A species of gram-negative bacteria and causative agent of severe bovine ANAPLASMOSIS. It is the most pathogenic of the ANAPLASMA species.
A genus of gram-negative bacteria whose organisms are obligate parasites of vertebrates. Species are transmitted by arthropod vectors with the host range limited to ruminants. Anaplasma marginale is the most pathogenic species and is the causative agent of severe bovine anaplasmosis.
A disease of cattle caused by parasitization of the red blood cells by bacteria of the genus ANAPLASMA.
A species of gram-negative bacteria in the genus ANAPLASMA, family ANAPLASMATACEAE, formerly called Ehrlichia phagocytophila or Ehrlichia equi. This organism is tick-borne (IXODES) and causes disease in horses and sheep. In humans, it causes human granulocytic EHRLICHIOSIS.
A widely distributed genus of TICKS, in the family IXODIDAE, including a number that infest humans and other mammals. Several are vectors of diseases such as TULAREMIA; ROCKY MOUNTAIN SPOTTED FEVER; COLORADO TICK FEVER; and ANAPLASMOSIS.
A species of gram-negative bacteria causing mild ANAPLASMOSIS in CATTLE. It also can infect SHEEP and GOATS. It is transmitted by TICKS.
Blood-sucking acarid parasites of the order Ixodida comprising two families: the softbacked ticks (ARGASIDAE) and hardbacked ticks (IXODIDAE). Ticks are larger than their relatives, the MITES. They penetrate the skin of their host by means of highly specialized, hooked mouth parts and feed on its blood. Ticks attack all groups of terrestrial vertebrates. In humans they are responsible for many TICK-BORNE DISEASES, including the transmission of ROCKY MOUNTAIN SPOTTED FEVER; TULAREMIA; BABESIOSIS; AFRICAN SWINE FEVER; and RELAPSING FEVER. (From Barnes, Invertebrate Zoology, 5th ed, pp543-44)
Diseases of domestic cattle of the genus Bos. It includes diseases of cows, yaks, and zebus.
Proteins isolated from the outer membrane of Gram-negative bacteria.
A tick-borne disease characterized by FEVER; HEADACHE; myalgias; ANOREXIA; and occasionally RASH. It is caused by several bacterial species and can produce disease in DOGS; CATTLE; SHEEP; GOATS; HORSES; and humans. The primary species causing human disease are EHRLICHIA CHAFFEENSIS; ANAPLASMA PHAGOCYTOPHILUM; and Ehrlichia ewingii.
Domesticated bovine animals of the genus Bos, usually kept on a farm or ranch and used for the production of meat or dairy products or for heavy labor.
Members of the class Arachnida, especially SPIDERS; SCORPIONS; MITES; and TICKS; which transmit infective organisms from one host to another or from an inanimate reservoir to an animate host.
Bacterial, viral, or parasitic diseases transmitted to humans and animals by the bite of infected ticks. The families Ixodidae and Argasidae contain many bloodsucking species that are important pests of man and domestic birds and mammals and probably exceed all other arthropods in the number and variety of disease agents they transmit. Many of the tick-borne diseases are zoonotic.
A genus of TICKS, in the family IXODIDAE, widespread in Africa. Members of the genus include many important vectors of animal and human pathogens.
Substances elaborated by bacteria that have antigenic activity.
A species of gram-negative bacteria producing mild to severe ANAPLASMOSIS in SHEEP and GOATS, and mild or inapparent infections in DEER and CATTLE.
Arthropods, other than insects and arachnids, which transmit infective organisms from one host to another or from an inanimate reservoir to an animate host.
A family of bacteria which inhabit RED BLOOD CELLS and cause several animal diseases.
Small, often pleomorphic, coccoid to ellipsoidal organisms occurring intracytoplasmically in circulating LYMPHOCYTES. They are the etiologic agents of tick-borne diseases of humans; DOGS; CATTLE; SHEEP; GOATS; and HORSES.
Glands that secrete SALIVA in the MOUTH. There are three pairs of salivary glands (PAROTID GLAND; SUBLINGUAL GLAND; SUBMANDIBULAR GLAND).
A species of gram-negative bacteria in the family ANAPLASMATACEAE, that causes HEARTWATER DISEASE in ruminants.
Suspensions of attenuated or killed bacteria administered for the prevention or treatment of infectious bacterial disease.
A species of protozoa that is a cause of bovine babesiosis. Ticks of the genera Boophilus, Rhipicephalus, and IXODES are the chief vectors.
The largest genus of TICKS in the family IXODIDAE, containing over 200 species. Many infest humans and other mammals and several are vectors of diseases such as LYME DISEASE, tick-borne encephalitis (ENCEPHALITIS, TICK-BORNE), and KYASANUR FOREST DISEASE.
A genus of tick-borne protozoan parasites that infests the red blood cells of mammals, including humans. There are many recognized species, and the distribution is world-wide.
Change in the surface ANTIGEN of a microorganism. There are two different types. One is a phenomenon, especially associated with INFLUENZA VIRUSES, where they undergo spontaneous variation both as slow antigenic drift and sudden emergence of new strains (antigenic shift). The second type is when certain PARASITES, especially trypanosomes, PLASMODIUM, and BORRELIA, survive the immune response of the host by changing the surface coat (antigen switching). (From Herbert et al., The Dictionary of Immunology, 4th ed)
Immunoglobulins produced in a response to BACTERIAL ANTIGENS.
A group of tick-borne diseases of mammals including ZOONOSES in humans. They are caused by protozoa of the genus BABESIA, which parasitize erythrocytes, producing hemolysis. In the U.S., the organism's natural host is mice and transmission is by the deer tick IXODES SCAPULARIS.
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
Vaccines for the prevention of diseases caused by various species of Rickettsia.
Proteins found in any species of bacterium.
Infestations with soft-bodied (Argasidae) or hard-bodied (Ixodidae) ticks.
Infection of cattle, sheep, or goats with protozoa of the genus THEILERIA. This infection results in an acute or chronic febrile condition.
Red blood cells. Mature erythrocytes are non-nucleated, biconcave disks containing HEMOGLOBIN whose function is to transport OXYGEN.
The presence of viable bacteria circulating in the blood. Fever, chills, tachycardia, and tachypnea are common acute manifestations of bacteremia. The majority of cases are seen in already hospitalized patients, most of whom have underlying diseases or procedures which render their bloodstreams susceptible to invasion.
Deoxyribonucleic acid that makes up the genetic material of bacteria.
Infections with bacteria of the family ANAPLASMATACEAE.
The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.
Constituent of 30S subunit prokaryotic ribosomes containing 1600 nucleotides and 21 proteins. 16S rRNA is involved in initiation of polypeptide synthesis.
A multistage process that includes cloning, physical mapping, subcloning, determination of the DNA SEQUENCE, and information analysis.
Subunits of the antigenic determinant that are most easily recognized by the immune system and thus most influence the specificity of the induced antibody.
In vitro method for producing large amounts of specific DNA or RNA fragments of defined length and sequence from small amounts of short oligonucleotide flanking sequences (primers). The essential steps include thermal denaturation of the double-stranded target molecules, annealing of the primers to their complementary sequences, and extension of the annealed primers by enzymatic synthesis with DNA polymerase. The reaction is efficient, specific, and extremely sensitive. Uses for the reaction include disease diagnosis, detection of difficult-to-isolate pathogens, mutation analysis, genetic testing, DNA sequencing, and analyzing evolutionary relationships.
The sequence of PURINES and PYRIMIDINES in nucleic acids and polynucleotides. It is also called nucleotide sequence.
The outer covering of the body composed of the SKIN and the skin appendages, which are the HAIR, the NAILS; and the SEBACEOUS GLANDS and the SWEAT GLANDS and their ducts.
The properties and relationships and biological processes that characterize the nature and function of the SKIN and its appendages.
A species of tick (TICKS) in the family IXODIDAE, distributed throughout the world but abundant in southern Europe. It will feed on a wide variety of MAMMALS, but DOGS are its preferred host. It transmits a large number of diseases including BABESIOSIS; THEILERIASIS; EHRLICHIOSIS; and MEDITERRANEAN SPOTTED FEVER.
The medical science concerned with the prevention, diagnosis, and treatment of diseases in animals.
Chemical, biological, or medical measures designed to prevent the spread of ticks or the concomitant infestations which result in tick-borne diseases. It includes the veterinary as well as the public health aspects of tick and mite control.

Antigens and alternatives for control of Anaplasma marginale infection in cattle. (1/95)

Anaplasmosis, a tick-borne cattle disease caused by the rickettsia Anaplasma marginale, is endemic in tropical and subtropical areas of the world. The disease causes considerable economic loss to both the dairy and beef industries worldwide. Analyses of 16S rRNA, groESL, and surface proteins have resulted in the recent reclassification of the order Rickettsiales. The genus Anaplasma, of which A. marginale is the type species, now also includes A. bovis, A. platys, and A. phagocytophilum, which were previously known as Ehrlichia bovis, E. platys, and the E. phagocytophila group (which causes human granulocytic ehrlichiosis), respectively. Live and killed vaccines have been used for control of anaplasmosis, and both types of vaccines have advantages and disadvantages. These vaccines have been effective in preventing clinical anaplasmosis in cattle but have not blocked A. marginale infection. Thus, persistently infected cattle serve as a reservoir of infective blood for both mechanical transmission and infection of ticks. Advances in biochemical, immunologic, and molecular technologies during the last decade have been applied to research of A. marginale and related organisms. The recent development of a cell culture system for A. marginale provides a potential source of antigen for the development of improved killed and live vaccines, and the availability of cell culture-derived antigen would eliminate the use of cattle in vaccine production. Increased knowledge of A. marginale antigen repertoires and an improved understanding of bovine cellular and humoral immune responses to A. marginale, combined with the new technologies, should contribute to the development of more effective vaccines for control and prevention of anaplasmosis.  (+info)

Glycosylation of Anaplasma marginale major surface protein 1a and its putative role in adhesion to tick cells. (2/95)

Anaplasma marginale, the causative agent of bovine anaplasmosis, is a tick-borne rickettsial pathogen of cattle that multiplies in erythrocytes and tick cells. Major surface protein 1a (MSP1a) and MSP1b form the MSP1 complex of A. marginale, which is involved in adhesion of the pathogen to host cells. In this study we tested the hypothesis that MSP1a and MSP1b were glycosylated, because the observed molecular weights of both proteins were greater than the deduced molecular masses. We further hypothesized that the glycosylation of MSP1a plays a role in adhesion of A. marginale to tick cells. Native and Escherichia coli-derived recombinant MSP1a and MSP1b proteins were shown by gas chromatography to be glycosylated and to contain neutral sugars. Glycosylation of MSP1a appeared to be mainly O-linked to Ser/Thr residues in the N-terminal repeated peptides. Glycosylation may play a role in adhesion of A. marginale to tick cells because chemical deglycosylation of MSP1a significantly reduced its adhesive properties. Although the MSP1a polypeptide backbone alone was adherent to tick cell extract, the glycans in the N-terminal repeats appeared to enhance binding and may cooperatively interact with one or more surface molecules on host cells. These results demonstrated that MSP1a and MSP1b are glycosylated and suggest that the glycosylation of MSP1a plays a role in the adhesion of A. marginale to tick cells.  (+info)

Anaplasma phagocytophilum has a functional msp2 gene that is distinct from p44. (3/95)

The msp2 and p44 genes encode polymorphic major outer membrane proteins that are considered unique to the intraerythrocytic agent of Anaplasma marginale and the intragranulocytic agent of Anaplasma phagocytophilum, respectively. In the present study, however, we found an msp2 gene in A. phagocytophilum that was remarkably conserved among A. phagocytophilum strains from human granulocytic anaplasmosis (HGA) patients, ticks, and a horse from various regions in the United States, but the gene was different in a sheep isolate from the United Kingdom. The msp2 gene in the A. phagocytophilum strain HZ genome was a single-copy gene and was located downstream of two Ehrlichia chaffeensis omp-1 homologs and a decarboxylase gene (ubiD). The msp2 gene was expressed by A. phagocytophilum in the blood from HGA patients NY36 and NY37 and by A. phagocytophilum isolates from these patients cultured in HL-60 cells at 37 degrees C. The msp2 gene was also expressed in a DBA/2 mouse infected by attaching ticks infected with strain NTN-1 and in a horse experimentally infected by attaching strain HZ-infected ticks. However, the transcript of the msp2 gene was undetectable in A. phagocytophilum strain HZ in SCID mice and Ixodes scapularis ticks infected with strain NTN-1. These results indicate that msp2 is functional in various strains of A. phagocytophilum, and relative expression ratios of msp2 to p44 vary in different infected hosts. These findings may be important in understanding roles that Msp2 proteins play in granulocytic ehrlichia infection and evolution of the polymorphic major outer membrane protein gene families in Anaplasma species.  (+info)

Prevalence of antibodies to bluetongue virus and Anaplasma marginale in Montana yearling cattle entering Alberta feedlots: Fall 2001. (4/95)

A serologic survey was conducted in yearling cattle imported into Alberta feedlots from Montana during October 2001 to estimate the prevalence of antibodies to bluetongue virus (BTV) and Anaplasma marginale in Montana yearling cattle. The apparent prevalence of antibodies to BTV when the competitive enzyme-linked immunosorbent assay (cELISA) was used was 0.37% (21/5608). Test positive cELISA samples were also all positive when tested by virus neutralization (VN) and they reacted to 1 or more BTV serotypes, including 2, 10, 11, 13, and 17. The apparent prevalence of antibodies to A. marginale when a recombinant cELISA (rcELISA) was used with a positive cutoff at 30% inhibition was 1.93% (108/5608). When the rcELISA positive cutoff was at 42% inhibition, the apparent prevalence was 0.73% (41/5608). After the reported sensitivity and specificity of the test had been accounted for, the A. marginale antibody results were consistent with a population that was either free of exposure or had a very low prevalence for A. marginale.  (+info)

Concurrent infections with vector-borne pathogens associated with fatal hemolytic anemia in a cattle herd in Switzerland. (5/95)

Bovine anaplasmosis is a vector-borne disease that results in substantial economic losses in other parts of the world but so far not in northern Europe. In August 2002, a fatal disease outbreak was reported in a large dairy herd in the Swiss canton of Grisons. Diseased animals experienced fever, anorexia, agalactia, and depression. Anemia, ectoparasite infestation, and, occasionally, hemoglobinuria were observed. To determine the roles of vector-borne pathogens and to characterize the disease, blood samples were collected from all 286 animals: 50% of the cows were anemic. Upon microscopic examination of red blood cells, Anaplasma marginale inclusion bodies were found in 47% of the cows. The infection was confirmed serologically and by molecular methods. Interestingly, we also found evidence of infections with Anaplasma phagocytophilum, large Babesia and Theileria spp., and Mycoplasma wenyonii. The last two species had not previously been described in Switzerland. Anemia was significantly associated with the presence of the infectious agents detected, with the exception of A. phagocytophilum. Remarkably, concurrent infections with up to five infectious vector-borne agents were detected in 90% of the ill animals tested by PCR. We concluded that A. marginale was the major cause of the hemolytic anemia, while coinfections with other agents exacerbated the disease. This was the first severe disease outbreak associated with concurrent infections with vector-borne pathogens in alpine Switzerland; it was presumably curtailed by culling of the entire herd. It remains to be seen whether similar disease outbreaks will have to be anticipated in northern Europe in the future.  (+info)

The CD4+ T cell immunodominant Anaplasma marginale major surface protein 2 stimulates gammadelta T cell clones that express unique T cell receptors. (6/95)

Major surface protein 2 (MSP2) of the bovine rickettsial pathogen Anaplasma marginale is an abundant, serologically immunodominant outer membrane protein. Immunodominance partially results from numerous CD4+ T cell epitopes in highly conserved amino and carboxy regions and the central hypervariable region of MSP2. However, in long-term cultures of lymphocytes stimulated with A. marginale, workshop cluster 1 (WC1)+ gammadelta T cells and CD4+ alphabeta T cells proliferated, leading to a predominance of gammadelta T cells. As gammadelta T cells proliferate in A. marginale-stimulated lymphocyte cultures, this study hypothesized that gammadelta T cells respond to the abundant, immunodominant MSP2. To test this hypothesis, gammadelta T cell clones were isolated from MSP2 vaccinates and assessed for antigen-specific proliferation and interferon-gamma secretion. Seven WC1+ gammadelta T cell clones responded to A. marginale and MSP2, and three of these proliferated to overlapping peptides from the conserved carboxy region. The gammadelta T cell response was not major histocompatibility complex-restricted, although it required antigen-presenting cells and was blocked by addition of antibody specific for the T cell receptor (TCR). Sequence analysis of TCR-gamma and -delta chains of peripheral blood lymphocytes identified two novel TCR-gamma chain constant (Cgamma) regions. It is important that all seven MSP2-specific gammadelta T cell clones used the same one of these novel Cgamma regions. The TCR complementarity-determining region 3 was less conserved than those of MSP2-specific CD4+ alphabeta T cell clones. Together, these data indicate that WC1+ gammadelta T cells recognize A. marginale MSP2 through the TCR and contribute to the immunodominant response to this protein.  (+info)

Stochastic transmission of multiple genotypically distinct Anaplasma marginale strains in a herd with high prevalence of Anaplasma infection. (7/95)

Multiple genotypically unique strains of the tick-borne pathogen Anaplasma marginale occur and are transmitted within regions where the organism is endemic. In this study, we tested the hypothesis that specific A. marginale strains are preferentially transmitted. The study herd of cattle (n = 261) had an infection prevalence of 29% as determined by competitive inhibition enzyme-linked immunosorbent assay and PCR, with complete concordance between results of the two assays. Genotyping revealed the presence of 11 unique strains within the herd. Although the majority of the individuals (70 of 75) were infected with only a single A. marginale strain, five animals each carried two strains with markedly distinct genotypes, indicating that superinfection does occur with distinct A. marginale strains, as has been reported with A. marginale and A. marginale subsp. centrale strains. Identification of strains in animals born into and infected within the herd during the period from 1998 to 2003 revealed no significant difference from the overall strain prevalence in the herd, results that do not support the occurrence of preferential strain transmission within a population of persistently infected animals and are most consistent with pathogen strain transmission being stochastic.  (+info)

Identification of a novel Anaplasma marginale appendage-associated protein that localizes with actin filaments during intraerythrocytic infection. (8/95)

The rickettsial pathogen Anaplasma marginale assembles an actin filament bundle during intracellular infection. Unlike other bacterial pathogens that generate actin filament tails, A. marginale infects mature erythrocytes, and the F-actin appendages are assembled on the cytoplasmic surface of a vacuole containing several organisms. To identify A. marginale molecules associated with these filaments, two complementary approaches were used: matrix-assisted laser desorption ionization-time-of-flight mass spectrometry and tandem mass spectrometry of A. marginale proteins identified with an appendage-specific monoclonal antibody and expression screening of an A. marginale phage library. Amino acid and nucleotide sequences were mapped to a full-length gene in the genome of the St. Maries strain of A. marginale; the correct identification was confirmed by expression of full-length recombinant protein and its reactivity with appendage-specific antibodies. Interestingly, there is marked variation in the abilities of diverse A. marginale strains to assemble the F-actin appendages. Comparison of four strains, the Florida, Illinois, St. Maries, and Virginia strains, revealed substantial polymorphism in the gene encoding the appendage-associated protein, with amino acid sequence identity of as low as 34% among strains. However, this variation does not underlie the differences in expression, as there is no specific polymorphism associated with loss of ability to assemble actin appendages. In contrast, the ability to assemble an actin filament bundle reflected dramatic strain-specific differences in the expression level of the appendage-associated protein. Understanding how this protein influences the cycle of invasion, replication, and egress in the host cell may provide new insights into pathogen-host interactions.  (+info)

DETECTION OF Anaplasma marginale INFECTION IN A DAIRY CATTLE FARM BY STAINED BLOOD SMEAR EXAMINATION AND NESTED POLYMERASE CHAIN REACTION
Classification of bacteria is challenging due to the lack of a theory-based framework. In addition, the adaptation of bacteria to ecological niches often results in selection of strains with diverse virulence, pathogenicity and transmission characteristics. Bacterial strain diversity presents challenges for taxonomic classification, which in turn impacts the ability to develop accurate diagnostics and effective vaccines. Over the past decade, the worldwide diversity of Anaplasma marginale, an economically important tick-borne pathogen of cattle, has become apparent. The extent of A. marginale strain diversity, formerly underappreciated, has contributed to the challenges of classification which, in turn, likely impacts the design and development of improved vaccines. Notably, the A. marginale surface protein 1a (MSP1a) is a model molecule for these studies because it serves as a marker for strain identity, is both an adhesin necessary for infection of cells and an immuno-reactive protein and is ...
Anaplasma marginale is an obligate intracellular bacterium and the main cause of bovine anaplasmosis in tropical and subtropical regions. In Egypt, data regarding the prevalence of A. marginale in ruminant hosts and of the circulating genotypes is lacking. This study therefore aimed to (i) investigate the presence, epidemiology and genotypes of A. marginale in cattle and buffaloes in Egypt, (ii) to evaluate suitable diagnostic tools and (iii) to identify co-infections of A. marginale with other selected tick-borne pathogens. Blood samples were collected from 394 animals (309 cattle and 85 buffaloes) from three different areas in Egypt. For the detection of A. marginale infection, several tests were compared for their sensitivity and specificity: blood smear analysis, enzyme-linked immunosorbent assay (ELISA), PCR, real-time PCR and reverse line blot (RLB) assay. Co-infections with A. marginale, piroplasms and other Anaplasmataceae were surveyed by RLB while A. marginale genotypes were identified by
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
The establishment and maintenance of anaplasmosis-free cattle herds is impaired due to the lack of a rapid, sensitive, and specific serologic test to detect persistently infected cattle which serve as carriers for the organism. To develop an improved diagnostic test for anaplasmosis we screened Anaplasma marginale initial body proteins to identify a protein common to antigenically different isolates that is recognized by the host immune system at all stages of infection. Seronegative cattle were infected with either the Florida, Virginia, or North Texas isolate of A. marginale and monitored for infection by daily examination of Wright-stained blood smears for parasitized erythrocytes. Sera from cattle at different stages of infection, from acute through persistent, were used to immunoprecipitate A. marginale proteins that were metabolically radiolabeled with [35S]methionine or surface radiolabeled with 125I. Multiple A. marginale proteins were recognized by using sera either undiluted or at ...
A major surface protein complex from the Florida isolate of Anaplasma marginale has been previously shown to induce protection in immunized cattle and has been proposed as the basis of a subunit vaccine against anaplasmosis. This complex in the Florida isolate is composed of two noncovalently associated polypeptides with molecular masses of 105 and 100 kilodaltons (kDa). The analogous protein complex from four geographically different isolates of A. marginale was immunoprecipitated and compared with the protein complex of the Florida isolate. The polypeptides of the complex varied in apparent molecular mass among the isolates. By using antibodies recognizing epitopes on each polypeptide of the Florida isolate, the antigenic identity of the polypeptides in the analogous complexes was determined. The polypeptides recognized by the neutralizing monoclonal antibody 22B1, which recognizes a 105-kDa polypeptide in the Florida isolate, ranged from 70 to 100 kDa in the other isolates. Those polypeptides ...
Shared and unique antigens were identified and partially characterized for two morphologically and antigenically distinct isolates of Anaplasma, A. marginale (Florida) (FAM) and A. caudatum (Illinois) (IAC). Crude CA-like antigens were prepared from the parasitemic blood of each calf, separated by SDS-PAGE, electroblotted onto nitrocellulose, and detected using immune bovine sera and an avidin-biotin-peroxidase assay with biotinylated rabbit anti-goat IgG (cross-reacted with cattle, sheep and deer antibodies). IAC antigens were 200 kilodalton (kd), 100 kd, 96 kd, 75 kd, 47 kd, 43 to 38 kd, and 27 kd, detected using anti-IAC and anti-FAM sera. FAM antigens were 108 kd, 100 kd, 96 kd, 91 kd, 75 kd, 47 kd, 43 to 38 kd, and 27 kd, detected using anti-FAM sera and, except for the 91 kd, with anti-IAC sera. The 91 kd is an FAM isolate-specific antigen. The 108 kd, 100 kd, and 96 kd are group-specific antigens of A. marginale and A. centrale. The 43 to 38 kd is genus-specific. The 96, 91, and 75 kd ...
Phytopathology 92:970-975...Phytopathology 92:970-975...Virus Transmission Phenotype Is Correlated with Host Adaptation Among Genetically Diverse Populations of the Aphid Schizaphis graminum...Stewart M. Gray , Dawn M. Smith , Lia Barbierri , and John Burd...
24.BraytonKA,PalmerGH,BrownWC: Genomicandproteomicapproaches tovaccinecandidateidentificationfor Anaplasmamarginale ExpertRev Vaccines 2006, 5: 95 101. 25.PierleSA,DarkMJ,DahmenD,PalmerGH,BraytonKA: Comparative genomicsandtranscriptomicsoftrait-geneassociation. BMCGenomics 2012, 13: 669. 26.VanOpijnenT,CamilliA: Transposoninsertionsequencing:anewtoolfor systems-levelanalysisofmicroorganisms. NatRevMicrobiol 2013, 11: 435 442. 27.ClaeysBouuaertC,ChalmersRM: Genetherapyvectors:theprospectsand potentialsofthecut-and-pastetransposons. Genetica 2010, 138: 473 484. 28.PicardeauM: Transpositionofflymarinerelementsintobacteriaasa genetictoolformutagenesis. Genetica 2010, 138: 551 558. 29.LampeDJ,GrantTE,RobertsonHM: Factorsaffectingtranspositionofthe Himar1 marinertransposoninvitro. Genetics 1998, 149: 179 187. 30.PlasterkRH,IzsvakZ,IvicsZ: Residentaliens:theTc1/marinersuperfamily oftransposableelements. TrendsGenet 1999, 15: 326 332. 31.ClarkTR,EllisonDW,KlebaB,HackstadtT: Complementationof Rickettsia ...
Ubiquinone (UQ), also called coenzyme Q, and plastoquinone (PQ) are electron carriers in oxidative phosphorylation and photosynthesis, respectively. The quinoid nucleus of ubiquinone is derived from the shikimate pathway; 4-hydroxybenzoate is directly formed from chorismate in bacteria, while it can be formed from either chorismate or tyrosine in yeast. The following biosynthesis of terpenoid moiety involves reactions of prenylation, decarboxylation, and three hydroxylations alternating with three methylations. The order of these reactions are somewhat different between bacteria and yeast. Phylloquinone (vitamin K1), menaquinone (vitamin K2), and tocopherol (vitamin E) are fat-soluble vitamins. Phylloquinone is a compound present in all photosynthetic plants serving as a cofactor for photosystem I-mediated electron transport. Menaquinone is an obligatory component of the electron-transfer pathway in bacteria ...
Part of the ESX-3 specialized secretion system, which is important for iron and zinc uptake or homeostasis (PubMed:19684129, PubMed:24155985). EccA3 exhibits ATPase activity and may provide energy for the export of ESX-3 substrates (By similarity).
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class=publication>Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href=http://www.nrbook.com/b/bookcpdf.php>Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
In der vorliegenden in vitro Studie sollte der Frage nachgegangen werden, inwieweit die Teilkronenpräparation Einfluss auf die marginale Integrität der vollkeramischen Restauration im Schmelz und im Dentin nach thermomechanischer Wechselbelastung hat. Es wurden zwei unterschiedliche Präparationsformen gewählt, wobei der vestibuläre, nichttragende Höcker auf 1,0 mm Restzahnhartsubstanzstärke ausgedünnt (Präparation A) oder zusätzlich um ca. 2,0 mm horizontal reduziert und überkuppelt (Präparation B) wurde. Von den Zähnen wurden vor und nach thermomechanischer Wechselbelastung Epoxidharzreplikate hergestellt, an denen die marginale Integrität computergestützt bei 201 facher Vergrößerung mittels rasterelektronenmikroskopischer Randanalyse sowohl an allen Grenzen (Schmelz/Befestigungskomposit, Dentin/Befestigungskomposit und Keramik/Befestigungskomposit), als auch an allen Flächen (okklusal/vestibulär, palatinal, approximal/mesial und approximal/distal) ermittelt wurde. Bei ...
Anaplasma marginale is a tick-transmitted, obligate intraerythrocytic pathogen of cattle, causing anaplasmosis characterized by anemia, decreased milk and meat production, and occasionally death. Animals that survive are ...
CP000828.PILC Location/Qualifiers FT CDS_pept complement(390490..391710) FT /codon_start=1 FT /transl_table=11 FT /gene=pilC FT /locus_tag=AM1_0417 FT /product=type II secretion system domain protein/ pilin FT biogenesis protein PilC FT /note=Member of bacterial type II secretion system protein FT F domain, PF00482. FT /db_xref=EnsemblGenomes-Gn:AM1_0417 FT /db_xref=EnsemblGenomes-Tr:ABW25474 FT /db_xref=GOA:B0CAY4 FT /db_xref=InterPro:IPR001992 FT /db_xref=InterPro:IPR003004 FT /db_xref=InterPro:IPR018076 FT /db_xref=InterPro:IPR042094 FT /db_xref=UniProtKB/TrEMBL:B0CAY4 FT /protein_id=ABW25474.1 FT /translation=MPTYVVRARDSQGKSSQKRVNATSQKEARSNIQRQGLQILDIKES FT QGFSMNAELDLSFLQSITVKDKALFSRQFSALVNAGVALVRGLGVMSEQCKNPKLKKAL FT LDVNAAVQQGVSLSDAMRGHPAAFDQLYVAMIQAGETGGVLDEVLNRLATLLEDQARLK FT NQIRSALAYPVVVGFIAVSIFLGMVIFLIPVFDGIFSQLGGDLPAFTQFMVNLSEFLRT FT PIYGISAAIVVFGSTFALRQYYRTRAGRETIDRIMLKLPLFGDLIQKTAVARFCRTFGS FT LSRSGVPILYSLEIVRDTAGNQVVSNAIDEARREIQGGGMLSLALQKEKVFPLLATQMI ...
NEW YORK (GenomeWeb News) - PathoGenetix and Applied Maths today announced a deal to integrate each others technologies into a solution for rapid pathogen strain typing.
ISSR stands for Inter Simple Sequence Repeat and refers to the genome regions between microsatellite loci. It is a rapid and inexpensive genotyping technique with a wide range of applications, including the characterization of genetic relatedness among the organisms of a population. This application describes the amplification of ISSR sequences from individual C. michiganensis subsp. michiganensis strains using ISSR-PCR and the QIAxcel Advanced System.
Anaplasma marginale is the most prevalent tick-borne pathogen of cattle. It is transmitted by ixodid ticks. Symptoms of acute disease are anemia, weight loss, and often death. A.marginale establishes life-long persistent infection in animals that survive disease. These animals are clinically healthy but serve as reservoirs for transmission of the pathogen. Anaplasma marginale subsp. centrale (Anaplasma centrale (strain Israel)) is a naturally occurring attenuated strain has been used as a live vaccine to prevent severe disease due to A. marginale senso stricto strains for 100 years. A. marginale subsp. centrale contains 10 putative genes not found in the genomes of senso stricto strains, while 18 genes found in senso stricto strains are absent from A. marginale subsp. centrale. As inoculation with purified outer membrane protein (OMP) complexes provides immunity against A. marginale, it is important to identify OMPs that differ among A,marginale to identify further vaccine candidates. ...
2002) Erratum to A msp1α polymerase chain reaction assay for specific detection and differentiation of Anaplasma marginale isolates [Vet. Microbiol. 86 (2002) 325-335]. Veterinary Microbiology, 87 (4). pp. 365-366. ...
The genus Anaplasma consists of tick-transmitted obligate intracellular bacteria that invade white or red blood cells to cause debilitating and potentially fatal infections. A. phagocytophilum, a human and veterinary pathogen, infects neutrophils to cause granulocytic anaplasmosis. A. marginale invades bovine erythrocytes. Evidence suggests that both species may also infect endothelial cells in vivo. In mammalian and arthropod host cells, A. phagocytophilum and A. marginale reside in host cell derived pathogen-occupied vacuoles (POVs). While it was recently demonstrated that the A. phagocytophilum-occupied vacuole (ApV) intercepts membrane traffic from the trans-Golgi network, it is unclear if it or the A. marginale-occupied vacuole (AmV) interacts with other secretory organelles. Here, we demonstrate that the ApV and AmV extensively interact with the host endoplasmic reticulum (ER) in endothelial, myeloid, and/or tick cells. ER lumen markers, calreticulin and protein disulfide isomerase, and the ER
Introduction. Bovine anaplasmosis is caused by the intraerythrocytic rickettsia Anaplasma marginale and is an endemic condition in tropical and subtropical areas. Ticks are the biological vector, but transmission may also occur mechanically by mosquitoes and bloodsucking flies (YERUHAM; BRAVERMAN, 1981). In endemic areas, calves are infected during the first months of life. Acute infections develop into a clinical disease characterized by anemia and weight loss (CORRIER; GUZMAN, 1977; RIBEIRO; REIS, 1981), and death can occur in 36% (PALMER, 1989). Animals that survive the clinical disease remain persistent carriers with low rickettsemia. They may be a source of infection for other susceptible animals that become infected through mechanical and biological vectors (SCHILF, 1971). Animal susceptibility increases with age, and younger animals are more resistant to the first infection, and have less severe clinical symptoms (ROBY et al., 1961; JONES et al., 1968).. Over the past 30 years no new ...
Aim: Anaplasma marginale is a rickettsial pathogen responsible for progressive anemia in ruminants leading to huge economic losses. The objectives of this cross-sectional study were to determine the prevalence of anaplasmosis and therapeutic evaluation of traditional line of treatment.. Materials and Methods: A total of 168 cattle presented to Teaching Veterinary Clinical Complex, Lala Lajpat Rai University of Veterinary & Animal Sciences, Hisar during the period of 3 months (July-September, 2014) with history of fever, anorexia, reduced milk yield and tick infestation were analyzed for prevalence of hemoprotozoan diseases using classical giemsa stained thin blood smear parasitological method.. Results: Out of these 168 animals, 7 (4.17%) were found to be suffering from anaplasmosis on the basis of presence of dense, rounded, intra-erythrocytic bodies situated on or near the margin of the erythrocytes. Overall prevalence of theileriosis and babesiosis were found to be 42.9% and 1.8%, ...
Marie Heurtin streaming vf, Marie Heurtin voirfilms,Marie Heurtin streamcomplet, Marie Heurtin filmsrip,Marie Heurtin Bande-annonce : Cette histoire est inspirée de faits réels qui se sont déroulés en France à la fin du 19ème siècle. Née sourde et aveugle, Marie Heurtin, âgée de 14 ans, est incapable de communiquer avec le reste du monde. Son père, modeste artisan, ne peut se résoudre à la faire interner dans un asile comme le lui conseille un médecin qui la juge « débile ». En désespoir de cause, il se rend à linstitut de Larnay, près de Poitiers, où des religieuses prennent en charge
GRT-ZCK165AT-3 Commercial 3 PAN Hot Bain Marie Food Warmer, find complete details about GRT-ZCK165AT-3 Commercial 3 PAN Hot Bain Marie Food Warmer, Bain Marie, Electric Bain Marie, Commercial Soup Kettle - Garyton
Ha, S., Furukawa, R., Stramiello, M., Wagner, J.J., and Fechheimer, M. (2011). Transgenic Mouse Model for the Formation of Hirano Bodies. BMC Neurosci. 12:97. [Epub ahead of print]. Ha, S., Furukawa, R., and Fechheimer, M. (2011). Association of AICD and Fe65 with Hirano bodies reduces transcriptional activation and initiation of apoptosis. Neurobiol Aging. 32:2287-98.. Kim, D.-H., R. Furukawa, and M. Fechheimer. 2009. Degradation of Hirano Bodies by Autophagy 5, 44-51.. Davis, R. C., Furukawa, R., and M. Fechheimer, 2008. A Mammalian Cell Culture Model for the Formation of Hirano Bodies, Acta Neuropathologica 115, 205-217.. Stich, R. W., G. A. Olah, K. A. Brayton, W. C. Brown, M. Fechheimer, K. Green-Church, S. Jittapalapong, K. M. Kocan, T. C. McGuire, F. R. Rurangirwa, and G. H. Palmer. 2004. Identification of a novel Anaplasma marginale appendage-associated protein that localizes with actin filaments during intraerythrocytic infection. Infection and Immunity 72, 7257-7264.. Maselli, A., R. ...
Below are College of Veterinary Medicine publications added to the Scopus database in the last 30 days.. PubMed Collection of MU CVM Publications 2020. Congratulations to all the recently published authors!. Note: access to the full text may be subject to library subscriptions.. Journal Articles. Saetiew N, Simking P, Saengow S, Morand S, Desquesnes M, Stich RW, Jittapalapong S. Spatial and seasonal variation in the prevalence of Anaplasma marginale among beef cattle in previously flooded regions of Thailand. Agriculture and Natural Resources. 2020;54(4):355-62. doi: 10.34044/j.anres.2020.54.4.03.. Wiemken TL, Ericsson AC. Chlorhexidine gluconate does not result in epidermal microbiota dysbiosis in healthy adults. American Journal of Infection Control. 2020. Epub 2020/12/02. doi: 10.1016/j.ajic.2020.11.021. PubMed PMID: 33259824.. Zhao ZH, Li CY, Meng TG, Wang Y, Liu WB, Li A, Cai YJ, Hou Y, Schatten H, Wang ZB, Sun QY, Sun Q. Single-cell RNA sequencing reveals regulation of fetal ovary ...
Maries memoirs, The Education of a Princess and A Princess in Exile, published by Viking Press in 1930 and 1932, were highly successful, and she signed many copies with a purple flourish. But what next? She had a living to make, at a time when former Wall Street millionaires were selling apples on streetcornersa familiar sight for one who had lived as a former-person under the Bolsheviks. One talent Marie seemed to constantly improve was her ability to charm sometimes perfect strangers, although the exquisite portrait painter and fellow ÚmigrÚe aristocrat Elly Shoumatoff (for whom Marie had sat in 1930) felt one of Maries less positive talents was for getting involved with undesirable people. When among her friends, Marie was warm and funny; but when pulling rank, in the words of Mme Shoumatoffs grandson, writer Alex Shoumatoff, the grand duchess could run the gamut from mildly annoying to sadly pathetic.. Mostly, it was the charm that came through, along with that enduring desire ...
Bain Marie E24M-F merupakan mesin yang dipakai sebagai pemajang maupun menghangatkan makanan. Dengan memakai mesin bain marie counter ini makanan akan tetap terjaga kualitasnya melalui penghangatan dari makanan tersebut. Mesin bain marie counter ini memiliki tampilan desain yang menarik dengan dilengkapi thermostat dan lampu indikator. Mesin bain marie terbuat dari bahan stainless Steel sehingga membuat makanan yang dipajang terlihat lebih cantik dan juga menarik. Cocok untuk penyajian makanan panas di rumah, cafe, dsb.. ...
You searched for: The3Maries! Discover the unique items that The3Maries creates. At Etsy, we pride ourselves on our global community of sellers. Each Etsy seller helps contribute to a global marketplace of creative goods. By supporting The3Maries, youre supporting a small business, and, in turn, Etsy!
Anaplasmosis is a tick-borne disease caused by an obligate gram-negative bacteria, Anaplasma (A.) marginale. This study reports on the seasonal prevalence, epidemiology and phylogeny of A. marginale in three breeds …. ...
Anaplasmosis is a tick-borne disease caused by an obligate gram-negative bacteria, Anaplasma (A.) marginale. This study reports on the seasonal prevalence, epidemiology and phylogeny of A. marginale in three breeds …. ...
. Contact Marie stopes clinic 0835746385 In Rustenburg, Mafikeng, Klerksdorp klerksdorp main street 4449 +27835746385. Marie stopes clinic 0835746385 In Rustenburg, Mafikeng, Klerksdorp offers . Learn More About Marie stopes clinic 0835746385 In Rustenburg, Mafikeng, Klerksdorp.
Whats the over/under on Marie breaking out into tears during testimony? Marie thinks President Trump was mean to her, implies she feels threatened. Really, Marie? From President Zelinsky to President Trump: ......It was great that you were the first one who told me that she was a bad Ambassador because I agree with you 100%.…
Whats the over/under on Marie breaking out into tears during testimony? Marie thinks President Trump was mean to her, implies she feels threatened. Really, Marie? From President Zelinsky to President Trump: ......It was great that you were the first one who told me that she was a bad Ambassador because I agree with you 100%.…
At Ramada Plaza by Wyndham Sault Ste. Marie Ojibway, our welcoming atmosphere and convenient amenities, such as free WiFi, offer an ideal stay in Sault Sainte Marie, MI.
Naja Marie Aidt ebook Bavian author Naja Marie Aidt - Kindle ePUB, TXT and Epub Download å Beginning in the middle of crisis then accelerat...
Marie Osmond Bio, Salary, Net Worth, Husband, Wedding, Children, Daughter, Relationship, Body Measurement, Age, Nationality, Albums. How old is Marie Osmond? As of 2019, Marie Osmond is 59 years old. How much is her net worth? Her net worth is estimated to be around $20 million.
Cel mai adeasea, cei care locuiesc la bloc isi achizitioneaza si monteaza centrale termice cu condensare datorita faptului ca acestea consuma putina energie.. Nu trebuie sa mergi neaparat prin magazine si sa umbli zile in sir pentru a cumpara o centrala. Poti cumpara o centrala si online de pe Epinvest.ro. Intra pe site si consulta lista cu centralele disponibile.. Nu este convenabil sa cumperi centrale termice cu condensare atunci cand locuiesti la casa. Daca locuiesti la casa, cel mai convenabil este sa-ti achizitionezi o centrala termica pe lemne. Ai cu siguranta spatiu suficient pentru depozitarea lemnelor si suficient spatiu pentru camera in care tii centrala.. ...
If we really want to get more women into STEM fields, we need to enact a moratorium on Marie Curie. Its all well and good to have that obligatory female nerd in the lab on every procedural mystery TV show, to include some lab-coated ladies in a Lego set, or to add a computer engineer Barbie to Mattels latest line (though that one didnt go so well). But clearly its not enough. Every single one of us needs to scrub that you-know-who reflex from our brain and replace it with a diverse set of important female innovators. When we do, girls will gain Grace Hopper, who was one of the most important-and colorful-computer scientists in history; Marie Tharp, who mapped the ocean floor and saw evidence of continental drift years before her partner or others in the scientific community accepted the idea; Virginia Apgar, whose scoring system for newborns has saved countless babies lives; and Inge Lehmann, who discovered Earths inner core. ...
Building on the momentum generated out of last weeks Families Against Narcotics (FAN) presentation, more than two dozen people gathered in the Avery Center Wednesday to decide where we - as a community - go from here.Prevention Coordinator Karen Senkus of the Chippewa County Health Department said she was pleased by the turnout before giving the crowd their instructions:
Købe Dame Hipstertrusse 2-Pack Sari 2-Pack By Marie Meili [Mode Danmark 0103]Hipstertrusser i 2-pk. Flatterende model i blødt mikromateriale fra Marie Meili. Den ene har smukt blondepanel og den anden er glat.Materiale:92% polyamid, 8% elastan.Vaskeråd:Vask 40°.
The Marie Curie Actions are the EUs funding mechanism for supporting the mobility and career development of researchers across Europe. (In Horizon 2020, they have been renamed the Marie Skłodowska-Curie Actions). Since 1996, the Marie Curie Actions have helped thousands of researchers of all ages, nationalities and disciplines develop their careers and realise their research dreams - no other scheme in the world offers such a wide variety of opportunities to such a broad range of researchers. By doing this, the Marie Curie Actions also promote the transfer of knowledge and skills across national and sectoral borders, and crucially, advance excellence in research and innovation across Europe.. The Initial Training Networks are one particular Marie Curie Action, which supports early stage researchers. Each network consists of a consortium of research partners and industry, with an integrated training programme in a particular topic. The Marie Curie Actions then fund a number of early stage ...
Heres something all the means girls can write about in their notebooks: Rachel McAdams is now a redhead.The Vow star ventured to Disneyland Wednesday with a new do, according to US Magazine.Rachel McAdams and Michael Sheen splitMcAdams, 34, kept her ...
Heritage Home in the Heart of Sault Ste Marie. Character Home Located in the Heart of Sault Ste Marie. Wide baseboards, hardwood floors and lead glass wind...
Answers from specialists on constance marie. First: Charcot marie tooth disease basically can be inherited neurological disease. Diabetes is a metabolic disorder.
shows Sale binary options strategies Sault Ste. Marie Nakamura (Japan) - Sale binary options strategies Sault Ste. Marie, Price trade Amory, Price binary options trading Shepparton, Discount binary options indicator Charters Towers
Wildhainweg 3, case postale 8232, CH-3001 Berne Division Carrières Marie Heim-Vögtlin Marie Heim-Vögtlin : liste des bénéficiaires MHV: mise au concours 2014 (36 subsides) Nom Prénom Statut
View Ariana marie and remy lacroix at sextape lesbian babes hd as completely free. syrian pornstar porn xxx Ariana marie and remy lacroix at sextape lesbian babes video.
House of Sinner LA Marie Morgane in Quiberon reviews and the House of Sinner LA Marie Morgane in Quiberon room rates. All the best hotel deals on ebookers.com.
Marie Osmond made Tuc Watkins feel so comfortable on her new Hallmark Channel talk show, Marie, that the handsome actor not only came out, but he also revealed
La Conférence sur le diabète et les autres MNT en Afrique de lOuest et en Afrique centrale a examiné les défis que le diabète et les autres maladies non transmissibles représentent pour la santé et le bien-être des citoyens de la région et par conséquent pour les économies de ces pays. Les participants à cette rencontre ont adopté la déclaration suivante et ont lancé un appel urgent à laction ...
En soutien aux secteurs de la culture et de la création en Afrique centrale. Projet mis en oeuvre par un consortium de partenaires africains et européens.
Heres how you can order isolates and seeds of differential hosts. Isolates To request isolates, please email the following individuals
Fixed term for 36 monthsApplications are invited for an Early Stage Researcher (ESR)/PhD studentship position funded by The Marie Sklodowska-Curie Actions (MSCA) Innovative Training Networks (ITN) programme
In the November issue of Marie Claire, our wonderful Aprés Educator, Britney Tokyo, created a series of stunning nude manicures on the model Jennifer Roberts.This look was created with Gel-X Extension System w/Natural Stiletto Long Tips Whats included in the kit is: -Top Gelcoat-pH Bonder-Non-Acidic Primer-Mini LED Li
The Container Store Group, Inc. (NYSE: TCS) shares are trading higher after the company reported fiscal second-quarter earnings of 41 cents per share, up from 8 cents year-over-year. The company reported quarterly sales of $248.20 million, which beat the analyst consensus estimate of $216.45 million by 14.6%.The company also announced its launching an exclusive co-branded collection of organizing tools by Marie Kondo.The Container Store has seen a lot of interest after Netflix, Inc. (NASDAQ: NFLX) started streaming episodes of Get Organized With the Home Edit, a show based on an extreme organization book by Clea Shearer and Joanna Tepin called The Home Edit.View more earnings on TCSSee Also: Container Stores Stock Is Getting A Netflix Home Edit BoostThe Container Store Group operates as a retailer of storage and organization products and solutions in the United States. It operates through two segments, The Container Store and Elfa. The company provides approximately 11,000 products designed to
See what Marie Sevland (mariesevland) has discovered on Pinterest, the worlds biggest collection of everybodys favorite things.
Kathleen Marie Laughlin MD is a Family Practitioner who practices in Tualatin, OR. Get a full report about this doctors background by clicking here.
Marie Besnard In France, in the 17th Century, alchemists became wealthy grinding arsenic rock into a colorless and odorless powder and selling the powder to their countrymen who wanted to do away with a wealthy old parent, grandparent, uncle or aunt. There was even an
Marie Curie (French: ; 7 November 1867 - 4 July 1934), née Maria SalomeaSkłodowska (Polish: ), was a Polish physicist and chemist, working mainly in France
Buy 3 More Inches, Pre Wash Treatment 500ml at Fabled by Marie Claire. Free next-day delivery on orders over £15, 1-hour delivery slots.
Buy Origins, Dr Weil Mega-Mushroom Skin Relief Face Cleanser 150ml at Fabled by Marie Claire. Free next-day delivery on orders over £15, 1-hour delivery slots.
136). Mackerras, I. M., Mackerras, M. J., & Mulhearn, C. R. (1942). Attempted transmission of Anaplasma marginale Theiler by ...
"mCherry - MCherry fluorescent protein - Anaplasma marginale - mCherry gene & protein". www.uniprot.org. Retrieved 2018-11-11. ...
The two major species that cause anaplasmosis in ruminants include Anaplasma marginale and Anaplasma phagocytophilum. Anaplasma ... The two major bacterial pathogens are Anaplasma marginale and Anaplasma phagocytophilum. These microorganisms are Gram-negative ... Atif FA (November 2015). "Anaplasma marginale and Anaplasma phagocytophilum: Rickettsiales pathogens of veterinary and public ... and South America have used live vaccines containing infectious Anaplasma centrale to prevent infection of Anaplasma marginale ...
Evidence of Anaplasma marginale Transmission by Sucking Lice Haematopinus tuberculatus". Journal of Parasitology. 99 (3): 546- ...
"Structural basis for segmental gene conversion in generation of Anaplasma marginale outer membrane protein variants". Molecular ... Ehrlichia and its closely related genus Anaplasma show extreme diversity in the structure and content of their genomes. This ...
Other species of Anaplasma, most commonly A. marginale, are well documented to cause disease in cattle. Anaplasma species ... "Novel Genetic Variants of Anaplasma phagocytophilum, Anaplasma bovis, Anaplasma centrale, and a Novel Ehrlichia sp. in Wild ... Other members of this genus include the species A. phagocytophilum, A. marginale, A. platys, A. ovis, and A. centrale Anaplasma ... Anaplasma bovis is currently one of 6 recognized species within the Genus Anaplasma. ...
It is a potential vector of many babesiosis pathogens like Babesia bigemina, Babesia bovis, and Anaplasma marginale. It shows a ...
The dominant parasites were Theileria species, T. buffeli, T. bicornis, Ehrlichia species, Anaplasma marginale and A. bovis. ...
Anaplasma marginale, and Baberia bigemina; 27 species of ixodid ticks have been found on waterbucks - a healthy waterbuck may ...
Anaplasma centrale tends to infect the central region of red blood cells, and is sufficiently closely related to An. marginale ... Anaplasma marginale infects marginal areas of red blood cells of cattle and causes anaplasmosis wherever boophilid ticks occur ... marginale. Sheep and goats suffer disease from infection with Anaplasma ovis which is transmitted similarly to the anaplasmas ... However, some microbes, such as Anaplasma marginale and A. centrale, can also be transmitted by biting flies, or by blood on ...
Tabanid flies are also transmitters the bacteria Anaplasma marginale and A.centrale to cattle, sheep and goats, causing ... Scoles,G.A., (2008) Comparison of the efficiency of biological transmission of Anaplasma marginale (Rickettsiales: ...
2005). "Complete genome sequencing of Anaplasma marginale reveals that the surface is skewed to two superfamilies of outer ...
Tick fever is caused by the diseases Babesia bigemina, Babesia bovis, or Anaplasma marginale which are transmitted by cattle ...
... are found in Anaplasma and those which interact with Anaplasma can mainly be found in A. marginale and A. phagocytophilum. ... A. marginale evolved to be more specific in infecting animals, such as deer and cattle in the subtropics and tropics. The main ... Anaplasma phagocytophilum shares its tick vector with other human pathogens, and about 10% of patients with HGA show serologic ... Anaplasma MSPs can not only cooperate with vertebrates, but also invertebrates, which make these phenotypes evolve faster than ...
... in deer and sheep of the parasites present in the blood of calves infected with the Oregon strain of Anaplasma marginale". Am J ...
Anaplasma marginale, Babesia bigemina. Tick fever results in exterior material damage, internal damage, loss of condition, ...
... marginale and Anaplasma centrale in cattle Anaplasma ovis and Anaplasma mesaeterum in sheep and goats Anaplasma ... Anaplasma species are biologically transmitted by Ixodes deer-tick vectors, and the prototypical species, A. marginale, can be ... Anaplasma is a genus of bacteria of the alphaproteobacterial order Rickettsiales, family Anaplasmataceae. Anaplasma species ... cite journal}}: Cite journal requires ,journal= (help) Anaplasma genomes in the JGI genome browser Anaplasma at the US National ...
Anaplasma marginale, which causes anaplasmosis in cattle, Francisella tularensis, which causes tularemia, Babesia caballi, ...
... and the bacterium Anaplasma marginale. Horses may be infected with Lyme disease, Anaplasma phagocytophila, and the viral ... Anaplasma phagocytophila), Q fever (Coxiella burnetii), Boutonneuse fever (Rickettsia conorii), ...
Anaplasma MeSH B03.440.040.050.100 - Anaplasma centrale MeSH B03.440.040.050.500 - Anaplasma marginale MeSH B03.440.040.050.575 ... Anaplasma MeSH B03.660.050.020.050.100 - Anaplasma centrale MeSH B03.660.050.020.050.500 - Anaplasma marginale MeSH B03.660. ... Anaplasma ovis MeSH B03.440.040.050.600 - Anaplasma phagocytophilum MeSH B03.440.040.287 - Ehrlichia MeSH B03.440.040.287.090 ... 050.020.050.575 - Anaplasma ovis MeSH B03.660.050.020.050.600 - Anaplasma phagocytophilum MeSH B03.660.050.020.287 - Ehrlichia ...
The 2014 Ju-Jitsu World Championship were the 12th edition of the Ju-Jitsu World Championships, and were held in Paris, France from November 28 to November 30, 2014. 28.11.2014 - Men's and Women's Fighting System, Men's and Women's Jiu-Jitsu (ne-waza), Men's Duo System - Classic 29.11.2014 - Men's and Women's Fighting System, Men's and Women's Jiu-Jitsu (ne-waza), Women's Duo System - Classic 30.11.2014 - Men's Jiu-Jitsu (ne-waza), Mixed Duo System - Classic, Team event Vincent MATCZAK (2014-09-30). "4TH INVITAION TO WORLD CHAMPIONSHIP 2014" (PDF). Retrieved 2019-11-28.[dead link] Online results Official results (PDF) Mixed team event results (PDF) (All articles with dead external links, Articles with dead external links from April 2022, Ju-Jitsu World Championships, 2014 in French sport ...
Bolley L. "Bo" Johnson (born November 15, 1951) is an American politician from the state of Florida. A member of the Democratic Party, Johnson was a member of the Florida House of Representatives, and served as the Speaker of the Florida House of Representatives. Johnson is from Milton, Florida. His father and grandfather served as county commissioners for Santa Rosa County, Florida. Johnson graduated from Milton High School, and became the first member of his family to attend college. He received his bachelor's degree from Florida State University. Johnson volunteered for Mallory Horne when Horne served as the president of the Florida Senate. At the age of 22, Johnson met Lawton Chiles, then a member of the United States Senate, who hired him as a legislative aide in 1973. Johnson was elected to the Florida House of Representatives, representing the 4th district from November 7, 1978 to November 3, 1992. He also served the 1st district from November 3, 1992 to November 8, 1994. He became the ...
... may refer to: Don't Say No (Billy Squier album), a 1981 album by American rock singer Billy Squier, and its title track Don't Say No (Seohyun EP), a 2016 extended play by South Korean pop singer Seohyun, and its title track "Don't Say No" (Tom Tom Club song), from the 1988 album Boom Boom Chi Boom Boom "Don't Say No", by Robbie Williams from the 2005 album Intensive Care "Don't Say No Tonight", a 1985 single by Eugene Wilde This disambiguation page lists articles associated with the title Don't Say No. If an internal link led you here, you may wish to change the link to point directly to the intended article. (Disambiguation pages with short descriptions, Short description is different from Wikidata, All article disambiguation pages, All disambiguation pages, Disambiguation pages ...
The Dewoitine 37 was the first of a family of 1930s French-built monoplane fighter aircraft. The D.37 was a single-seat aircraft of conventional configuration. Its fixed landing gear used a tailskid. The open cockpit was located slightly aft of the parasol wing. The radial engine allowed for a comparatively wide fuselage and cockpit. Design of this machine was by SAF-Avions Dewoitine but owing to over work at that companies plant at the time, manufacture of the D.37/01 was transferred to Lioré et Olivier. They were high-wing monoplanes of all-metal construction with valve head blisters on their engine cowlings. The first prototype flew in October 1931. Flight testing resulted in the need for multiple revisions in both engine and airframe, so it was February 1934 before the second prototype flew. Its performance prompted the French government to order for 28 for the Armée de l'Air and Aéronavale. The Lithuanian government ordered 14 that remained in service with their Air Force until 1936, ...
The Noor-ul-Ain (Persian: نور العين, lit. 'the light of the eye') is one of the largest pink diamonds in the world, and the centre piece of the tiara of the same name. The diamond is believed to have been recovered from the mines of Golconda, Hyderabad in India. It was first in possession with the nizam Abul Hasan Qutb Shah, later it was given as a peace offering to the Mughal emperor Aurangazeb when he defeated him in a siege. It was brought into the Iranian Imperial collection after the Persian king Nader Shah Afshar looted Delhi in the 18th century.[citation needed] The Noor-ul-Ain is believed to have once formed part of an even larger gem called the Great Table diamond. That larger diamond is thought to have been cut in two, with one section becoming the Noor-ul-Ain and the other the Daria-i-Noor diamond. Both of these pieces are currently part of the Iranian Crown Jewels. The Noor-ul-Ain is the principal diamond mounted in a tiara of the same name made for Iranian Empress Farah ...
The Benoist Land Tractor Type XII was one of the first enclosed cockpit, tractor configuration aircraft built. Benoist used "Model XII" to several aircraft that shared the same basic engine and wing design, but differed in fuselage and control surfaces. The Type XII was a tractor-engined conversion of the model XII headless pusher aircraft that resembled the Curtiss pusher aircraft. Demonstration pilots used Benoist aircraft to demonstrate the first parachute jumps, and the tractor configuration was considered much more suitable for the task. The first example named the "Military Plane" had a small box frame covered fuselage that left the occupants mostly exposed to the wind. The later model XII "Cross Country Plane" had a full fuselage that occupants sat inside of. The first tractor biplane used a wooden fuselage with a small seat on top. The wings were covered with a Goodyear rubberized cloth. The first model XII was built in the spring of 1912. On 1 March 1912, Albert Berry used a headless ...
... (also known as Yalmotx in Qʼanjobʼal) is a town, with a population of 17,166 (2018 census), and a municipality in the Guatemalan department of Huehuetenango. It is situated at 1450 metres above sea level. It covers a terrain of 1,174 km². The annual festival is April 29-May 4. Barillas has a tropical rainforest climate (Af) with heavy to very heavy rainfall year-round and extremely heavy rainfall from June to August. Citypopulation.de Population of departments and municipalities in Guatemala Citypopulation.de Population of cities & towns in Guatemala "Climate: Barillas". Climate-Data.org. Retrieved July 26, 2020. Muni in Spanish Website of Santa Cruz Barillas Coordinates: 15°48′05″N 91°18′45″W / 15.8014°N 91.3125°W / 15.8014; -91.3125 v t e (Articles with short description, Short description is different from Wikidata, Pages using infobox settlement with no coordinates, Articles containing Q'anjob'al-language text, Coordinates on Wikidata, ...
Maria Margaret La Primaudaye Pollen (10 April 1838 - c. 1919), known as Minnie, was a decorative arts collector. As Mrs John Hungerford Pollen, she became known during the early-twentieth century as an authority on the history of textiles, publishing Seven Centuries of Lace in 1908. Maria Margaret La Primaudaye was born into a Huguenot family on 10 April 1838, the third child of the Revd Charles John La Primaudaye, a descendant of Pierre de La Primaudaye. She was educated in Italy. Her family converted to Catholicism in 1851, and it was in Rome that her father met another recent English convert, John Hungerford Pollen, previously an Anglican priest and a decorative artist. She became engaged to Pollen, who was then seventeen years her senior, in the summer of 1854, and was married in the church of Woodchester monastery, near Stroud, Gloucester, on 18 September 1855. The Pollens initially settled in Dublin, where John Hungerford Pollen had been offered the professorship of fine arts at the ...
Ronald Robert Fogleman (born January 27, 1942) is a retired United States Air Force general who served as the 15th Chief of Staff of the Air Force from 1994 to 1997 and as Commanding General of the United States Transportation Command from 1992 to 1994. A 1963 graduate from the United States Air Force Academy, he holds a master's degree in military history and political science from Duke University. A command pilot and a parachutist, he amassed more than 6,800 flying hours in fighter, transport, tanker and rotary wing aircraft. He flew 315 combat missions and logged 806 hours of combat flying in fighter aircraft. Eighty of his missions during the Vietnam War were as a "Misty FAC" in the F-100F Super Sabre at Phù Cát Air Base, South Vietnam between 25 December 1968 and 23 April 1969. Fogleman was shot down in Vietnam in 1968, while piloting an F-100. He was rescued by clinging to an AH-1 Cobra attack helicopter that landed at the crash site. In early assignments he instructed student pilots, ...
Peachtree Street" is a 1950 song co-written and recorded by Frank Sinatra in a duet with Rosemary Clooney. The song was released as a Columbia Records single. Frank Sinatra co-wrote the song with Leni Mason and Jimmy Saunders. Mason composed the music while Sinatra and Saunders wrote the lyrics. The song was arranged by George Siravo The song was released as an A side Columbia 10" 78 single, Catalog Number 38853, Matrix Number CO-43100-1 and as a 7" 33, 1-669. The B side was the re-issued "This Is the Night." Neither of the songs charted. The subject of the song is a stroll down the street in Atlanta, Georgia of the same name. Sinatra originally intended Dinah Shore to sing the duet with him. When Shore declined, Clooney was asked. The song was recorded on April 8, 1950. The song features spoken asides by Sinatra and Clooney. Rosemary Clooney asks: "Say, Frank, you wanna take a walk?" Frank Sinatra replies: "Sure, sweetie, just pick a street." He noted how there were no peach trees on the ...
... Neitz, W.O.; Du Toit, P. ... Bovine anaplasmosis : the transmission of Anaplasma marginale to a black wildebeest (Conochaetes gnu). Login ... 3. A. marginale neither lost its virulence not its characteristic morphology ·by passage through the black-wildebeest. 4. The ... 1. It was found that the black-wildebeest was susceptible to A. marginale but no clinical symptoms were noticed. 2. Neither P. ...
Em conclusão, os búfalos desenvolveram uma resposta imune humoral específica contra A. marginale e foram considerados ... O objetivo do presente estudo foi analisar a resposta imune humoral anti-Anaplasma marginale em búfalos (Bubalus bubalis) ... Detecção sorológica e molecular de Anaplasma marginale em búfalos na Ilha de Marajó, Pará. Silva, ... O objetivo do presente estudo foi analisar a resposta imune humoral anti-Anaplasma marginale em búfalos (Bubalus bubalis) ...
Anaplasma spp. was identified by PCR-msp5 and A. marginale was genotyped by PCR-msp1α. Prevalence of CT and C-ELISA positive ... Anaplasma spp. was identified by PCR-msp5 and A. marginale was genotyped by PCR-msp1α. Prevalence of CT and C-ELISA positive ... Se identificó Anaplasma spp. por PCR-msp5 y se genotipificó A. marginale mediante PCR-msp1α. Vacas de la región Espinal fueron ... Se identificó Anaplasma spp. por PCR-msp5 y se genotipificó A. marginale mediante PCR-msp1α. Vacas de la región Espinal fueron ...
Anaplasma marginale 1 * Anoxybacillus flavithermus 1 * Archaeoglobus fulgidus 1 * Arcobacter butzleri 1 ...
Methods:0 Anaplasma marginale in the cattle of South Gujarat, India was detected in the PCR and LAMP by amplifying the fragment ... marginale in the phylogram. Prevalence rate of A. marginale was significantly higher (p,0.05) in the PCR [43/280 (15.36%)] and ... Loop-mediated isothermal amplification assay for the rapid detection of Anaplasma marginale in cattle based on major surface ... A detection limit of PCR and LAMP was up to 10 -6 and 10 -8 of the original genomic DNA of A. marginale, respectively. A single ...
Anaplasma marginale ACR67104.1. Full length. Major surface protein 2. ND. −. −. Anaplasma marginale ACR67105.1. Full length. ... Anaplasma marginale. ACR67103.1. Full length. Major surface protein 2 variant 9H1. ND. +. −. ... the genera Anaplasma, Bartonella, Borrelia, Brucella, Burkholderia, Ehrlichia and Mycobacterium). In this set, 20% of the ...
... and Anaplasma marginale (0.20%). This study reports the first molecular identification of the above-mentioned Ehrlichia and ... Molecular survey of Anaplasma and Ehrlichia species in livestock ticks from Kassena-Nankana, Ghana; with a first report of ... This study identified Anaplasma and Ehrlichia species in ticks collected from livestock in the Kassena-Nankana Districts ... The pathogens identified were Ehrlichia canis (4.28%), Ehrlichia minasensis (1.63%), Anaplasma capra (0.81%) ...
Molecular detection of Anaplasma marginale in stable flies Stomoxys calcitrans (Diptera: Muscidae) feeding on a tick-free ... The obtained re-sults suggest that A. marginale transmission is carried out mechanically by S. calcitrans , favouring the ...
Anaplasma marginale. Aphtovirus. Bacillus anthracis. Bacteroides nodosus. Bordetella bronchiseptica. Brucella spp., especially: ...
The data presented in this paper demonstrate that Anaplasma marginale, a tick borne pathogen of cattle, can stably maintain a ... Technical Abstract: We tested the stability of transformed Anaplasma marginale during a complete in vivo infection cycle. ... Title: Stability and tick transmission phenotype of gfp-transformed Anaplasma marginale through a complete in vivo infection ... Stability and tick transmission phenotype of gfp-transformed Anaplasma marginale through a complete in vivo infection cycle. ...
SEROLOGIC EVIDENCE OF Anaplasma marginale INFECTION IN WHITE-TAILED DEER (Odocoileus virginianus) IN MISSOURI ... test for antibodies against Anaplasma marginale. The results indicated a low prevalence (1.14%) of MRCA reactors in the white- ...
... and other Anaplasma species (A. phagocytophilum, A. platys, A. marginale, A. ovis, A. centrale). ... marginale, A. ovis, A. centrale), Candidatus Neoehrlichia mikurensis, Ehrlichia ruminantium, E. canis, E. chaffeensis. We were ... In addition to Borrelia species, we were able to detect DNA from five species of Anaplasma (i.e. A. phagocytophilum, A. platys ... spielmanii [3], Anaplasma phagocytophilum, the spotted fever group of Rickettsia sp., and possibly Bartonella spp. and ...
Infection with Anaplasma marginale (bovine anaplasmosis) in tick free areas. *Infection with Babesia bovis, B. bigemina or B. ...
The emergence of ehrlichiae began in 1910, when Theiler described Anaplasma marginale, the etiologic agent of an economically ...
Bovine anaplasmosis, caused by the rickettsia Anaplasma marginale, has a worldwide distribution and is the cause of great ... Bovine anaplasmosis, caused by the rickettsia Anaplasma marginale, has a worldwide distribution and is the cause of great ...
It also is an experimental vector of Anaplasma marginale to cattle.. Another American one-host species, D albipictus, the ... D hunteri is an experimental vector of A marginale and A ovis. D parumapertus is a vector of a unique strain of Rickettsia ... D variabilis is an experimental vector of A marginale, B caballi, and B equi. In addition, sawgrass virus, Ehrlichia ... D andersoni is also the chief vector of Colorado tick fever virus and transmits Powassan virus, A marginale, A ovis, and the ...
Anaplasma marginale Ab [Presence] in Serum by Card agglutination. 20686-2. Anaplasma marginale Ab [Presence] in Serum by ... Anaplasma marginale DNA [Presence] in Tissue by NAA with probe detection. 22798-3. Anaplasma marginale rRNA [Presence] in ... Anaplasma marginale Ab [Presence] in Serum by Immunofluorescence. 22795-9. Anaplasma marginale Ab [Presence] in Serum by ... Anaplasma sp identified in Blood by Modified Giemsa stain. 23657-0. Anaplasma marginale Ab [Titer] in Serum by Complement ...
Anaplasmosis is caused by the bacterium Anaplasma marginale. It is an organism found in all states except Hawaii, and in many ...
Molly Burton - Prevalence and strain diversity of Anaplasma marginale in Kansas cattle herds ...
... marginale grew within parasitophorous vacuoles on ISE6 tick cells. Electron microscopy of blood was consistent with Anaplasma ... A Novel Anaplasma Sp. Associated with Anemia in Gopher Tortoises (Gopherus polyphemus) in Florida ... Pan-bacterial 16S rRNA PCR and sequencing of blood resulted in sequence consistent with a novel Anaplasma sp. For further ... Anaplasma are arthropod-borne obligate intracellular bacteria in the class Alphaproteobacteria, order Rickettsiales. Three ...
Anaplasma marginale infecta las células de la sangre y típicamente se identifica como ... READ MORE ... Marginale, Novilla, Parasito, Rancho, Rebaño, Sangre, Spanish, Torete, Toro, Tropical, UF, Vaca, Vacuno, Vaquilla ... Tags: Ag, Agricultura, Agro, Anaplasma, Anaplasmosis, Bacteria, Becerro, Bosques, Bovine, Bovino, County, Ectoparasitos, ...
Anaplasmosis is a tick-borne disease caused by an obligate gram-negative bacteria, Anaplasma (A.) marginale. This study reports ... A Report on Molecular Detection and Phylogenetic Evaluation of Anaplasma marginale in Ticks and Blood Samples Collected from ... on the seasonal prevalence, epidemiology and phylogeny of A. marginale in three breeds … ...
... and Anaplasma marginale. R (B) decoloratus is an efficient vector of B bigemina and A marginale but does not transmit B bovis ... where it is a competent experimental vector of Anaplasma marginale and A centrale. In eastern and northern Africa, R simus is ... It has also been reported to transmit Anaplasma marginale, Borrelia theileri, Rickettsia conorii, and Kerai, Wad Medani, and ... Brown dog ticks have been described as vectors of Anaplasma platys, Babesiosis in Animals read more Babesia canis, Ehrlichia ...
Anaplasma marginale. Cattle. Boophilus, Rhipicephalus, and other tick bites. Erythrocytes. Genogroup III ...
e anaplasma marginale e níveis de anticorpos anti-b. Bigemina, b. Bovis e a. Marginale, em bovinos leiteiros mestiços. Revista ... e anaplasma marginale e níveis de anticorpos anti-b. Bigemina, b. Bovis e a. Marginale, em bovinos leiteiros mestiços. Revista ... e anaplasma marginale e níveis de anticorpos anti-b. Bigemina, b. Bovis e a. Marginale, em bovinos leiteiros mestiços (1995) ... e anaplasma marginale e níveis de anticorpos anti-b. Bigemina, b. Bovis e a. Marginale, em bovinos leiteiros mestiços. Revista ...
species: Anaplasma marginale Theiler, 1910 Institution: Canadian Museum of Nature Collection: Canadian Museum of Nature ... species: Anaplasma marginale Theiler, 1910 Institution: Canadian Museum of Nature Collection: Canadian Museum of Nature ... species: Anaplasma centrale (ex Theiler, 1911) Ristic & Kreier, 1984 Institution: Canadian Museum of Nature Collection: ... species: Anaplasma centrale (ex Theiler, 1911) Ristic & Kreier, 1984 Institution: Canadian Museum of Nature Collection: ...
Anaplasma Phagocytophilum (1) Anaplasma Marginale - Isolation & Purification Anaplasma Marginale (1) Anaplasma Phagocytophilum ... Anaplasma marginale and Anaplasma phagocytophilum: Rickettsiales pathogens of veterinary and public health significance by Atif ...
valaisiana; Mycoplasma ovipneumoniane,, Chlamydia psittacii, Anaplasma marginale, Anaplasma ovis and pathogen-free tick DNA as ... valaisiana; Mycoplasma ovipneumoniane, Chlamydia psittacii infections, Anaplasma marginale, Anaplasma ovis and pathogen-free ... Meanwhile, Mycoplasma ovipneumoniane, Chlamydia psittacii, Anaplasma marginale, Anaplasma ovis and pathogen-free tick DNA as ... Anaplasma marginale and Anaplasma ovis, were provided by colleagues in Lanzhou Veterinary Research Institute, CAAS and used as ...
Anaplasma marginale. 2022 - Present. Johnes disease. 2022 - Present. Rabies. 2022 - Present. Other important Kansas diseases. ...
  • Bovine anaplasmosis, caused by the rickettsia Anaplasma marginale, has a worldwide distribution and is the cause of great economic losses in developing countries where it is highly endemic. (nih.gov)
  • Anaplasmosis is caused by the bacterium Anaplasma marginale. (dtnpf.com)
  • Anaplasmosis is a tick-borne disease caused by an obligate gram-negative bacteria, Anaplasma (A.) marginale. (lutzonilab.net)
  • Control of active infection of anaplasmosis caused by Anaplasma marginale susceptible to Chlortetracycline. (southwestmfa.com)
  • Anaplasmosis of sheep and goats is an arthropod-borne disease caused by the intra-erythrocytic rickettsial organism, Anaplasma ovis . (anipedia.org)
  • 4 Although a number of reports of Anaplasma infections in sheep and goats in Africa soon followed, 51, 52, 62 the report by Di Domizio in 1919 8 is considered to be the first authentic description of anaplasmosis in non-bovine hosts. (anipedia.org)
  • Anaplasma ovis is the main cause of ovine and caprine anaplasmosis. (anipedia.org)
  • The epidemiological role of trans-placental transmission of A. marginale in cattle was studied. (gob.ar)
  • 0 Anaplasma marginale in the cattle of South Gujarat, India was detected in the PCR and LAMP by amplifying the fragment of msp5 gene. (jvbd.org)
  • Thus LAMP can be a practical alternative to the PCR for the diagnosis of A . marginale infection in the cattle even in field condition. (jvbd.org)
  • The data presented in this paper demonstrate that Anaplasma marginale, a tick borne pathogen of cattle, can stably maintain a fluorescent marker during long-term persistent infection in the immunocompetent mammalian host and throughout a complete transmission cycle in the natural tick vector, Dermacentor andersoni. (usda.gov)
  • Similar to wild-type, the transformed A. marginale established infection in cattle, a natural reservoir host, and persisted in immune competent animals. (usda.gov)
  • It also is an experimental vector of Anaplasma marginale to cattle. (merckvetmanual.com)
  • First molecular characterization of Anaplasma marginale in cattle and Rhipicephalus (Boophilus) microplus ticks in Cebu, Philippines. (edu.ph)
  • Cattle whole blood and ticks infesting the cattle were collected for analysis of Anaplasma and Ehrlichia pathogens. (abroadexport.com)
  • 49 reported an Anaplasma infection in sheep that was not transmissible to cattle, and Lestoquard 22 differentiated the causative organism from the Anaplasma spp. (anipedia.org)
  • Anaplasma mesaeterum , the name proposed for a hitherto unrecognized anaplasm of sheep and goats, 63 is closely related to A. ovis and may also cause clinical disease in sheep and goats, but, unlike A. ovis , it appears to be less pathogenic for goats than for sheep and is not infective for cattle. (anipedia.org)
  • 63 Anaplasma marginale , a species pathogenic for cattle, may also, under certain circumstances, cause latent infection in sheep and goats. (anipedia.org)
  • 56 Anaplasma ovis and A. mesaeterum , on the other hand, appear to be immunologically more closely related, but cross-immunity is nevertheless incomplete, a situation somewhat reminiscent of the relationship between A. centrale and A. marginale in cattle. (anipedia.org)
  • The obtained re-sults suggest that A. marginale transmission is carried out mechanically by S. calcitrans , favouring the circulation and maintenance of the microorganism in this particular bovine herd. (semanticscholar.org)
  • The ultrastructure of the marginal bodies of A. ovis in sheep erythrocytes is very similar to that of A. marginale in bovine erythrocytes. (anipedia.org)
  • Bayesian and maximum likelihood phylogenetic analyses found that this agent was the most basal member of the Anaplasma clade tropic for erythrocytes, containing A. marginale , A. ovis , and A. centrale , all of which infect erythrocytes and cause clinically significant anemia in ruminants. (vin.com)
  • Comfirmantory PCR assays revealed the existence of Anaplasma bovis (13/144, 9.03%), Anaplasma centrale (2/144, 1.39%), Rickettsia heilongjiangensis (3/144, 2.08%), Rickettsia sp. (biomedcentral.com)
  • Ferner wurden alle Serumproben auf das Vorhandensein von Antikörpern gegenüber Theileria mutans, Babesia bigemina und Anaplasma marginale untersucht. (fu-berlin.de)
  • mutans, indicates that this antelope can also be utilized for separating these three parasites which usually occur together in South Africa and thus obtaining pure infection of A. marginale. (up.ac.za)
  • We tested the stability of transformed Anaplasma marginale during a complete in vivo infection cycle. (usda.gov)
  • The tick infection rate was indistinguishable from wild-type however there were significant lower levels of the transformed A. marginale in the tick. (usda.gov)
  • First molecular detection of Ehrlichia canis and Anaplasma platys in ticks from dogs in Cebu, Philippines. (edu.ph)
  • The assignment of reads to taxa based on BLASTN results revealed the existence of several potential pathogens, including Anaplasma spp. (biomedcentral.com)
  • A detection limit of PCR and LAMP was up to 10 -6 and 10 -8 of the original genomic DNA of A. marginale , respectively. (jvbd.org)
  • Anaplasma are arthropod-borne obligate intracellular bacteria in the class Alphaproteobacteria, order Rickettsiales . (vin.com)
  • 1 Bacteria morphologically similar to A. marginale grew within parasitophorous vacuoles on ISE6 tick cells. (vin.com)
  • It is the most pathogenic of the ANAPLASMA species. (bvsalud.org)
  • In Giemsa-stained blood smears A. ovis is morphologically indistinguishable from A. marginale , 56, 57 and appears as irregularly shaped, almost spherical, intra-erythrocytic granules staining a deep purple colour. (anipedia.org)
  • 34 Differences between A. ovis and A. marginale with regard to the intra-erythrocytic location of organisms have been found to be statistically significant. (anipedia.org)
  • 15, 30, 44 Development of A. ovis in sheep and goat erythrocytes, and in the tick vector, is presumably similar to the cycle of development proposed for A. marginale . (anipedia.org)
  • Apart from the morphological similarities, complete serological cross-reactivity has been demonstrated between A. ovis and A. marginale . (anipedia.org)
  • 1. It was found that the black-wildebeest was susceptible to A. marginale but no clinical symptoms were noticed. (up.ac.za)
  • 4. The fact that the black-wildebeest is susceptible to A. marginale but refractive to P. bigeminum and Th. (up.ac.za)
  • Specific TaqMan assays for the tortoise Anaplasma groEL and sucB genes were designed and validated, enabling rapid, specific, sensitive, and quantitative testing. (vin.com)
  • The clinical presentation of significant anemia associated with Anaplasma may have conservation implications. (vin.com)
  • Pan-bacterial 16S rRNA PCR and sequencing of blood resulted in sequence consistent with a novel Anaplasma sp. (vin.com)
  • Electron microscopy of blood was consistent with Anaplasma sp. (vin.com)
  • Complete genome sequencing of Anaplasma marginale reveals that the surface is skewed to two superfamilies of outer membrane proteins, Proc. (vetres.org)
  • Monophyletic lineage type relationship was observed with high bootstrap proportion among the msp5 DNA sequences of A . marginale in the phylogram. (jvbd.org)
  • 2007) Immunogenicity of Anaplasma marginale type IV secretion system proteins in a protective outer membrane vaccine . (emdmillipore.com)
  • Current msp5 DNA sequences of A . marginale (MW538962 and MW538961) showed 100% homology with the published sequences. (jvbd.org)
  • Anaplasma marginale is an etiologic agent of bovine anaplasmosis. (go.jp)
  • Beef Cattle (over 700 lb): Control of active infection of anaplasmosis caused by Anaplasma marginale susceptible to chlortetracycline. (nih.gov)
  • Beef and Non-Lactating Dairy Cattle: As an aid in control of active infection of anaplasmosis caused by Anaplasma marginale susceptible to chlortetracycline when delivered in a free-choice feed. (nih.gov)
  • Anaplasmosis is a tick-borne disease caused by an obligate gram-negative bacteria, Anaplasma (A.) marginale. (lutzonilab.net)
  • Anaplasma marginale is the most pathogenic species and is the causative agent of severe bovine anaplasmosis. (nih.gov)
  • Ehrlichiosis and anaplasmosis are a group of emerging zoonotic tick-borne infections caused by Ehrlichia and Anaplasma species, respectively. (mayocliniclabs.com)
  • They've recently been studying something fascinating: If a tick is infected by a non-disease causing strain of the bacteria Anaplasma marginale , its bite won't transmit anaplasmosis to its human victim. (wsu.edu)
  • The comparison of reverse line blot and serological results for four haemoparasites (T. parva, T. mutans, A. marginale and B. bigemina) indicated that, except for the mostly benign T. mutans, indigenous cattle seem capable of clearing infections of the three other, pathogenic parasites to below detectable levels. (ed.ac.uk)
  • A total of 171 animals were found positive for at least one pathogen by Giemsa-stained blood smears examinationTheileria annulata(136/299, 45.5%),Babesia bovis(14/299, 4.7%),B. bigemina(3/299, 1.0%) andAnaplasma marginale(12/299, 4.0%) were identified. (itg.be)
  • Serological survey of Babesia bovis, Babesia bigemina , and Anaplasma marginale antibodies in cattle from the semi-arid region of the state of Bahia, Brazil, by enzyme-linked immunosorbent assays. (ac.ir)
  • At the species level, only Rickettsia africae (human) and Anaplasma marginale (bovine) were consistently detected. (cirad.fr)
  • It is the most pathogenic of the ANAPLASMA species. (nih.gov)
  • There was very little coinfection of the two most common Anaplasma species, although they were commonly detected as coinfections with the Theileria parasites. (ed.ac.uk)
  • This study aimed to detect and characterize the species of Anaplasma present in domestic and wild ruminants in Zambia with a focus on the infection risk posed by the translocation of sable antelope (Hippotragus niger) from North-Western Province to Lusaka Province. (bvsalud.org)
  • Because hosts are usually seronegative in the initial phase of infection and serological cross-reactions with several Anaplasma species are observed after seroconversion, direct tests are the best approach for both case definition and epidemiological studies. (infektiologie.tirol)
  • Most commonly transmitted by ticks, A. marginale causes disease primarily in cattle. (alberta.ca)
  • This is because infection with A. marginale occurs only occasionally in temperate climate areas where environmental conditions favour the survival of the ticks that carry the micro-organism. (alberta.ca)
  • Ticks are biological vectors of A. marginale and the most common route of transmission. (alberta.ca)
  • They review the direct laboratory tests (microscopy, nucleic acid-based detection and in vitro isolation) currently used for Anaplasma detection in ticks and vertebrates and their application. (infektiologie.tirol)
  • Detection of Anaplasma marginale by real time PCR. (tamu.edu)
  • Guidelines for the Direct Detection of Anaplasma spp. (infektiologie.tirol)
  • Canine Elisa Laboratories manufactures the canine anaplasma elisa kits reagents distributed by Genprice. (elevagemrmagoo.com)
  • The method detected A. marginale from the positive DNA samples obtained from different countries, while no amplicons were observed from DNA samples of several other bovine blood pathogens tested. (go.jp)
  • The present study successfully established a new nPCR assay that can detect A. marginale , and reported the first molecular detection and characterization of A. marginale and an Anaplasma sp. (go.jp)
  • Molecular characterization and phylogenic analysis of Anaplasma spp. (vetmedmosul.com)
  • Rickettsiales of the genus Anaplasma are globally distributed tick-borne pathogens of animals and humans with complex epidemiological cycles. (bvsalud.org)
  • Sequence and immunologic conservation of Anaplasma marginale OmpA within strains from Ghana as compared to the predominant OmpA variant. (uidaho.edu)
  • The results indicated high prevalences of Theileria mutans (71.6%), T. velifera (62.8%), Anaplasma sp. (ed.ac.uk)
  • Theileria can be confused with Anaplasma marginale infections because both cause anemia. (harlanenterprise.net)
  • The presence of A. marginale may be confirmed by identifying the organism in a stained blood smear from a sick animal. (alberta.ca)
  • Anaplasma infections are usually challenging to diagnose, clinically presenting with nonspecific symptoms that vary greatly depending on the agent involved, the affected host, and other factors such as immune status and coinfections. (infektiologie.tirol)
  • A highly specific and sensitive nested PCR (nPCR) method based on the Msp5 gene was developed to detect A. marginale ( Msp5 nPCR). (go.jp)
  • The Canine Anaplasma Elisa Kits reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. (elevagemrmagoo.com)
  • Major surface protein 2 of A. marginale is an immunodominant outer membrane protein of approximately 40 kDa. (medscape.com)