursor cells. We report here that certain embryonic cells and tissues that develop after lateral inhibition, like the connectives and commissures of the central nervous system, are enriched for a form of Notch not recognized by antibodies made against the intracellular region carboxy-terminal of the CDC10/Ankyrin repeats. Western blotting and immunoprecipitation analyses show that Notch molecules lacking this region are produced during embryogenesis and form protein complexes with the ligand Delta. Experiments with cultured cells indicate that Delta promotes accumulation of a Notch intracellular fragment lacking the carboxyl terminus. Furthermore, Notch lacking the carboxyl terminus functions as a receptor for Delta. These results suggest that Notch activities during development include generation and activity of a truncated receptor we designate NDeltaCterm.  (+info)

Molecular cloning and characterization of SRAM, a novel insect rel/ankyrin-family protein present in nuclei. (6/285)

Previously, we purified a 59-kDa protein that binds to the kappaB motif of the Sarcophaga lectin gene. Here we report its cDNA cloning and some of its characteristics as a novel member of the Rel/Ankyrin-family. This protein, named SRAM, contained a Rel homology domain, a nuclear localization signal and 4 ankyrin repeats, but lacked the Ser-rich domain and PEST sequence that Relish contained. We found that SRAM was localized in the nuclei of NIH-Sape-4 cells, which are an embryonic cell line of Sarcophaga. The Sarcophaga lectin gene promoter containing tandem repeats of the kappaB motifs was activated in NIH-Sape-4 cells. In Drosophila mbn-2 cells, Dif alone activated this reporter gene and a cooperative effect was detected when SRAM and Dif were co-transfected, although SRAM alone did not activate it. This is the first report of a Rel/Ankyrin molecule that exists in the nuclei.  (+info)

The L1-type cell adhesion molecule neuroglian influences the stability of neural ankyrin in the Drosophila embryo but not its axonal localization. (7/285)

Ankyrins are linker proteins, which connect various membrane proteins, including members of the L1 family of neural cell adhesion molecules, with the submembranous actin-spectrin skeleton. Here we report the cloning and characterization of a second, novel Drosophila ankyrin gene (Dank2) that appears to be the result of a gene duplication event during arthropod evolution. The Drosophila L1-type protein neuroglian interacts with products from both Drosophila ankyrin genes. Whereas the previously described ankyrin gene is ubiquitously expressed during embryogenesis, the expression of Dank2 is restricted to the nervous system in the Drosophila embryo. The absence of neuroglian protein in a neuroglian null mutant line causes decreased levels of Dank2 protein in most neuronal cells. This suggests that neuroglian is important for the stability of Dank2 protein. However, neuroglian is not required for Dank2 axonal localization. In temperature-sensitive neuroglian mutants in which neuroglian protein is mislocated at the restrictive temperature to an intracellular location in the neuronal soma, Dank2 protein can still be detected along embryonic nerve tracts.  (+info)

Cardiac ankyrin repeat protein is a novel marker of cardiac hypertrophy: role of M-CAT element within the promoter. (8/285)

CARP, a cardiac doxorubicin (adriamycin)-responsive protein, has been identified as a nuclear protein whose expression is downregulated in response to doxorubicin. In the present study, we tested the hypothesis that CARP serves as a reliable genetic marker of cardiac hypertrophy in vivo and in vitro. CARP expression was markedly increased in 3 distinct models of cardiac hypertrophy in rats: constriction of abdominal aorta, spontaneously hypertensive rats, and Dahl salt-sensitive rats. In addition, we found that CARP mRNA levels correlate very strongly with the brain natriuretic peptide mRNA levels in Dahl rats. Transient transfection assays into primary cultures of neonatal rat cardiac myocytes indicate that transcription from the CARP and brain natriuretic peptide promoters is stimulated by overexpression of p38 and Rac1, components of the stress-activated mitogen-activated protein kinase pathways. Mutation analysis and electrophoretic mobility shift assays indicated that the M-CAT element can serve as a binding site for nuclear factors, and this element is important for the induction of CARP promoter activity by p38 and Rac1. Thus, our data suggest that M-CAT element is responsible for the regulation of the CARP gene in response to the activation of stress-responsive mitogen-activated protein kinase pathways. Moreover, given that activation of these pathways is associated with cardiac hypertrophy, we propose that CARP represents a novel genetic marker of cardiac hypertrophy.  (+info)

*Ankyrin repeat

Ankyrin repeats typically fold together to form a single, linear solenoid structure called ankyrin repeat domains. These ... designed ankyrin repeat protein), an engineered antibody mimetic based on the structure of ankyrin repeats PDB: 1N11​; Michaely ... A specialized family of ankyrin proteins known as muscle ankyrin repeat proteins (MARPs) are involved with the repair and ... Ankyrin repeats, by contrast, contain very few such contacts (that is, they have a low contact order). Most studies have found ...

*KN motif and ankyrin repeat domains 4

... is a protein that in humans is encoded by the KANK4 gene. GRCh38: Ensembl release 89: ... KN motif and ankyrin repeat domains 4". Retrieved 2017-09-07. ...

*INK4

They contain multiple ankyrin repeats. Ortega, Sagrario; Malumbres, Marcos; Barbacid, Mariano (March 2002). "Cyclin D-dependent ...

*ANKRD31

Ankyrin repeat domain 31 is a protein that in humans is encoded by the ANKRD31 gene. GRCh38: Ensembl release 89: ... ENSG00000145700 - Ensembl, May 2017 "Human PubMed Reference:". "Mouse PubMed Reference:". "Entrez Gene: Ankyrin repeat domain ...

*ANKRD17

Ankyrin repeat domain-containing protein 17 is a protein that in humans is encoded by the ANKRD17 gene. This gene encodes a ... "Entrez Gene: ANKRD17 ankyrin repeat domain 17". Human ANKRD17 genome location and ANKRD17 gene details page in the UCSC Genome ... protein with ankyrin repeats, which are associated with protein-protein interactions. Studies in mice suggest that this protein ...

*ANKRD25

KN motif and ankyrin repeat domain-containing protein 2 is a protein that in humans is encoded by the KANK2 gene. GRCh38: ... "Entrez Gene: ANKRD25 ankyrin repeat domain 25". Human KANK2 genome location and KANK2 gene details page in the UCSC Genome ... Zhu Y, Kakinuma N, Wang Y, Kiyama R (Jan 2008). "Kank proteins: a new family of ankyrin-repeat domain-containing proteins". ... 2007). "SIP, a novel ankyrin repeat containing protein, sequesters steroid receptor coactivators in the cytoplasm". EMBO J. 26 ...

*ANKRD13C

Ankyrin repeat domain-containing protein 13C is a protein that in humans is encoded by the ANKRD13C gene. ANKRD13C is predicted ... "Entrez Gene: ANKRD13C ankyrin repeat domain 13C". Chatr-Aryamontri A, Oughtred R, Boucher L, Rust J, Chang C, Kolas NK, ...

*ANKRD15

KN motif and ankyrin repeat domain-containing protein 1 is a protein that in humans is encoded by the KANK1 gene. This gene ... "Entrez Gene: ANKRD15 ankyrin repeat domain 15". Human KANK1 genome location and KANK1 gene details page in the UCSC Genome ... Zhu Y, Kakinuma N, Wang Y, Kiyama R (Jan 2008). "Kank proteins: a new family of ankyrin-repeat domain-containing proteins". ... "A novel ankyrin repeat-containing gene (Kank) located at 9p24 is a growth suppressor of renal cell carcinoma". J Biol Chem. 277 ...

*KRIT1

"Entrez Gene: KRIT1 KRIT1, ankyrin repeat containing". Pagenstecher A, Stahl S, Sure U, Felbor U (Mar 2009). "A two-hit ... a novel ankyrin repeat-containing protein encoded by a gene mapping to 7q21-22". Oncogene. 15 (9): 1043-9. doi:10.1038/sj.onc. ...

*ANKRD23

This gene is a member of the muscle ankyrin repeat protein (MARP) family and encodes a protein with four tandem ankyrin-like ... 2003), "The muscle ankyrin repeat proteins: CARP, ankrd2/Arpp and DARP as a family of titin filament-based stress response ... Ankyrin repeat domain-containing protein 23 is a protein that in humans is encoded by the ANKRD23 gene. ... "Entrez Gene: ANKRD23 ankyrin repeat domain 23". Miller, Melanie K; Bang Marie-Louise; Witt Christian C; Labeit Dietmar; ...

*ANKRD1

"Altered expression of cardiac ankyrin repeat protein and its homologue, ankyrin repeat protein with PEST and proline-rich ... "Altered expression of cardiac ankyrin repeat protein and its homologue, ankyrin repeat protein with PEST and proline-rich ... Shen L, Chen C, Wei X, Li X, Luo G, Zhang J, Bin J, Huang X, Cao S, Li G, Liao Y (May 2015). "Overexpression of ankyrin repeat ... Song Y, Xu J, Li Y, Jia C, Ma X, Zhang L, Xie X, Zhang Y, Gao X, Zhang Y, Zhu D (2012). "Cardiac ankyrin repeat protein ...

*Polyphosphate kinase

NUC-2 contains several ankyrin repeats. Several members of this family are annotated as XPR1 proteins: the xenotropic and ...

*Molecular Partners

They are derived from natural ankyrin repeat proteins. Repeat proteins are among the most common classes of binding proteins in ... Plückthun, A (2015). "Designed ankyrin repeat proteins (DARPins): binding proteins for research, diagnostics, and therapy". ... soluble and stable proteins from combinatorial libraries of consensus ankyrin repeat proteins". Journal of Molecular Biology. ... "High-affinity binders selected from designed ankyrin repeat protein libraries". Nature Biotechnology. 22 (5): 575-582. doi: ...

*TRANK1

Tetratricopeptide repeat and ankyrin repeat containing 1 is a protein that in humans is encoded by the TRANK1 gene. Through a ... Tetratricopeptide repeat and ankyrin repeat containing 1". Mühleisen TW, Leber M, Schulze TG, Strohmaier J, Degenhardt F, ...

*PRR32

Ankyrin repeat domain-1 was overexpressed in both groups. Underexpressed genes in both groups included myosin light chain ... This action was repeated a few more times and it seems that the PRR32 gene is only relevant in mammals. The google spreadsheet ... leucine-rich repeat kinase-2, follistatin, collagen type XIX alpha-1, ceramide kinase-like, sestrin-3 and CXorf64. No genes ... Validation analysis using RT-PCR confirmed the data for leucine-rich repeat kinase-2, follistatin, collagen type XIX alpha-1, ...

*ASB1

Ankyrin repeat and SOCS box protein 1 is a protein that is in humans, encoded by the ASB1 gene. The protein encoded by this ... gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence ... 2001). "Cloning and characterization of the genes encoding the ankyrin repeat and SOCS box-containing proteins Asb-1, Asb-2, ... ASB1 ankyrin repeat and SOCS box-containing 1". Human ASB1 genome location and ASB1 gene details page in the UCSC Genome ...

*ANKRD24

... is in the protein family that contains ankyrin-repeat domains. Ankyrin repeats are known for mediating protein-protein ... Ankyrin repeat domain-containing protein 24 is a protein in humans that is coded for by the ANKRD24 gene. The gene is also ... "ANKRD24 ankyrin repeat domain 24 [Homo sapiens (human)] - Gene - NCBI". www.ncbi.nlm.nih.gov. Retrieved 2016-05-09. "Gene Card ... "ANKRD24 ankyrin repeat domain 24 [Homo sapiens (human)] - Gene - NCBI". www.ncbi.nlm.nih.gov. Retrieved 2016-04-27. "EST ...

*ANKRD27

Ankyrin repeat domain-containing protein 27 is a protein that in humans is encoded by the ANKRD27 gene. GRCh38: Ensembl release ... "Entrez Gene: ANKRD27 ankyrin repeat domain 27 (VPS9 domain)". Human ANKRD27 genome location and ANKRD27 gene details page in ...

*DARPin

... s correspond to the average size of natural ankyrin repeat protein domains. Proteins with fewer than three repeats (i.e ... Typically, DARPins comprise four or five repeats, of which the first (N-capping repeat) and last (C-capping repeat) serve to ... Mosavi, L. K.; Minor, D. L.; Peng, Z. -Y. (2002). "Consensus-derived structural determinants of the ankyrin repeat motif". ... Simon M, Frey R, Zangemeister-Wittke U, Plückthun A (2013). "rthogonal assembly of a designed ankyrin repeat protein-cytotoxin ...

*CLPB

Notably, the presence of ankyrin repeats replaced the first of two ATPase domains found in bacteria and fungi. CLPB belongs to ... In humans, the presence of ankyrin repeats replaced the first of two ATPase domains found in bacteria and fungi, which might ... Mosavi LK, Cammett TJ, Desrosiers DC, Peng ZY (June 2004). "The ankyrin repeat as molecular architecture for protein ... Li J, Mahajan A, Tsai MD (December 2006). "Ankyrin repeat: a unique motif mediating protein-protein interactions". Biochemistry ...

*ANKRD2

Ankyrin Repeat, PEST sequence and Proline-rich region (ARPP), also known as Ankyrin repeat domain-containing protein 2 is a ... "Altered expression of cardiac ankyrin repeat protein and its homologue, ankyrin repeat protein with PEST and proline-rich ... "Altered expression of cardiac ankyrin repeat protein and its homologue, ankyrin repeat protein with PEST and proline-rich ... ANKRD2 has nine exons, four of which encode ankyrin repeats in the middle region of the protein, a PEST-like and Lysine-rich ...

*ANKS4B

The gene is also known as HARP (Harmonin-interacting, ankyrin repeat-containing protein). Ankyrin repeats mediate protein- ... Ankyrin repeat and sterile alpha motif domain containing 4B is a protein that in humans is encoded by the ANKS4B gene. ... "Ankyrin repeat and sterile alpha motif domain containing 4B". Retrieved 2011-12-06. "Dysmorphology data for Anks4b". Wellcome ... ankyrin repeat-containing protein), a novel protein that interacts with harmonin in epithelial tissues". Genes to Cells. 9 (10 ...

*ANKHD1

Ankyrin repeat and KH domain-containing protein 1 is a protein that in humans is encoded by the ANKHD1 gene. This gene encodes ... "Entrez Gene: ANKHD1 ankyrin repeat and KH domain containing 1". Human ANKHD1 genome location and ANKHD1 gene details page in ... Traina F, Favaro PM, Medina Sde S, Duarte Ada S, Winnischofer SM, Costa FF, Saad ST (Sep 2006). "ANKHD1, ankyrin repeat and KH ... a protein with multiple ankyrin repeat domains and a single KH domain. Co-transcription of this gene and the neighboring ...

*SHANK3

SH3 and multiple ankyrin repeat domains 3 (Shank3), also known as proline-rich synapse-associated protein 2 (ProSAP2), is a ... SHANK3 SH3 and multiple ankyrin repeat domains 3". Boeckers TM, Bockmann J, Kreutz MR, Gundelfinger ED (2002). "ProSAP/Shank ...

*SHANK1

SH3 and multiple ankyrin repeat domains protein 1 is a protein that in humans is encoded by the SHANK1 gene. SHANK1 has been ... "Entrez Gene: SHANK1 SH3 and multiple ankyrin repeat domains 1". Park E, Na M, Choi J, Kim S, Lee JR, Yoon J, Park D, Sheng M, ... Ankyrin repeats of the multidomain Shank protein family interact with the cytoskeletal protein alpha-fodrin". J. Biol. Chem. ... Ankyrin repeats of the multidomain Shank protein family interact with the cytoskeletal protein alpha-fodrin". J. Biol. Chem. ...

*SPTAN1

Ankyrin repeats of the multidomain Shank protein family interact with the cytoskeletal protein alpha-fodrin". J. Biol. Chem. ... First, a cardiac-specific, 21 amino acid sequence insert in the 21st spectrin repeat, termed alpha II-cardi+, was identified as ... Thirdly, an insert of five amino acids in the fifteenth spectrin motif bears a highly antigenic epitope resembling an ankyrin- ... Secondly, another insert of 20 amino acids in the 10th spectrin repeat, termed SH3i+, contains protein kinase A and protein ...
TY - JOUR. T1 - Structure and stability of the ankyrin domain of the Drosophila Notch receptor. AU - Zweifel, Mark E.. AU - Leahy, Daniel J.. AU - Hughson, Frederick M.. AU - Barrick, Doug. PY - 2003/11. Y1 - 2003/11. N2 - The Notch receptor contains a conserved ankyrin repeat domain that is required for Notch-mediated signal transduction. The ankyrin domain of Drosophila Notch contains six ankyrin sequence repeats previously identified as closely matching the ankyrin repeat consensus sequence, and a putative seventh C-terminal sequence repeat that exhibits lower similarity to the consensus sequence. To better understand the role of the Notch ankyrin domain in Notch-mediated signaling and to examine how structure is distributed among the seven ankyrin sequence repeats, we have determined the crystal structure of this domain to 2.0 Å resolution. The seventh, C-terminal, ankyrin sequence repeat adopts a regular ankyrin fold, but the first, N-terminal ankyrin repeat, which contains a 15-residue ...
Scrub typhus is an understudied, potentially fatal infection that threatens one billion persons in the Asia-Pacific region. How the causative obligate intracellular bacterium, Orientia tsutsugamushi facilitates its intracellular survival and pathogenesis is poorly understood. Many intracellular bacterial pathogens utilize the Type 1 (T1SS) or Type 4 secretion system (T4SS) to translocate ankyrin repeat-containing proteins (Anks) that traffic to distinct subcellular locations and modulate host cell processes. The O. tsutsugamushi genome encodes one of the largest known bacterial Ank repertoires plus T1SS and T4SS components. Whether these potential virulence factors are expressed during infection, how the Anks are potentially secreted, and to where they localize in the host cell are not known. We determined that O. tsutsugamushi transcriptionally expresses 20 unique ank genes as well as genes for both T1SS and T4SS during infection of mammalian host cells. Examination of the Anks C-termini revealed that
Involved in the control of cytoskeleton formation by regulating actin polymerization. Inhibits actin fiber formation and cell migration. Inhibits RhoA activity; the function involves phosphorylation through PI3K/Akt signaling and may depend on the competetive interaction with 14-3-3 adapter proteins to sequester them from active complexes. Inhibits the formation of lamellipodia but not of filopodia; the function may depend on the competetive interaction with BAIAP2 to block its association with activated RAC1. Inhibits fibronectin-mediated cell spreading; the function is partially mediated by BAIAP2. Inhibits neurite outgrowth. Involved in the establishment and persistence of cell polarity during directed cell movement in wound healing. In the nucleus, is involved in beta-catenin-dependent activation of transcription. Potential tumor suppressor for renal cell carcinoma.
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
Ubiquitin-binding protein that specifically recognizes and binds Lys-63-linked ubiquitin. Does not bind Lys-48-linked ubiquitin. Positively regulates the internalization of ligand-activated EGFR by binding to the Ub moiety of ubiquitinated EGFR at the cell membrane ...
MEVRGSFLAACRRRMATWRKNRDKDGFSNPGYRVRQKDLGMIHKAAIAGDVNKVMESILLRLNDLNDRDK 1 - 70 KNRTALLLACAHGRPGVVADLVARKCQLNLTDSENRTALIKAVQCQEEVCASILLEHGANPNVRDMYGNT 71 - 140 ALHYAIDNENISMARKLLAYGADIEARSQDGHTSLLLAVNRKKEQMVAFLLKKKPDLTAIDNFGRTALIL 141 - 210 AARNGSTSVVYQLLQHNIDVFCQDISGWTAEDYAVASKFQAIRGMISEYKANKRCKSLQNSNSEQDLEMT 211 - 280 SEGEQERLEGCESSQPQVEEKMKKCRNKKMEVSRNVHADDSDNYNDDVDELIHKIKNRKPDNHQSPGKEN 281 - 350 GEFDRLARKTSNEKSKVKSQIYFTDDLNDISGSSEKTSEDDELPYSDDENFMLLIEQSGMECKDFVSLSK 351 - 420 SKNATAACGRSIEDQKCYCERLKVKFQKMKNNISVLQKVLSETDKTKSQSEHQNLQGKKKLCNLRFILQQ 421 - 490 QEEERIKAEELYEKDIEELKIMEEQYRTQTEVKKQSKLTLKSLEVELKTVRSNSNQNFHTHERERDLWQE 491 - 560 NHLMRDEIARLRLEIDTIKHQNQETENKYFKDIEIIKENNEDLEKTLKRNEEALTKTITRYSKELNVLMD 561 - 630 ENTMLNSELQKEKQSMSRLETEMESYRCRLAAALCDHDQRQSSKRDLQLAFQSTVNEWCHLQEDTNSHIQ 631 - 700 ILSQQLSKAESTSSGLETELHYEREALKEKTLHIEHMQGVLSRTQRRLEDIEHMYQNDQPILEKYVRKQQ 701 - 770 SVEDGLFQLQSQNLLYQQQCNDARKKADNQEKTIINIQVKCEDTVEKLQAECRKLEENNKGLMKECTLLK 771 - 840 ...
Spinal muscular atrophies (SMA, also known as hereditary motor neuropathies) and hereditary motor and sensory neuropathies (HMSN) are clinically and genetically heterogeneous disorders of the peripheral nervous system. Here we report that mutations in the TRPV4 gene cause congenital distal SMA, scapuloperoneal SMA, HMSN 2C. We identified three missense substitutions (R269H, R315W and R316C) affecting the intracellular N-terminal ankyrin domain of the TRPV4 ion channel in five families. Expression of mutant TRPV4 constructs in cells from the HeLa line revealed diminished surface localization of mutant proteins. In addition, TRPV4-regulated Ca(2+) influx was substantially reduced even after stimulation with 4alphaPDD, a TRPV4 channel-specific agonist, and with hypo-osmotic solution. In summary, we describe a new hereditary channelopathy caused by mutations in TRPV4 and present evidence that the resulting substitutions in the N-terminal ankyrin domain affect channel maturation, leading to reduced ...
Dilated cardiomyopathy (DCM), a primary disorder of the cardiac muscle characterized by ventricular chamber dilation and diminished cardiac contractility (1), is the most common cause of chronic heart failure (CHF) in the young and the most common indication for cardiac transplantation (2). The underlying etiologies are varied and include genetic, viral (myocarditis), toxins like alcohol, mitochondrial, and metabolic disorders (3-6).. Familial inheritance is seen in ≈30% to 40% of DCM patients (5). Autosomal dominant mode of inheritance is the most common (≈90%), followed by X-linked (5% to 10%), autosomal recessive, and mitochondrial inheritance patterns (,5%) (7). To date, mutations in ≈20 genes have been discovered in patients with DCM (8). Of these genes, the genes encoding Z-band alternatively spliced PDZ-motif protein, titin, lamin A/C, and β-myosin heavy chain may each be responsible for 5% to 10% of familial DCM cases (9-12), with dystrophin thought to contribute in 10% to 15% of ...
... , Authors: Dessen P. Published in: Atlas Genet Cytogenet Oncol Haematol.
Article{pmid23619335, Author=Lamboy, J. A. and Kim, H. and Dembinski, H. and Ha, T. and Komives, E. A. , Title={{S}ingle-molecule {F}{R}{E}{T} reveals the native-state dynamics of the {I}κ{B}α ankyrin repeat domain}, Journal=J. Mol. Biol., Year=2013, Volume=425, Number=14, Pages=2578--2590, Month=Jul ...
Kidney ankyrin repeat-containing proteins (KANK1/2/3/4) belong to a family of scaffold proteins, playing critical roles in cytoskeleton organization, cell polarity and migration. Mutations in KANK proteins are implicated in cancers and genetic diseases, such as nephrotic syndrome. KANK proteins can bind various target proteins through different protein regions, including a highly conserved ankyrin repeat domain (ANKRD). However, the molecular basis for target recognition by the ANKRD remains elusive. In this study, we solved a high-resolution crystal structure of the ANKRD of KANK1 in complex with a short sequence of the motor protein kinesin family member 21A (KIF21A), revealing that the highly specific target-binding mode of the ANKRD involves combinatorial use of two interfaces ...
Purpose: : Vascular endothelial growth factor (VEGF) is a key controller of pathological angiogenesis and leakage in various retinal diseases. Clinically, anti-VEGF agents have revolutionized treatment of exudative age related macular degeneration (AMD), diabetic retinopathy and retinal vein occlusion. However, one of the main limitations of current VEGF inhibitors remains the need for repeated intravitreal injections. Second-generation VEGF inhibitors should thus aim at providing more efficient VEGF-inhibition to reduce injection frequency. Methods: : In the current study, we use highly potent anti-VEGF DARPins (designed ankyrin repeat proteins) to inhibit VEGF receptor phosphorylation and endothelial cell sprouting in vitro, retinal vascular leakage in rabbits and choroidal angiogenesis in the Laser CNV model in rats. Results: : Our results demonstrate the successful isolation and purification of several DARPins with picomolar affinity to VEGF. In vitro, VEGF receptor phosphorylation was ...
All vertebrates have a left-right body axis with invariant asymmetries of the heart and the positions of the abdominal viscera. Major advances have recently been made in defining molecular components of the pathway specifying the vertebrate left-right axis, but our knowledge of the early determinants is extremely limited. In the inv mouse the left-right axis is consistently reversed, unlike other vertebrate mutants where randomisation of situs is apparent. The gene disrupted in this mouse encodes a 1062-amino-acid protein, inversin. We previously reported 16 tandem ankyrin repeats, spanning amino acids 13-557, and two putative nuclear localisation sequences, but otherwise the sequence offered few clues to the possible function. In order to identify regions likely to be functionally important, we have identified and characterised orthologous sequences in several species, including chick, Xenopus and zebrafish. Sequence comparisons show strong conservation of the ankyrin repeat region and also a lysine
Molecular Biology International is a peer-reviewed, Open Access journal that publishes original research articles as well as review articles in all areas of molecular biology.
View mouse Shank2 Chr7:144001928-144424494 with: phenotypes, sequences, polymorphisms, proteins, references, function, expression
Please, confirm that you want to generate a PDF file of this page. This may take some seconds once process has started. Then it will be opened automatically. ...
Gentaur molecular products has all kinds of products like :search , GenWay \ Ankyrin repeat and SOCS box-containing protein 3 isoform a variant - \ 10-288-22178F for more molecular products just contact us
Highly potent biotoxins like Pseudomonas exotoxin A (ETA) are attractive payloads for tumor targeting. However, despite replacement of the natural cell-binding domain of ETA by tumor-selective antibodies or alternative binding proteins like designed ankyrin repeat proteins (DARPins) the therapeutic window of such fusion toxins is still limited by target-independent cellular uptake, resulting in toxicity in normal tissues. Furthermore, the strong immunogenicity of the bacterial toxin precludes repeated administration in most patients. Site-specific modification to convert ETA into a prodrug-like toxin which is reactivated specifically in the tumor, and at the same time has a longer circulation half-life and is less immunogenic, is therefore appealing. To engineer a prodrug-like fusion toxin consisting of the anti-EpCAM DARPin Ec1 and a domain I-deleted variant of ETA (ETA″), we used strain-promoted azide alkyne cycloaddition for bioorthogonal conjugation of linear or branched polyethylene ...
Allergan will make Molecular Partners a combined up-front payment of $62.5 million as part of two new agreements centered on the discovery, development, and commercialization of DARPin® (Designed Ankyrin Repeat Protein) therapeutics for treating serious ophthalmic disorders.
PIKE-A (PIKE-activating gene differs from PIKE-S with the addition of a 40-kDa C-terminal extension containing Arf-GAP and two ankyrin-repeat domains. and peripheral bloodstream leukocytes (4-6). Weve proven that PIKE-A is certainly coamplified with CDK4 on chromosome 12 in a number of human malignancies including sarcoma RG7112 neuroblastoma and glioblastoma (32). PIKE-A is certainly readily discovered in 12q-amplified cell lines including RMS13 rhabdomyosarcoma and OSA osteosarcoma however not in regular muscles (6). PIKE-A provides the GTPase PH ArfGAP and two Ankyrin repeats domains within PIKE-L but does not have the N-terminal proline-rich area which binds proteins 4.1N PLC-γ1 and PI3-kinase. PIKE-A particularly binds to energetic Akt and up-regulates its activity within a GTP-dependent way mediating human cancers cell invasion (32). Akt/PKB is an essential regulator of divergent cellular procedures including apoptosis proliferation fat burning capacity and differentiation. Constitutive ...
J:44447 Baumeister A, Arber S, Caroni P, Accumulation of muscle ankyrin repeat protein transcript reveals local activation of primary myotube endcompartments during muscle morphogenesis. J Cell Biol. 1997 Dec 1;139(5):1231-42 ...
Complete information for ANKRD20A15P gene (Pseudogene), Ankyrin Repeat Domain 20 Family Member A15, Pseudogene, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
Complete information for ANKRD6 gene (Protein Coding), Ankyrin Repeat Domain 6, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
Directed evolution of anti-HER2 DARPins by SNAP display reveals stability-function trade-offs in the selection process. . Biblioteca virtual para leer y descargar libros, documentos, trabajos y tesis universitarias en PDF. Material universiario, documentación y tareas realizadas por universitarios en nuestra biblioteca. Para descargar gratis y para leer online.
LIAR antibody (ankyrin repeat domain 54) for ELISA, ICC/IF, IHC-P, WB. Anti-LIAR pAb (GTX85269) is tested in Human, Mouse, Rat samples. 100% Ab-Assurance.
Gracheva EO, Cordero-Morales JF, González JA, Ingolia NT, Aranguren CI, Manno C, Weissman JS, Julius D. Ganglion-specific splicing of TRPV1 underlies infrared sensation in vampire bats. Nature 2011: 476(7358):88-91. Highlighted in "Nature News and views": Fenton MB. Heat-thirsty bats. 2011; 476:40-41.. Bagriantsev S, Peyronnet R, Clark K, Honore E, Minor DL. Multiple modalities converge on a common gate to control K2P channel function. EMBO J 2011, 30: 3594-606.. Cordero-Morales JF, Gracheva EO, Julius D. Cytoplasmic ankyrin repeat domains of TRPA1 dictate sensitivity to thermal and chemical stimuli. PNAS 2011, 108(46):E1184-91.. 2010. Gracheva EO, Ingolia NT, Kelly YM, Cordero-Morales JF, Hollopeter G, Chesler AT, Sánchez EE, Perez JC, Weissman JS, Julius D. Molecular basis of infrared detection by snakes. Nature 2010, 464(7291):1006-11.. Bagriantsev S, Minor DL. Small molecule ion channel match making: a natural fit for new ASIC ligands. Neuron 2010, 68(1):1-3.. Gracheva EO, Maryon EB, ...
The worlds first wiki where authorship really matters. Due credit and reputation for authors. Imagine a global collaborative knowledge base for original thoughts.
Opens the Highlight Feature Bar and highlights feature annotations from the FEATURES table of the record. The Highlight Feature Bar can be used to navigate to and highlight other features and provides links to display the highlighted region separately. Links in the FEATURES table will also highlight the corresponding region of the sequence. More... ...
Reagents, Tools and Custom Services for molecular biology, specializing in the fields of Nano-Antibody development (nAb), Cellular Reprogramming (iPSC), Genome Editing, Fluorescent Proteins, RNAi, Viral Packaging and Protein expression.
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
Close The Infona portal uses cookies, i.e. strings of text saved by a browser on the users device. The portal can access those files and use them to remember the users data, such as their chosen settings (screen view, interface language, etc.), or their login data. By using the Infona portal the user accepts automatic saving and using this information for portal operation purposes. More information on the subject can be found in the Privacy Policy and Terms of Service. By closing this window the user confirms that they have read the information on cookie usage, and they accept the privacy policy and the way cookies are used by the portal. You can change the cookie settings in your browser. ...
ASB9 antibody [N1C3] (ankyrin repeat and SOCS box containing 9) for ICC/IF, IHC-P, WB. Anti-ASB9 pAb (GTX107216) is tested in Human samples. 100% Ab-Assurance.
The tumor suppressor p16(INK4a) has earned widespread attention in cancer studies since its discovery as an inhibitor of cyclin-dependent kinases (CDKs) 4/6. Structurally, it consists of four complete ankyrin repeats, believed to be involved in CDK4
The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex assemblies. As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
POTED - POTED (untagged)-Human POTE ankyrin domain family, member D (POTED) available for purchase from OriGene - Your Gene Company.
KANK3 - KANK3 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector shRNA available for purchase from OriGene - Your Gene Company.
Mouse polyclonal antibody raised against a full-length human RFXANK protein. RFXANK (NP_604389.1, 1 a.a. ~ 237 a.a) full-length human protein. (H00008625-B01P) - Products - Abnova
Selamat Datang Di Website Resmi Obat Dewa Red Kank, Web Ini Menyediakan informasi Mengenai Produk Red Kank, Artikel Kesehatan serta Layanan Informasi Dan Lain2 Yang Berkaitan Dengan Kesehatan Serta Menyediakan Wadah Untuk Berkonsultasi Mengenai Keluhan Penyakit Dari Pelanggan Red Kank Secara Gratis Via e-Clinic.
购买ANKRD61兔多克隆抗体(ab122064),ANKRD61抗体经IHC-P验证,可与人样本反应。产品出库一年都在质保范围内。中国现货速达。
ANKRD35兔多克隆抗体(ab122279)可与人样本反应并经WB, IHC, ICC/IF实验严格验证。中国75%以上现货,所有产品均提供质保服务,可通过电话、电邮或微信获得本地专属技术支持。
So where do I go from here? I see nothing else either. Will you do a Jing (pic,or video)? You will see the Jing site come up, if you go to my link and you will see what I am seeing. You can use the Jing site to do a video, or screen shot of what to do with this MOD and how to do it? All I see different is a red box around my nick. ...
Created page with "* [[Level 1]] * [[Level 2]] * [[Level 3]] * [[Level 4]] * [[Level 5]] * [[Level 6]] * [[Level 7]] * [[Level 9]] * [[Level 10 ...
Dont Get Bossed Around - Terraria: terraria-gameplay-ign-commentary The three Hardmode Bosses exist in another league compared to their regular mode counterparts. The big three baddies...
Looking for online definition of ankyrin repeat domain 3 in the Medical Dictionary? ankyrin repeat domain 3 explanation free. What is ankyrin repeat domain 3? Meaning of ankyrin repeat domain 3 medical term. What does ankyrin repeat domain 3 mean?
ASB13A.2; ankyrin repeat and SOCS box containing 13a, tandem duplicate 2; si:dkey-108d22.2; uncharacterized protein LOC563551; ankyrin repeat and SOCS box-containing 13a, tandem duplicate 2 ...
Protein Motif that contains a 33-amino acid long sequence that often occurs in tandem arrays. This repeating sequence of 33-Amino Acids was discovered in Ankyrin where it is involved in interaction with the anion exchanger (Anion Exchange Protein 1, Erythrocyte). Ankyrin repeats cooperatively fold into domains that mediate molecular recognition via protein-protein interactions ...
Using single-molecule atomic force microscopy, we find that a protein consisting of six identical ankyrin repeat units flanked by N- and C-terminal modules (N6C) unfolds in a stepwise, unit-by-unit fashion under a mechanical force. Stretching a N6C molecule results in a sawtooth pattern fingerprint, with as many as six peaks separated by ~10 nm and an average unfolding force of 50 ± 20 pN. Our results demonstrate that a stretching force can unfold multiple repeat units individually in a single protein molecule, despite extensive hydrophobic interactions between adjacent units ...
Microbial pathogens employ sophisticated virulence strategies to cause infections in humans. The intracellular pathogen Legionella pneumophila encodes RidL to hijack the host scaffold protein VPS29, a component of retromer and retriever complexes critical for endosomal cargo recycling. Here, we determined the crystal structure of L. pneumophila RidL in complex with the human VPS29-VPS35 retromer subcomplex. A hairpin loop protruding from RidL inserts into a conserved pocket on VPS29 that is also used by cellular ligands, such as Tre-2/Bub2/Cdc16 domain family member 5 (TBC1D5) and VPS9-ankyrin repeat protein for VPS29 binding. Consistent with the idea of molecular mimicry in protein interactions, RidL outcompeted TBC1D5 for binding to VPS29. Furthermore, the interaction of RidL with retromer did not interfere with retromer dimerization but was essential for association of RidL with retromer-coated vacuolar and tubular endosomes. Our work thus provides structural and mechanistic evidence into how ...
Kummer, L; Parizek, P; Rube, P; Millgramm, B; Prinz, A; Mittl, P R E; Kaufholz, M; Zimmermann, B; Herberg, F W; Pluckthun, A (2012). Structural and functional analysis of phosphorylation-specific binders of the kinase ERK from designed ankyrin repeat protein libraries. Proceedings of the National Academy of Sciences of the United States of America (PNAS), 109(34):E2248-E2257.. ...
Nephrotic syndrome (NS) results from disruption of the kidney filtration barrier and is associated with proteinuria, hypoalbuminemia, and edema. Many children with NS respond to steroid therapy; however, steroid-resistant NS (SRNS) progresses to end-stage disease that requires renal replacement therapy. In many cases, the underlying cause of SNRS is unknown; however, recent studies have identified monogenic mutations that underlie disease. Several proteins encoded by NS-associated genes localize to podocytes, which are essential for maintenance of the glomerular filtration barrier. Heon Yung Gee, Fujian Zhang, and colleagues at Harvard Medical School and Childrens National Medical Center evaluated families with NS and identified recessive mutations in the kidney ankyrin repeat-containing protein-encoding genes KANK1, KANK2, and KANK4. Additionally, an independent screen in a Drosophila model determined that the Drosophila KANK homologue (dKank) is required for nephrite function. KANK1, KANK2, ...
The results of the current study demonstrate that insulin receptor substrate 4 co-localizes with Asb-4 within areas of the hypothalamus and amygdala that regulate caloric intake and energy expenditure. Asb-4 regulates IRS4 levels by directing its degradation via ubiquitination and decreasing the down-stream signal of IRS4. Five separate observations support this conclusion: 1) Asb-4 and IRS4 are both expressed in the arcuate nucleus, the dorsomedial nucleus of the hypothalamus and the amygdala; 2) Asb-4 colocalizes with IRS4, and both molecules are expressed in POMC and NPY neurons of the hypothalamus; 3) the molecules co-precipitate in vitro and in vivo; 4) increased expression of full-length Asb-4 causes decreased levels of IRS4; 5) expression of full-length Asb-4 increases ubiquitination of IRS4 and decreased phospho-AKT at Thr308.. Although IRS4 is thought to have a role in signal transduction similar to other member of the IRS family, the tissue distribution of IRS4 is substantially ...
The protein encoded by this gene belongs to the Kank family of proteins, which contain multiple ankyrin repeat domains. This family member functions in cytoskeleton formation by regulating actin polymerization. This gene is a candidate tumor suppressor for renal cell carcinoma. Mutations in this gene cause cerebral palsy spastic quadriplegic type 2, a central nervous system development disorder. A t(5;9) translocation results in fusion of the platelet-derived growth factor receptor beta gene (PDGFRB) on chromosome 5 with this gene in a myeloproliferative neoplasm featuring severe thrombocythemia. Alternative splicing of this gene results in multiple transcript variants. A related pseuodgene has been identified on chromosome 20 ...
The TRPV4 calcium-permeable cation channel plays important physiological roles in osmosensation, mechanosensation, cell barrier formation, and bone homeostasis. Recent studies reported that mutations in TRPV4, including some in its ankyrin repeat domain (ARD), are associated with human inherited diseases including neuropathies and skeletal dysplasias, probably due to increased constitutive activity of the channel. TRPV4 activity is regulated by the binding of calmodulin and small molecules such as ATP to the ARD in its cytoplasmic N-terminus. We determined structures of ATP-free and -bound forms of human TRPV4-ARD and compared them with available TRPV-ARD structures. The third inter-repeat loop region (Finger 3 loop) is flexible and may act as a switch to regulate the channel activity. Comparisons of TRPV-ARD structures also suggest an evolutionary link between ARD structure and ATP binding ability. Thermal stability analyses and molecular dynamics (MD) simulations suggest that ATP increases ...
The overall objective of this R21 application is to explore the role of ankyrin-repeat SOCS-box containing protein 2 (Asb2) in the regulation of CD4 helper T ce...
2V4H: Darpin-Assisted Crystallography of the Cc2-Lz Domain of Nemo Reveals a Coupling between Dimerization and Ubiquitin-Binding.
Summary of RFXANK (ANKRA1, BLS, F14150_1, MGC138628, RFX-B) expression in human tissue. Mainly nuclear expression in all tissues.
Buy our Recombinant Human RFXANK protein. Ab167884 is a full length protein produced in Escherichia coli and has been validated in SDS-PAGE, MS. Abcam provides…
(ID:15338) The modular architecture of repeat proteins determines the molecular folding mechanism of this class of proteins. Anykr
Cardiac hypertrophy is a growth process that occurs in response to stress stimuli or injury, and leads to the induction of several pathways to alter gene expression. Under hypertrophic stimuli, sarcomeric structure is disrupted, both as a consequence of gene expression and local changes in sarcomeric proteins. Cardiac-restricted ankyrin repeat protein (CARP) is one such protein that function both in cardiac sarcomeres and at the transcriptional level. We postulate that due to this dual nature, CARP plays a key role in maintaining the cardiac sarcomere. GATA4 is another protein detected in cardiomyocytes as important in hypertrophy, as it is activated by hypertrophic stimuli, and directly binds to DNA to alter gene expression. Results of GATA4 activation over time were inconclusive; however, the role of CARP in mediating hypertrophic growth in cardiomyocytes was clearly demonstrated. In this study, Neonatal Rat Ventricular Myocytes were used as a model to detect changes over time in CARP and ...
Mice with normoblastosis, nb/nb, have a severe hemolytic anemia. The extreme fragility and shortened lifespan of the mutant erythrocytes result from a defective membrane skeleton. Previous studies in our laboratory indicated a 50% deficiency of spectrin and an absence of normal ankyrin in erythrocyte membranes of nb/nb mice. We now report genetic mapping data that localize both the nb and erythroid ankyrin (Ank-1) loci to the centromeric end of mouse chromosome 8. Using immunological and biochemical methods, we have further characterized the nature of the ankyrin defect in mutant erythrocytes. We do not detect normal sized (210 kDa) erythroid ankyrin by immunoblot analysis in nb/nb reticulocytes. However, nb/nb reticulocytes do contain a 150-kDa ankyrin immunoreactive protein. The 150-kDa protein is present with normal-sized ankyrin in nb/+ reticulocytes but is not found in +/+ reticulocytes. Our genetic and biochemical data indicate that the nb mutation results from a defect in the
We have recently found that the erythroid ankyrin gene, Ank1, expresses isoforms in mouse skeletal muscle, several of which share COOH-terminal sequence with previously known Ank1 isoforms but have a novel, highly hydrophobic 72-amino acid segment at their NH2 termini. Here, through the use of domain-specific peptide antibodies, we report the presence of the small ankyrins in rat and rabbit skeletal muscle and demonstrate their selective association with the sarcoplasmic reticulum. In frozen sections of rat skeletal muscle, antibodies to the spectrin-binding domain (anti-p65) react only with a 210-kD Ank1 and label the sarcolemma and nuclei, while antibodies to the COOH terminus of the small ankyrin (anti-p6) react with peptides of 20 to 26 kD on immunoblots and decorate the myoplasm in a reticular pattern. Mice homozygous for the normoblastosis mutation (gene symbol nb) are deficient in the 210-kD ankyrin but contain normal levels of the small ankyrins in the myoplasm. In nb/nb skeletal
Recruitment of ankyrin G by NF186 is critical for PNS node assembly. (A) DRG neurons expressing NF186-GFP or NF186ΔABD-GFP were cultured with Schwann cells under myelinating conditions, fixed, and stained for GFP, P0, and ankyrin G (left) or sodium channels (NaCh; right). Robust levels of NF186ΔABD at nodes were associated with reduced coexpression of ankyrin G and sodium channels, as evident by comparison of nontransfected nodes (asterisks) to transfected nodes (arrowheads). Bars, 10 μm. (B) Schematic diagram and sequence of NF constructs used for rescue experiments. The modified sequence within the NF mucin-like domain is shown with substituted codons marked in red. (C) Western blot of NF186 knockdown and rescue. DRG neurons were infected with pLL3.7 vector alone (sh Con) or encoding shRNA to endogenous NF186. shRNA-treated neurons were either not nucleofected (sh NF) or were nucleofected with the codon-modified NF186-GFP (+NF) or NF186ΔABD-GFP constructs (+NFΔABD). Lysates were blotted ...
In classical immunochemistry, antibodies of the IgG type are used to label cellular structures. Due to the size of the primary and secondary antibody (about 10 nm each) the size of the observed structure increases by 30-40 nm. The size of the DARPins (3 nm) may open up a resolution regime that is not addressable with conventional labeling techniques. We will set up, optimize and perform STED nanoscopy with sub-50 nm resolution on various cultured breast cancer cell line models as well as on tissue samples using DARPins and antibodies to evaluate the nanoscopic distribution of HER2 and related proteins ...
Mutational activation of the murine int-3 oncogene can contribute to mammary gland tumorigenesis. Evidence suggests that int-3 regulates the morphogenesis and functional differentiation of the mouse mammary gland. The proposed research investigates the role of int-3 proteins in the normal physiology of braast development and the biochemical properties critical for mt-3 transforming activity. cDNAs encoding the truncated int-3 oncogene were cloned. A full length cDNA of approximately 7.3 kilobases was subsequently cloned and has been sequenced. The deduced amino acid sequence verifies that int-3 is a Notch/lin-12 family member. Structually, the int-3 protein contains approximately 20 EGF-like repeats, 3 Notch/lin-12 repeats, a transmembrane domain, and an intracellular domain containing six ankyrin repeats. Analysis of int-3 mRNA shows expression in several adult tissues and during mouse embryonic development. Cell lines have been generated that express an epitope-tagged int-3 oncoprotein, which was
KEYWORD: 3D-structure Activator Alternative splicing ANK repeat Apoptosis DNA-binding Nuclear protein Phosphorylation Polymorphism Repeat Transcription regulation Ubl conjugation ...
N terminal band 3 binding domain with 24 tandem subunits of 33 amino-acids (the SW16/Ank repeat), important for lipid-binding activity of the beta-spectrin ankyrin-binding domain and its substantial role in maintaining the spectrin-based skeleton distribution ...
This antibody pair set comes with matched antibody pair to detect and quantify protein level of human ANKRA2. (H00057763-AP11) - Products - Abnova
The worlds first wiki where authorship really matters. Due credit and reputation for authors. Imagine a global collaborative knowledge base for original thoughts.
Fast delivery of KANK2 knockout Human Cell Lines for the study of gene function. Created by CRISPR/Cas9 genome editing. Includes matched wildtype control.
Q: Dear Doctor, I have a concern. I was in a relationship with a man for a year, and Itrusted him until I found out that he was a pathological liar.Soon after we parted, I was experiencing a discharge, so Ivisited the...
We use cookies to ensure that we give you the best experience on our website. If you continue without changing your settings well assume that you are happy to receive all cookies on the FIH website. To find out more about our data policy please click here. ...
If you receive your order and it is not what you are expecting you can return it back to us within 30 days of receiving the goods for an exchange or refund (including the delivery charge if you return it within 14 days).. You can return your items by using Collect+ or by taking them to any GO Outdoors store (except Hathersage) using your delivery note as proof of purchase.. Unfortunately, orders paid for using PayPal cannot be returned to store and we are currently unable to offer free returns as we offer free delivery over £50 as standard.. See our returns policy for more information.. ...
The E3 ubiquitin ligase Fbw7 (F-box and WD repeat domain-containing 7) is broadly considered as a tumor suppressor because of its role in turnover of several well-known onco-proteins. However, the role of Fbw7 in melanomagenesis is not clear. To investigate the expression profile and biological functions of Fbw7 in melanoma, we examined Fbw7 expression level using melanoma tissue microarray and immunohistochemistry. Our data showed that Fbw7 expression is significantly reduced in primary melanoma compared with dysplastic nevi (P = 0.020) and further reduced in metastatic melanoma compared with primary melanoma (P = 0.011). Furthermore, we observed a strong correlation between negative Fbw7 expression and a worse 5-year survival of melanoma patients (P = 0.015). We also found that both Fbw7 protein and mRNA expression was significantly reduced in 9 melanoma cell lines compared with normal melanocytes. Moreover, our in vitro studies showed a remarkable increase of cell migration and stress fibre ...
Mechanical forces play an essential role in cellular processes as input, output, and signals. Various protein complexes in the cell are designed to handle, transform and use such forces. For instance, proteins of muscle and the extracellular matrix can withstand considerable stretching forces, hearing-related and mechanosensory proteins can transform weak mechanical stimuli into electrical signals, and regulatory proteins are suited to forcing DNA into loops to control gene expression. Here we review the structure-function relationship of four protein complexes with well defined and representative mechanical functions. The first example is titin, a protein that confers passive elasticity on muscle. The second system is the elastic extracellular matrix protein, fibronectin, and its cellular receptor integrin. The third protein system is the transduction apparatus in hearing and other mechanical senses, likely containing cadherin and ankyrin repeats. The last system is the lac repressor protein, ...
Mono- and Stereopictres of 5.0 Angstrom coordination sphere of Bromine atom in PDB 3f59: Crystal Structure Of ZU5-Ank, the Spectrin Binding Region of Human Erythroid Ankyrin
Isoforms of Spectrin and Ankyrin Reflect the Functional Topography of the Mouse Kidney. . Biblioteca virtual para leer y descargar libros, documentos, trabajos y tesis universitarias en PDF. Material universiario, documentación y tareas realizadas por universitarios en nuestra biblioteca. Para descargar gratis y para leer online.
Immunization by a large molecular assembly, such as the TP901-1 baseplate, proved to be an efficient technique to obtain nanobodies against the exposed surface of the various molecular components of the complex to evaluate the effect of binding on infectivity. Although the three components of the baseplate were targeted, BppU and BppL dominated the immunological response, with some epitopes being clearly favored. The head domain of BppL and its saccharide binding groove were targeted by two TP901-1-neutralizing-strongly binding-nanobodies. This groove was also found to be the epitope of a nanobody-neutralizing (VHH5) phage p2 (14, 15, 24, 26). This groove-directed mode of binding is a characteristic of nanobodies, because this mode has also been observed on several occasions for catalytic crevices of enzymes (22, 34, 35). Noteworthy, nanobodies are distinctly different from DARPINs, because this latter family of artificial binders binds preferentially to flat or convex surfaces. We observed this ...
HD Movies 2017 | Full Movie Online | Watch Online.WATCH FULL MOVIE 2017 ONLINE HD STREAMING ONLINE.Liar Liar02:16:00 Download Liar Liar
Putative Protein Of Unknown Function; Green Fluorescent Protein (GFP)-fusion Protein Localizes To The Cytoplasm And Nucleus; Contains Ankyrin (Ank) Repeats; YCR051W Is Not An Essential Gene
Explore the structures and analogues of ASB · Asymbescaline · 3,4-Diethoxy-5-methoxyphenethylamine in book II of TiHKAL: The Continuation. Alexander & Ann Shulgin
Find and save ideas about Bläschen on Pinterest. | See more ideas about Die geburt eines kindes, Zwillingsbabys and 2. Schwangerschaft Ankündigungen.
The Bromodomain as the Acetyl-Lysine Binding Domain in Gene Transcription -- PHD Fingers as Histone Readers -- Methyl-Lysine Recognition by the Royal Family Modules: Chromo, Tudor, MBT, Chromo Barrel, and PWWP Domains -- Histone Recognition by WD40 Proteins -- Methyl-Lys Recognition by Ankyrin Repeat Proteins -- Methyl-Arginine Recognition by Tudor Domains -- Histone Recognition by Tandem Modules and Modulation by Multiple PTMs -- Genome-Wide Profiling of Molecular Recognition of Histone PTMs -- BET Bromodomain Inhibition as a Therapeutic Approach in Hematological Malignancies -- Anti-Inflammatory Effects of BET Protein Inhibition Through Modulation of Gene Transcription -- Activating Latent HIV by Inhibiting Bromodomain Proteins -- Small Molecule Modulation of Methyl-Lysine Mediated Interactions. This book provides a timely review of the role of histone modifications in epigenetic control of gene expression. Topics covered include: basic mechanisms of molecular recognition of histone ...
This new class of molecules opens the door for transforming new drug formats.. Molecular Partners has established a robust platform to discover and develop DARPin-based product candidates targeting indications in ophthalmology, oncology and immunology. The most advanced DARPin product candidate, called abicipar pegol, is out-licensed to Allergan and is expected to enter Phase III clinical studies for the treatment of wet age-related macular degeneration in the second quarter of 2015 and is currently in Phase II clinical development for the treatment of diabetic macular edema. The other DARPin product candidates in the pipeline are currently being developed by Molecular Partners either on its own or together with renowned pharmaceutical companies through strategic partnerships.. Molecular Partners has the exclusive license to develop DARPin-based product candidates. The vision of Molecular Partners is to pioneer the development of DARPins to create multi-benefit therapeutics transforming the ...
Resident and inflammatory mononuclear phagocytes (MPhs) with functional plasticity in the intestine are critically involved in the pathology of inflammatory bowel diseases (IBDs), the mechanism of which remains incompletely understood. In the present study, we found that increased expression of the E3 ligase F-box and WD repeat domain-containing 7 (FBXW) in the inflamed intestine was significantly correlated with IBD severity in both human diseases and in mouse models. Myeloid Fbxw7 deficiency protected mice from colitis induced by dextran sodium sulfate (DSS) or 2,6,4-trinitrobenzene sulfonic acid (TNBS). Fbxw7 deficiency resulted in decreased production of the chemokines CCL2 and CCL7 by colonic CX3CR1hi resident macrophages and reduced the accumulation of CX3CR1int proinflammatory MPhs in colitis-affected colon tissue. Mice that received adeno-associated virus-shFbxw7 (AAV-shFbxw7) showed significantly improved survival rates and alleviation of colitis. Mechanism screening demonstrated that ...
Resident and inflammatory mononuclear phagocytes (MPhs) with functional plasticity in the intestine are critically involved in the pathology of inflammatory bowel diseases (IBDs), the mechanism of which remains incompletely understood. In the present study, we found that increased expression of the E3 ligase F-box and WD repeat domain-containing 7 (FBXW) in the inflamed intestine was significantly correlated with IBD severity in both human diseases and in mouse models. Myeloid Fbxw7 deficiency protected mice from colitis induced by dextran sodium sulfate (DSS) or 2,6,4-trinitrobenzene sulfonic acid (TNBS). Fbxw7 deficiency resulted in decreased production of the chemokines CCL2 and CCL7 by colonic CX3CR1hi resident macrophages and reduced the accumulation of CX3CR1int proinflammatory MPhs in colitis-affected colon tissue. Mice that received adeno-associated virus-shFbxw7 (AAV-shFbxw7) showed significantly improved survival rates and alleviation of colitis. Mechanism screening demonstrated that ...
Our results from TANC overexpression experiments indicate that TANC proteins are important for dendritic spines and excitatory synapses. This conclusion is further supported by the reduction in spine density in the hippocampal CA3 region of TANC1−/− mice. How might the maintenance of dendritic spines and excitatory synapses by TANC1 and TANC2 be regulated?. First, our results indicate that TANC-dependent spine/synapse maintenance requires TANC binding to PSD-95, which promotes synaptic localization of TANC proteins. Thus, it is likely that interaction with PSD-95 concentrates TANC proteins at synapses, where they play a role in mediating PSD-95-dependent maintenance of spines and synapses. Second, from a functional perspective, synaptically translocated TANC proteins may function as a scaffold or adaptor for synaptic signaling by virtue of the presence of several domains for protein-protein interactions, including ankyrin repeats, TPRs, a coiled-coil domain, and a C-terminal PDZ-binding ...
This gene encodes a protein which interacts with the N-terminal region of BRCA1. In addition to its ability to bind BRCA1 in vivo and in vitro, it shares homology with the 2 most conserved regions of BRCA1: the N-terminal RING motif and the C-terminal BRCT domain. The RING motif is a cysteine-rich sequence found in a variety of proteins that regulate cell growth, including the products of tumor suppressor genes and dominant protooncogenes. This protein also contains 3 tandem ankyrin repeats. The BARD1/BRCA1 interaction is disrupted by tumorigenic amino acid substitutions in BRCA1, implying that the formation of a stable complex between these proteins may be an essential aspect of BRCA1 tumor suppression. This protein may be the target of oncogenic mutations in breast or ovarian cancer. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2013] ...
Using shRNA mediated knockdown in primary erythroblasts prior to terminal erythroid differentiation we have demonstrated the ability to deplete ankyrin-R expression by up to 95% generating an effective novel near null reticulocyte phenotype. As would be predicted, the reduction of ankyrin expression predominantly impacts the surface expression of membrane proteins assigned to the band 3 tetramer based erythrocyte multiprotein complex. The greatest impact of ankyrin deficiency is not on band 3 itself, however, but on the stability of the Rhesus protein sub complex (RhAG, Rh in particular), whether mediated by shRNA or by natural ankyrin genetic mutations. Importantly, reduced surface expression of the core Rh subcomplex components Rh and RhAG precedes the loss of the more extensively studied ankyrin binding protein band 3. We also demonstrate that absence of ankyrin during erythropoiesis abrogates the ability of band 3 to form the larger of two band 3-containing macrocomplexes (likely the band 3 ...
Affinity proteins are invaluable tools in biotechnological and medical applications. This thesis is about combinatorial protein engineering principles for the generation of novel affinity proteins to purify mouse immunoglobulin, detect a potential cancer marker protein or inhibit a cell proliferation pathway.. In a first study, ribosome display was for the first time applied to the selection of so-called affibody molecules, including the design of a ribosome display gene cassette, initial test enrichment experiments and the selection of binders against murine IgG1. One of the selected binders (ZMAB25) showed a highly selective binding profile to murine IgG1, which was exploited in the recovery of two different mouse monoclonal IgG1 antibodies from a bovine immunoglobulin-containing background. Ribosome display was further applied to the selection of affibody molecules binding to SATB1, a suggested marker protein for metastasizing adenocarcinoma. The study also included the selection of VHH ...
Expression of RFXANK (ANKRA1, BLS, F14150_1, MGC138628, RFX-B) in urinary bladder tissue. Antibody staining with HPA049157 in immunohistochemistry.
Jancsó, G., Arató, E., Hardi, P., Nagy, T., Pintér, Fazekas, G., Gasz, B., Takacs, I., Menyhei, G., Kollar, L. & Sínay, L., 2016, In : Clinical Hemorheology and Microcirculation. 63, 3, p. 217-234 18 p.. Research output: Article ...
Dokken - Liar Lyrics. Dokken Back In The Streets Liar (dokken) Liar Deceiver Mistreater You, you are the one i wanna know Oh, i gotta go I gotta get
WDR85 Full-Length MS Protein Standard (NP_620133), Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine, was produced in human 293 cells (HEK293) with fully chemically defined cell culture medium to obtain incorporation efficiency at Creative-Proteomics. WDR85 is a WD repeat-containing protein that plays a role in the first step of diphthamide biosynthesis (Carette et al., 2009 )
Spectrin and ankyrin are two essential proteins acting like bricks and...Ron Dubreuil associate professor of biological sciences at the Univer...Spectrin was first discovered in red blood cells where it forms a pro...Dubreuil and his UIC co-workers have spent a decade looking at differe... In our study we showed spectrin doesnt have to bind to ankyrin to d...,Ghost,protein,leaves,fresh,tracks,in,the,cell,biological,biology news articles,biology news today,latest biology news,current biology news,biology newsletters
Multiple sclerosis (MS) is a genetically complex disease that shares a substantial proportion of risk loci with other autoimmune diseases.1 Along these lines, ANKRD55, originally implicated in rheumatoid arthritis, was recently reported as a potential novel MS risk gene (rs6859219, p=1.9×10−7).2 Here, we comprehensively validated this effect in independent datasets comprising 8846 newly genotyped subjects from Germany and France as well as 5003 subjects from two genome-wide association studies (GWAS). Upon meta-analysis of all available data (19 686 subjects), ANKRD55 rs6859219 now shows compelling evidence for association with MS at genome-wide significance (OR=1.19, p=3.1×10−11). Our study adds ANKRD55 to the list of established MS risk loci and extends previous evidence suggesting an overlapping genetic foundation across autoimmune diseases.. Ankyrin repeats are abundant in a large number of different proteins in humans and mediate protein-protein interactions. DNA-sequence variants in ...
Major histocompatibility (MHC) class II molecules are transmembrane proteins that have a central role in development and control of the immune system. The protein encoded by this gene, along with regulatory factor X-associated protein and regulatory factor-5, forms a complex that binds to the X box motif of certain MHC class II gene promoters and activates their transcription. Once bound to the promoter, this complex associates with the non-DNA-binding factor MHC class II transactivator, which controls the cell type specificity and inducibility of MHC class II gene expression. This protein contains ankyrin repeats involved in protein-protein interactions. Mutations in this gene have been linked to bare lymphocyte syndrome type II, complementation group B. Two transcript variants encoding different isoforms have been described for this gene, with only one isoform showing activation activity.[7]. ...
This article outlines the need for a homeostatic response to alterations in cellular oxygenation. It describes work on erythropoietin control that led to the discovery of the hypoxia-inducible transcription factor (HIF-1) and the parallel recognition that this system was responsive to a widespread oxygen-sensing mechanism. Subsequently, multiple HIF isoforms have been shown to have overlapping but non-redundant functions, controlling expression of genes involved in diverse processes such as angiogenesis, vascular tone, metal transport, glycolysis, mitochondrial function, cell growth and survival. The major role of prolyl and asparaginyl hydroxylation in regulating HIFs is described, as well as the identification of PHD1-3 and FIH as the oxygen-sensing enzymes responsible for these hydroxylations. Current understanding of other processes that modulate overall HIF activity, including influences from other signalling mechanisms such as kinases and nitric oxide levels, and the existence of a variety of
Abstract: Rickettsia felis has been recently cultured in XTC2 cells. This allows production of enough bacteria to create a genomic bank and to sequence it. The chromosome of R. felis is longer than that of previously sequenced rickettsiae and it possess 2 plasmids. Microscopically, this bacterium exhibits two forms of pili: one resembles a conjugative pilus and another forms hair-like projections that may play a role in pathogenicity. R. felis also exhibits several copies of ankyrin-repeat genes and tetratricopeptide encoding gene that are specifically linked to pathogenic host-associated bacteria. It also contains toxin-antitoxin system encoding genes that are extremely rare in intracellular bacteria and may be linked to plasmid maintenance. ...

Ankyrin repeat (IPR002110) | InterPro | EMBL-EBIAnkyrin repeat (IPR002110) | InterPro | EMBL-EBI

Ankyrin repeat (IPR002110). Short name: Ankyrin_rpt Description. The ankyrin repeat is one of the most common protein-protein ... Ankyrin repeats are tandemly repeated modules of about 33 amino acids. They occur in a large number of functionally diverse ... Hundreds of ankyrin-like repeats in functionally diverse proteins: mobile modules that cross phyla horizontally?. Proteins 17 ... Consensus-derived structural determinants of the ankyrin repeat motif.. Proc. Natl. Acad. Sci. U.S.A. 99 16029-34 2002 ...
more infohttp://www.ebi.ac.uk/interpro/entry/IPR002110

Ankyrin repeat-containing domain superfamily (IPR036770) | InterPro | EMBL-EBIAnkyrin repeat-containing domain superfamily (IPR036770) | InterPro | EMBL-EBI

Ankyrin repeat and death domain-containing protein 1A/1B (IPR039194). *Ankyrin repeat domain-containing protein 60 (IPR039323) ... The ankyrin repeat is one of the most common protein-protein interaction motifs in nature. Ankyrin repeats are tandemly ... Ankyrin repeat-containing domain superfamily (IPR036770). Short name: Ankyrin_rpt-contain_sf ... This entry represents the ankyrin repeat-containing domain. These domains contain multiple repeats of a beta(2)-alpha(2) motif ...
more infohttp://www.ebi.ac.uk/interpro/entry/IPR036770

Ankyrin Repeat - Medical Dictionary online-medical-dictionary.orgAnkyrin Repeat - Medical Dictionary online-medical-dictionary.org

Ankyrin Repeat. Protein Motif that contains a 33-amino acid long sequence that often occurs in tandem arrays. This repeating ... Ankyrin repeats cooperatively fold into domains that mediate molecular recognition via protein-protein interactions. ... sequence of 33-Amino Acids was discovered in Ankyrin where it is involved in interaction with the anion exchanger (Anion ...
more infohttp://www.online-medical-dictionary.org/definitions-a/ankyrin-repeat.html

Analyses of Physcomitrella patens Ankyrin Repeat Proteins by Computational ApproachAnalyses of Physcomitrella patens Ankyrin Repeat Proteins by Computational Approach

... Niaz Mahmood1 and Nahid Tamanna2 ... Ankyrin (ANK) repeat containing proteins are evolutionary conserved and have functions in crucial cellular processes like cell ...
more infohttps://www.hindawi.com/journals/mbi/2016/9156735/abs/

Ankyrin repeat domain 29 ELISA Kits | Biocompare.comAnkyrin repeat domain 29 ELISA Kits | Biocompare.com

Compare Ankyrin repeat domain 29 ELISA Kits from leading suppliers on Biocompare. View specifications, prices, citations, ... Ankyrin repeat domain 29 ELISA Kits. The ELISA (enzyme-linked immunosorbent assay) is a well-established antibody-based tool ... Your search returned 13 Ankyrin repeat domain 29 ELISA ELISA Kit across 1 supplier. ...
more infohttps://www.biocompare.com/pfu/110627/soids/2-321282/ELISA_Kit/ELISA_Ankyrin_repeat_domain_29

Ankyrin repeat domain 12 ELISA Kits | Biocompare.comAnkyrin repeat domain 12 ELISA Kits | Biocompare.com

Compare Ankyrin repeat domain 12 ELISA Kits from leading suppliers on Biocompare. View specifications, prices, citations, ... Ankyrin repeat domain 12 ELISA Kits. The ELISA (enzyme-linked immunosorbent assay) is a well-established antibody-based tool ... Your search returned 20 Ankyrin repeat domain 12 ELISA ELISA Kit across 5 suppliers. ...
more infohttps://www.biocompare.com/pfu/110627/soids/2-27276/Assay_Kit/ELISA_Ankyrin_repeat_domain_12

Ankyrin repeat | definition of ankyrin repeat by Medical dictionaryAnkyrin repeat | definition of ankyrin repeat by Medical dictionary

... ankyrin repeat explanation free. What is ankyrin repeat? Meaning of ankyrin repeat medical term. What does ankyrin repeat mean? ... Looking for online definition of ankyrin repeat in the Medical Dictionary? ... ankyrin repeat. Also found in: Wikipedia. ankyrin repeat. A short repetitive sequence of amino acids consisting of a beta ... The beta strands on adjacent ankyrin repeats combine to form a short antiparallel beta sheet. Ankyrin repeats were first ...
more infohttp://medical-dictionary.thefreedictionary.com/Ankyrin+repeat

Ankrd13c (ankyrin repeat domain 13c) - Rat Genome DatabaseAnkrd13c (ankyrin repeat domain 13c) - Rat Genome Database

Sus scrofa (pig) : ANKRD13C (ankyrin repeat domain 13C) Chlorocebus sabaeus (green monkey) : ANKRD13C (ankyrin repeat domain ... ankyrin repeat domain 13C) HGNC Alliance Rattus norvegicus (Norway rat) : Ankrd13c (ankyrin repeat domain 13C) Alliance ... ankyrin repeat domain 13C) Pan paniscus (bonobo/pygmy chimpanzee) : ANKRD13C (ankyrin repeat domain 13C) Canis lupus familiaris ... ankyrin repeat domain 13C) Ictidomys tridecemlineatus (thirteen-lined ground squirrel) : Ankrd13c (ankyrin repeat domain 13C) ...
more infohttps://rgd.mcw.edu/rgdweb/report/gene/main.html?id=1617912

SOWAHD sosondowah ankyrin repeat domain family member D [Homo sapiens (human)] - Gene - NCBISOWAHD sosondowah ankyrin repeat domain family member D [Homo sapiens (human)] - Gene - NCBI

ankyrin repeat domain-containing protein SOWAHD. Names. ankyrin repeat domain 58. ankyrin repeat domain-containing protein 58. ... SOWAHD sosondowah ankyrin repeat domain family member D [Homo sapiens] SOWAHD sosondowah ankyrin repeat domain family member D ... ANK; ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins. The number of ... Ank_2; Ankyrin repeats (3 copies). sd00045. Location:148 → 184. ANK; ANK repeat [structural motif]. ...
more infohttps://www.ncbi.nlm.nih.gov/gene/347454

ankyrin repeat and MYND domain-containing protein 2 [Mus musculus] - Protein - NCBIankyrin repeat and MYND domain-containing protein 2 [Mus musculus] - Protein - NCBI

ankyrin repeat and MYND domain-containing protein 2 [Mus musculus] ankyrin repeat and MYND domain-containing protein 2 [Mus ... ankyrin repeat and MYND domain-containing protein 2 [Mus musculus]. NCBI Reference Sequence: NP_666145.3 ...
more infohttps://www.ncbi.nlm.nih.gov/protein/NP_666145.3

High-Resolution Crystallographic Analysis of AcrB Using Designed Ankyrin Repeat Proteins (DARPins) | SpringerLinkHigh-Resolution Crystallographic Analysis of AcrB Using Designed Ankyrin Repeat Proteins (DARPins) | SpringerLink

Tam H.K., Malviya V.N., Pos K.M. (2018) High-Resolution Crystallographic Analysis of AcrB Using Designed Ankyrin Repeat ... High-Resolution Crystallographic Analysis of AcrB Using Designed Ankyrin Repeat Proteins (DARPins). ... High-affinity binders selected from designed ankyrin repeat protein libraries. Nat Biotechnol 22:575-582CrossRefPubMedGoogle ... soluble and stable proteins from combinatorial libraries of consensus ankyrin repeat proteins. J Mol Biol 332:489-503CrossRef ...
more infohttps://link.springer.com/protocol/10.1007%2F978-1-4939-7454-2_1

Sequence Similarity 









- 1SW6: S. CEREVISIAE SWI6 ANKYRIN-REPEAT FRAGMENT Sequence Similarity Report PageSequence Similarity - 1SW6: S. CEREVISIAE SWI6 ANKYRIN-REPEAT FRAGMENT Sequence Similarity Report Page

X-ray structural analysis of the yeast cell cycle regulator Swi6 reveals variations of the ankyrin fold and has implications ...
more infohttps://www.rcsb.org/pdb/explore/sequenceCluster.do?structureId=1SW6

Ankyrin repeat - WikipediaAnkyrin repeat - Wikipedia

Ankyrin repeats typically fold together to form a single, linear solenoid structure called ankyrin repeat domains. These ... designed ankyrin repeat protein), an engineered antibody mimetic based on the structure of ankyrin repeats PDB: 1N11​; Michaely ... A specialized family of ankyrin proteins known as muscle ankyrin repeat proteins (MARPs) are involved with the repair and ... Ankyrin repeats, by contrast, contain very few such contacts (that is, they have a low contact order). Most studies have found ...
more infohttps://en.wikipedia.org/wiki/Ankyrin_repeat

TVAG 224290 - Ankyrin repeat protein, putative - Trichomonas vaginalis - TVAG 224290 gene & proteinTVAG 224290 - Ankyrin repeat protein, putative - Trichomonas vaginalis - TVAG 224290 gene & protein

IPR002110. Ankyrin_rpt. IPR020683. Ankyrin_rpt-contain_dom. IPR036770. Ankyrin_rpt-contain_sf. ... IPR002110. Ankyrin_rpt. IPR020683. Ankyrin_rpt-contain_dom. IPR036770. Ankyrin_rpt-contain_sf. ... Ankyrin repeat protein, putativeImported. ,p>Information which has been imported from another database using automatic ... tr,A2DW52,A2DW52_TRIVA Ankyrin repeat protein, putative OS=Trichomonas vaginalis GN=TVAG_224290 PE=4 SV=1 ...
more infohttp://www.uniprot.org/uniprot/A2DW52

Fragment-based screening identifies molecules targeting the substrate-binding ankyrin repeat domains of tankyrase | Scientific...Fragment-based screening identifies molecules targeting the substrate-binding ankyrin repeat domains of tankyrase | Scientific...

... uses its ankyrin repeat clusters (ARCs) to bind a wide range of proteins and thereby controls diverse cellular functions. A ... Tankyrase-1 Ankyrin Repeats Form an Adaptable Binding Platform for Targets of ADP-Ribose Modification. Structure 24, 1679-1692 ... The PARP enzyme and scaffolding protein tankyrase (TNKS, TNKS2) uses its ankyrin repeat clusters (ARCs) to bind a wide range of ... Tankyrase contains five N-terminal ankyrin repeat clusters (ARCs), four of which, namely ARCs 1, 2, 4 and 5, can recruit ...
more infohttps://www.nature.com/articles/s41598-019-55240-5?error=cookies_not_supported&code=98a664ae-42ad-4f6e-b364-9adecec25a5f

ANKRD34C - Ankyrin repeat domain-containing protein 34C - Homo sapiens (Human) - ANKRD34C gene & proteinANKRD34C - Ankyrin repeat domain-containing protein 34C - Homo sapiens (Human) - ANKRD34C gene & protein

IPR002110 Ankyrin_rpt. IPR020683 Ankyrin_rpt-contain_dom. IPR036770 Ankyrin_rpt-contain_sf. ... IPR002110 Ankyrin_rpt. IPR020683 Ankyrin_rpt-contain_dom. IPR036770 Ankyrin_rpt-contain_sf. ... Ankyrin repeat domain-containing protein 34CAdd BLAST. 535. Amino acid modifications. Feature key. Position(s). Description ... sp,P0C6C1,AN34C_HUMAN Ankyrin repeat domain-containing protein 34C OS=Homo sapiens OX=9606 GN=ANKRD34C PE=3 SV=2 ...
more infohttps://www.uniprot.org/uniprot/P0C6C1

Ankrd2 (ankyrin repeat domain 2 (stretch responsive muscle)) - Rat Genome DatabaseAnkrd2 (ankyrin repeat domain 2 (stretch responsive muscle)) - Rat Genome Database

Homo sapiens (human) : ANKRD2 (ankyrin repeat domain 2) HGNC Alliance Rattus norvegicus (Norway rat) : Ankrd2 (ankyrin repeat ... Pan paniscus (bonobo/pygmy chimpanzee) : ANKRD2 (ankyrin repeat domain 2) Canis lupus familiaris (dog) : ANKRD2 (ankyrin repeat ... ankyrin repeat domain-containing protein 2; Arpp; mArpp; skeletal muscle ankyrin repeat protein. ... ANKRD2 (ankyrin repeat domain 2). Transitive Ortholog Pipeline. Transitive Ortholog Pipeline. Canis lupus familiaris (dog):. ...
more infohttps://rgd.mcw.edu/rgdweb/report/gene/main.html?id=1312940

ANKS3 (ankyrin repeat and sterile alpha motif domain containing 3)ANKS3 (ankyrin repeat and sterile alpha motif domain containing 3)

... ankyrin repeat and sterile alpha motif domain containing 3), Authors: Dessen P. Published in: Atlas Genet Cytogenet Oncol ...
more infohttp://atlasgeneticsoncology.org/Genes/GC_ANKS3.html

KRIT1, Ankyrin Repeat Containing ELISA & Assay KitsKRIT1, Ankyrin Repeat Containing ELISA & Assay Kits

Compare and order KRIT1, Ankyrin Repeat Containing ELISA Kits. View citations, images, detection ranges, sensitivity, prices ... More product categories related to KRIT1, Ankyrin Repeat Containing ELISA Kit * 49 anti-KRIT1, Ankyrin Repeat Containing ... KRIT1, Ankyrin Repeat Containing ELISA Kit. 4 products by 2 suppliers: Wuhan Fine biotech , Cloud-Clone ... This gene encodes a protein containing four ankyrin repeats, a band 4.1/ezrin/radixin/moesin (FERM) domain, and multiple NPXY ...
more infohttps://www.antibodies-online.com/cell-redoxhomeostasis-pathway-96/krit1-elisa-kit-23171/

Ankyrin-repeat, SH3-domain, and Proline-rich-region containing ProteinAnkyrin-repeat, SH3-domain, and Proline-rich-region containing Protein

... : Biological Overview , References Gene name - Ankyrin- ... Classification - Ankyrin-repeat, SH3-domain, and Proline-rich-region Cellular location - cytoplasmic ... dASPP is the homolog of mammalian ASPP1 and -2 (Ankyrin-repeat, SH3-domain and Proline-rich-region containing Protein). ASPP1 ... Drosophila Ankyrin-repeat, SH3-domain, and Proline-rich-region containing Protein (dASPP) has been identified as a regulator of ...
more infohttp://www.sdbonline.org/sites/fly/genebrief/aspp.htm

ANKRD54 (ankyrin repeat domain 54) - KOMP (Knockout Mouse Project)ANKRD54 (ankyrin repeat domain 54) - KOMP (Knockout Mouse Project)

ankyrin repeat domain 54. Synonyms: C730048E16Rik, EST1068184, EST475269, Liar, Mus EST 1068184, Mus EST 475269. Gene ...
more infohttps://www.komp.org/geneinfo.php?geneid=23354

ANKRD60 (ankyrin repeat domain 60) - KOMP (Knockout Mouse Project)ANKRD60 (ankyrin repeat domain 60) - KOMP (Knockout Mouse Project)

ankyrin repeat domain 60. Synonyms: 1700019A24Rik, 1700030G11Rik. Gene nomenclature, locus information, and GO, OMIM, and PMID ...
more infohttps://www.komp.org/geneinfo.php?geneid=2806

ACAP3 (ArfGAP with coiled-coil, ankyrin repeat and PH domains 3)ACAP3 (ArfGAP with coiled-coil, ankyrin repeat and PH domains 3)

... ankyrin repeat and PH domains 3), Authors: Dessen P. Published in: Atlas Genet Cytogenet Oncol Haematol. ... AH/BAR-dom Ankyrin_rpt Ankyrin_rpt-contain_dom ArfGAP PH_dom-like PH_domain ... ACAP3 116983 ArfGAP with coiled-coil, ankyrin repeat and PH domains 3. ... ANK_REP_REGION (PS50297) ANK_REPEAT (PS50088) ARFGAP (PS50115) PH_DOMAIN (PS50003) ...
more infohttp://atlasgeneticsoncology.org/Genes/GC_ACAP3.html

Ankyrin repeat domain 3 | definition of ankyrin repeat domain 3 by Medical dictionaryAnkyrin repeat domain 3 | definition of ankyrin repeat domain 3 by Medical dictionary

What is ankyrin repeat domain 3? Meaning of ankyrin repeat domain 3 medical term. What does ankyrin repeat domain 3 mean? ... Looking for online definition of ankyrin repeat domain 3 in the Medical Dictionary? ankyrin repeat domain 3 explanation free. ... Ankyrin repeat domain 3 , definition of ankyrin repeat domain 3 by Medical dictionary https://medical-dictionary. ... redirected from ankyrin repeat domain 3) RIPK4. A gene on chromosome 21q22.3 that encodes a serine/threonine/ tyrosine kinase, ...
more infohttp://medical-dictionary.thefreedictionary.com/ankyrin+repeat+domain+3
  • The repeats stack together to form an L-shaped structure [ PMID: 8875926 , PMID: 12461176 ]. (ebi.ac.uk)
  • Each repeat folds into a helix-loop-helix structure with a beta-hairpin/loop region projecting out from the helices at a 90 o angle. (ebi.ac.uk)
  • The beta strands on adjacent ankyrin repeats combine to form a short antiparallel beta sheet. (thefreedictionary.com)