Laboratories: Facilities equipped to carry out investigative procedures.Amylases: A group of amylolytic enzymes that cleave starch, glycogen, and related alpha-1,4-glucans. (Stedman, 25th ed) EC 3.2.1.-.Diagnostic Techniques and Procedures: Methods, procedures, and tests performed to diagnose disease, disordered function, or disability.Menu PlanningPlasticizers: Materials incorporated mechanically in plastics (usually PVC) to increase flexibility, workability or distensibility; due to the non-chemical inclusion, plasticizers leach out from the plastic and are found in body fluids and the general environment.Laboratory Animal Science: The science and technology dealing with the procurement, breeding, care, health, and selection of animals used in biomedical research and testing.Abbreviations as Topic: Shortened forms of written words or phrases used for brevity.Pathology, Surgical: A field of anatomical pathology in which living tissue is surgically removed for the purpose of diagnosis and treatment.Diethylhexyl Phthalate: An ester of phthalic acid. It appears as a light-colored, odorless liquid and is used as a plasticizer for many resins and elastomers.Animals, LaboratoryGastroenterology: A subspecialty of internal medicine concerned with the study of the physiology and diseases of the digestive system and related structures (esophagus, liver, gallbladder, and pancreas).Abdominal Pain: Sensation of discomfort, distress, or agony in the abdominal region.Pancreatitis: INFLAMMATION of the PANCREAS. Pancreatitis is classified as acute unless there are computed tomographic or endoscopic retrograde cholangiopancreatographic findings of CHRONIC PANCREATITIS (International Symposium on Acute Pancreatitis, Atlanta, 1992). The two most common forms of acute pancreatitis are ALCOHOLIC PANCREATITIS and gallstone pancreatitis.Pancreas: A nodular organ in the ABDOMEN that contains a mixture of ENDOCRINE GLANDS and EXOCRINE GLANDS. The small endocrine portion consists of the ISLETS OF LANGERHANS secreting a number of hormones into the blood stream. The large exocrine portion (EXOCRINE PANCREAS) is a compound acinar gland that secretes several digestive enzymes into the pancreatic ductal system that empties into the DUODENUM.Condiments: Aromatic substances added to food before or after cooking to enhance its flavor. These are usually of vegetable origin.Endoscopes: Instruments for the visual examination of interior structures of the body. There are rigid endoscopes and flexible fiberoptic endoscopes for various types of viewing in ENDOSCOPY.Duodenoscopy: Endoscopic examination, therapy or surgery of the luminal surface of the duodenum.Dyspepsia: Impaired digestion, especially after eating.Hyperamylasemia: A condition with abnormally elevated level of AMYLASES in the serum. Hyperamylasemia due to PANCREATITIS or other causes may be differentiated by identifying the amylase isoenzymes.Electronic Mail: Messages between computer users via COMPUTER COMMUNICATION NETWORKS. This feature duplicates most of the features of paper mail, such as forwarding, multiple copies, and attachments of images and other file types, but with a speed advantage. The term also refers to an individual message sent in this way.Food Dispensers, Automatic: Mechanical food dispensing machines.Editorial Policies: The guidelines and policy statements set forth by the editor(s) or editorial board of a publication.Authorship: The profession of writing. Also the identity of the writer as the creator of a literary production.Periodicals as Topic: A publication issued at stated, more or less regular, intervals.Postal Service: The functions and activities carried out by the U.S. Postal Service, foreign postal services, and private postal services such as Federal Express.Internet: A loose confederation of computer communication networks around the world. The networks that make up the Internet are connected through several backbone networks. The Internet grew out of the US Government ARPAnet project and was designed to facilitate information exchange.Legislation, Food: Laws and regulations concerned with industrial processing and marketing of foods.Publishing: "The business or profession of the commercial production and issuance of literature" (Webster's 3d). It includes the publisher, publication processes, editing and editors. Production may be by conventional printing methods or by electronic publishing.Job Application: Process of applying for employment. It includes written application for employment or personal appearance.Ascorbic Acid Deficiency: A condition due to a dietary deficiency of ascorbic acid (vitamin C), characterized by malaise, lethargy, and weakness. As the disease progresses, joints, muscles, and subcutaneous tissues may become the sites of hemorrhage. Ascorbic acid deficiency frequently develops into SCURVY in young children fed unsupplemented cow's milk exclusively during their first year. It develops also commonly in chronic alcoholism. (Cecil Textbook of Medicine, 19th ed, p1177)Pancreatitis, Chronic: INFLAMMATION of the PANCREAS that is characterized by recurring or persistent ABDOMINAL PAIN with or without STEATORRHEA or DIABETES MELLITUS. It is characterized by the irregular destruction of the pancreatic parenchyma which may be focal, segmental, or diffuse.Pancreatic Elastase: A protease of broad specificity, obtained from dried pancreas. Molecular weight is approximately 25,000. The enzyme breaks down elastin, the specific protein of elastic fibers, and digests other proteins such as fibrin, hemoglobin, and albumin. EC 3.4.21.36.Leukocyte Elastase: An enzyme that catalyzes the hydrolysis of proteins, including elastin. It cleaves preferentially bonds at the carboxyl side of Ala and Val, with greater specificity for Ala. EC 3.4.21.37.Exocrine Pancreatic Insufficiency: A malabsorption condition resulting from greater than 10% reduction in the secretion of pancreatic digestive enzymes (LIPASE; PROTEASES; and AMYLASE) by the EXOCRINE PANCREAS into the DUODENUM. This condition is often associated with CYSTIC FIBROSIS and with chronic PANCREATITIS.Liver Function Tests: Blood tests that are used to evaluate how well a patient's liver is working and also to help diagnose liver conditions.Pancreatitis, Alcoholic: Acute or chronic INFLAMMATION of the PANCREAS due to excessive ALCOHOL DRINKING. Alcoholic pancreatitis usually presents as an acute episode but it is a chronic progressive disease in alcoholics.MedlinePlus: NATIONAL LIBRARY OF MEDICINE service for health professionals and consumers. It links extensive information from the National Institutes of Health and other reviewed sources of information on specific diseases and conditions.Saliva: The clear, viscous fluid secreted by the SALIVARY GLANDS and mucous glands of the mouth. It contains MUCINS, water, organic salts, and ptylin.Isoamylase: An enzyme that hydrolyzes 1,6-alpha-glucosidic branch linkages in glycogen, amylopectin, and their beta-limit dextrins. It is distinguished from pullulanase (EC 3.2.1.41) by its inability to attack pullulan and by the feeble action of alpha-limit dextrins. It is distinguished from amylopectin 6-glucanohydrolase (EC 3.2.1.69) by its action on glycogen. With EC 3.2.1.69, it produces the activity called "debranching enzyme". EC 3.2.1.68.alpha-Amylases: Enzymes that catalyze the endohydrolysis of 1,4-alpha-glycosidic linkages in STARCH; GLYCOGEN; and related POLYSACCHARIDES and OLIGOSACCHARIDES containing 3 or more 1,4-alpha-linked D-glucose units.Parotid Gland: The largest of the three pairs of SALIVARY GLANDS. They lie on the sides of the FACE immediately below and in front of the EAR.Ceruletide: A specific decapeptide obtained from the skin of Hila caerulea, an Australian amphibian. Caerulein is similar in action and composition to CHOLECYSTOKININ. It stimulates gastric, biliary, and pancreatic secretion; and certain smooth muscle. It is used in paralytic ileus and as diagnostic aid in pancreatic malfunction.Origanum: A plant genus of the family LAMIACEAE that is the source of a familiar food seasoning.Photometry: Measurement of the various properties of light.Starch: Any of a group of polysaccharides of the general formula (C6-H10-O5)n, composed of a long-chain polymer of glucose in the form of amylose and amylopectin. It is the chief storage form of energy reserve (carbohydrates) in plants.Enzymes: Biological molecules that possess catalytic activity. They may occur naturally or be synthetically created. Enzymes are usually proteins, however CATALYTIC RNA and CATALYTIC DNA molecules have also been identified.Kinetics: The rate dynamics in chemical or physical systems.Emetics: Agents that cause vomiting. They may act directly on the gastrointestinal tract, bringing about emesis through local irritant effects, or indirectly, through their effects on the chemoreceptor trigger zone in the postremal area near the medulla.Mathematics: The deductive study of shape, quantity, and dependence. (From McGraw-Hill Dictionary of Scientific and Technical Terms, 6th ed)Names: Personal names, given or surname, as cultural characteristics, as ethnological or religious patterns, as indications of the geographic distribution of families and inbreeding, etc. Analysis of isonymy, the quality of having the same or similar names, is useful in the study of population genetics. NAMES is used also for the history of names or name changes of corporate bodies, such as medical societies, universities, hospitals, government agencies, etc.Therapeutic Equivalency: The relative equivalency in the efficacy of different modes of treatment of a disease, most often used to compare the efficacy of different pharmaceuticals to treat a given disease.Marketing: Activity involved in transfer of goods from producer to consumer or in the exchange of services.Advertising as Topic: The act or practice of calling public attention to a product, service, need, etc., especially by paid announcements in newspapers, magazines, on radio, or on television. (Random House Unabridged Dictionary, 2d ed)Formularies as Topic: Works about lists of drugs or collections of recipes, formulas, and prescriptions for the compounding of medicinal preparations. Formularies differ from PHARMACOPOEIAS in that they are less complete, lacking full descriptions of the drugs, their formulations, analytic composition, chemical properties, etc. In hospitals, formularies list all drugs commonly stocked in the hospital pharmacy.Drug Labeling: Use of written, printed, or graphic materials upon or accompanying a drug container or wrapper. It includes contents, indications, effects, dosages, routes, methods, frequency and duration of administration, warnings, hazards, contraindications, side effects, precautions, and other relevant information.Drug Industry: That segment of commercial enterprise devoted to the design, development, and manufacture of chemical products for use in the diagnosis and treatment of disease, disability, or other dysfunction, or to improve function.Encyclopedias as Topic: Works containing information articles on subjects in every field of knowledge, usually arranged in alphabetical order, or a similar work limited to a special field or subject. (From The ALA Glossary of Library and Information Science, 1983)EncyclopediasDictionaries, MedicalDictionaries as Topic: Lists of words, usually in alphabetical order, giving information about form, pronunciation, etymology, grammar, and meaning.Molecular Sequence Annotation: The addition of descriptive information about the function or structure of a molecular sequence to its MOLECULAR SEQUENCE DATA record.Databases, Genetic: Databases devoted to knowledge about specific genes and gene products.Transcriptome: The pattern of GENE EXPRESSION at the level of genetic transcription in a specific organism or under specific circumstances in specific cells.Gene Ontology: Sets of structured vocabularies used for describing and categorizing genes, and gene products by their molecular function, involvement in biological processes, and cellular location. These vocabularies and their associations to genes and gene products (Gene Ontology annotations) are generated and curated by the Gene Ontology Consortium.Library Services: Services offered to the library user. They include reference and circulation.Libraries, MedicalHealth Status: The level of health of the individual, group, or population as subjectively assessed by the individual or by more objective measures.Public Health: Branch of medicine concerned with the prevention and control of disease and disability, and the promotion of physical and mental health of the population on the international, national, state, or municipal level.Delivery of Health Care: The concept concerned with all aspects of providing and distributing health services to a patient population.Reproducibility of Results: The statistical reproducibility of measurements (often in a clinical context), including the testing of instrumentation or techniques to obtain reproducible results. The concept includes reproducibility of physiological measurements, which may be used to develop rules to assess probability or prognosis, or response to a stimulus; reproducibility of occurrence of a condition; and reproducibility of experimental results.Calcium Carbonate: Carbonic acid calcium salt (CaCO3). An odorless, tasteless powder or crystal that occurs in nature. It is used therapeutically as a phosphate buffer in hemodialysis patients and as a calcium supplement.Polymers: Compounds formed by the joining of smaller, usually repeating, units linked by covalent bonds. These compounds often form large macromolecules (e.g., BIOPOLYMERS; PLASTICS).Hydrochloric Acid: A strong corrosive acid that is commonly used as a laboratory reagent. It is formed by dissolving hydrogen chloride in water. GASTRIC ACID is the hydrochloric acid component of GASTRIC JUICE.Engraving and EngravingsRare BooksAggression: Behavior which may be manifested by destructive and attacking action which is verbal or physical, by covert attitudes of hostility or by obstructionism.Gas, Natural: A combustible, gaseous mixture of low-molecular weight PARAFFIN hydrocarbons, generated below the surface of the earth. It contains mostly METHANE and ETHANE with small amounts of PROPANE; BUTANES; and higher hydrocarbons, and sometimes NITROGEN; CARBON DIOXIDE; HYDROGEN SULFIDE; and HELIUM. (from McGraw-Hill Dictionary of Scientific and Technical Terms, 6th ed)Water Wells: Constructions built to access underground water.

The structure of a glycopeptide (GP-II) isolated from Rhizopus saccharogenic amylase. (1/1858)

Mild alkaline treatment of glycopeptide (GP-II) resulted in the loss of 1 mole of serine and 5 moles of threonine per mole of GP-II, suggesting the presence of O-glycosyl bonds between 1 serine and 5 threonine residues and carbohydrate chains. Treatment of GP-II with alkaline borohydride released only disaccharide. Methylation studies of the carbohydrate moiety gave 2,3,4,6-tetra-O-methyl and 2,4,6-tri-O-methyl derivatives of mannose in a ratio of approximately 1:1. In addition, one step of Smith degradation resulted in the loss of about 6 residues of mannose per mole of GP-II. Moreover, alpha-mannosidase [EC 3.2.1.24] liberated about 6 residles of mannose per mole of GP-II. On the basis of these data, the structure of the carbohydrate moiety of GP-II was confirmed to be 3-O-alpha-mannosylmannose. The amino- and carboxyl-terminal amino acids of GP-II were determined to be threonine and serine, respectively. On reductive cleavage of N-proline bonds with metallic sodium in liquid ammonia, 2 moles of alanine per mole of GP-II were lost. From the compositions of three fragments isolated from the reductive cleavage products, the amino acid sequence of the peptide portion of GP-II was determined. Based on these data, a probable structure was proposed for GP-II.  (+info)

Purification of gibberellic acid-induced lysosomes from wheat aleurone cells. (2/1858)

Using isopycnic density gradient centrifugation, lysosomes were concentrated in a single region of a sucrose-Ficoll gradient (p = 1-10 g cm-3), well separated from most other cell organelles. Gibberellic acid-induced lysosomes were found to be rich in alpha-amylase and protease but not ribonuclease. The lysosomal band also contained a majority of the NADH2-cytochrome c reductase, a marker enzyme for endoplasmic reticulum, found in the gradient. Examination of electron micrographs revealed that a purified band of lyosomes contained at least 3 vesicle types, ranging in size from 0-1 to 0-5 mum. The significance of these findings to proposed mechanisms of action of gibberellic acid is discussed.  (+info)

Detection of viruses and body fluids which may contain viruses in the domestic environment. (3/1858)

The domestic environment was investigated for the presence of viruses and body fluids that may contain viruses. A range of surfaces in 39 homes (17 visited on 2 occasions) were sampled by swabbing and analysed using cell culture, reverse transcription polymerase chain reaction for enteroviral RNA, haemoglobin as a marker for blood, amylase as an indicator of urine, saliva and sweat, and protein as an indicator of general hygiene. Haemoglobin was found on 1.9% of surfaces sampled and of the positive samples 30% were from articles frequently handled. Amylase (> 5 U/l) was found in 29.3% of samples tested. Protein was found in 97.8% of samples tested. Enteroviral RNA, indicating the presence of virus, was detected in 3 out of 448 samples tested; they were from a tap handle, telephone handpiece and a toilet bowl. No viruses were isolated in cell culture, however significant problems were encountered with bacterial and fungal contamination. This work demonstrates that only testing environmental samples for bacteria and ATP may not give a total view of the microbiological problem in the home. A range of test methods is useful to gain a broad view of the problems of hygiene in the home and to allow comparative studies of specific areas such as the kitchen and bathroom.  (+info)

Underestimation of acute pancreatitis: patients with only a small increase in amylase/lipase levels can also have or develop severe acute pancreatitis. (4/1858)

BACKGROUND: In most treatment studies on acute pancreatitis, pancreatologists base their diagnosis on amylase/lipase levels more than three times above the upper limit of normal (>3n) and thus exclude patients with smaller enzyme level increases. The recommendations derived from the results of treatment studies do not take into account such patients. Non-pancreatologists frequently believe that only patients with high enzyme levels have a serious prognosis. AIMS: To question the assumption that high enzyme levels indicate severe, and conversely low enzyme levels indicate mild, acute pancreatitis. PATIENTS/METHODS: This retrospective study includes 284 consecutive patients with a first attack of acute pancreatitis. The cause was biliary in 114 (40%) patients, alcoholism in 83 (29%), other in 21 (7%), and unknown in 66 (23%). Patients were divided into two groups according to their serum enzyme levels (amylase: 3n, n = 196; lipase: 3n, n = 233). Renal impairment, indication for dialysis and artificial ventilation, development of pseudocysts, necessity for surgery, and mortality were taken as parameters of severity. RESULTS: The incidence of severity was the same for both the 3n groups. CONCLUSIONS: The severity of acute pancreatitis is independent of the elevation in serum amylase/lipase level (3n) on admission. Patients with only a slight increase can also have or develop severe acute pancreatitis. Patients with +info)

Genetic regulation of tissue-specific expression of amylase structural genes in Drosophila melanogaster. (5/1858)

Laboratory strains of Drosophila melanogaster were screened for spatial variations in adult midgut alpha-amylase (1,4-alpha-D-glucan glucanohydrolase, EC 3.2.1.1) expression. No strain-specific differences were found anteriorly, but three patterns of activity were discerned in the posterior midgut: A, activity throughout most of the region; B, activity in the anterior part of the region; and C, little or no activity. Alleles of a control gene, map, are responsible for this tissue-specific regulation of activity; e.g., mapA homozygotes produce the A pattern and mapC homozygotes the C pattern. The map locus was placed at 2--80 +/- on the genetic map of chromosome 2R, about two crossover units distal to the Amy structural gene region for alpha-amylase. Electrophoretic studies showed that mapA is trans acting in mapA/mapC flies, allowing expression of amylase isozymes coded for by genes on the opposite chromosome. The map gene behaves as a temporal gene that is clearly separable from the tightly linked, duplicated Amy structural genes.  (+info)

Modes of action of acarbose hydrolysis and transglycosylation catalyzed by a thermostable maltogenic amylase, the gene for which was cloned from a Thermus strain. (6/1858)

A maltogenic amylase gene was cloned in Escherichia coli from a gram-negative thermophilic bacterium, Thermus strain IM6501. The gene encoded an enzyme (ThMA) with a molecular mass of 68 kDa which was expressed by the expression vector p6xHis119. The optimal temperature of ThMA was 60 degrees C, which was higher than those of other maltogenic amylases reported so far. Thermal inactivation kinetic analysis of ThMA indicated that it was stabilized in the presence of 10 mM EDTA. ThMA harbored both hydrolysis and transglycosylation activities. It hydrolyzed beta-cyclodextrin and starch mainly to maltose and pullulan to panose. ThMA not only hydrolyzed acarbose, an amylase inhibitor, to glucose and pseudotrisaccharide (PTS) but also transferred PTS to 17 sugar acceptors, including glucose, fructose, maltose, cellobiose, etc. Structural analysis of acarbose transfer products by using methylation, thin-layer chromatography, high-performance ion chromatography, and nuclear magnetic resonance indicated that PTS was transferred primarily to the C-6 of the acceptors and at lower degrees to the C-3 and/or C-4. The transglycosylation of sugar to methyl-alpha-D-glucopyranoside by forming an alpha-(1,3)-glycosidic linkage was demonstrated for the first time by using acarbose and ThMA. Kinetic analysis of the acarbose transfer products showed that the C-4 transfer product formed most rapidly but readily hydrolyzed, while the C-6 transfer product was stable and accumulated in the reaction mixture as the main product.  (+info)

Ultrastructural analysis of some functional aspects of Xenopus laevis pancreas during development and metamorphosis. (7/1858)

Morphological studies using both light and electron microscope were carried out with the aim of characterizing cells present in the larval and adult pancreas of Xenopus laevis. The following cell types have been seen: (1) exocrine cells, with a very well developed r.e.r. (rough endoplasmic reticulum), well defined Golgi complexes and numerous large secretory granules (A cells); (2) cells without either r.e.r. or secretory granules but with a large number of well developed mitochondria (B cells); (3) endocrine cells often clustered in the typical islets and with small membrane-coated granules showing a very dense central core surrounded by a light halo (C cells). During development, the aspect is seen to change from an unorganized tissue in which the acinar structures are still not clearly visible (stage 42), to a more organized form in which the exocrine cells (A cells) are seen to be arranged around the lumen of the acinus together with some B cells. At the stages 54-56, an increasing number of acini surrounded both by A and B cells was observed. At about stage 61, large quantities of necrotic cells were seen and it became more difficult to individualize the acinar organization found in the preceding stages. Finally, there are no necrotic cells in the adult but only A, B cells which are organized in well developed acinar structures and C cells. The investigation also included a study of some pancreatic enzymes (lipase and amylase) synthesized during larval life. Lipase activity shows a peak at stage 54-56 in which the most well organized tissue of the entire larval life was observed. The activity then decreases, reaching a minimum at stage 66, after which it rapidly rises. Maximum amylase activity occurs at stage 51 after which there is a decrease, to a minimum at stage 66. The activity then remains at constant level.  (+info)

A monoclonal anti-interleukin 8 antibody (WS-4) inhibits cytokine response and acute lung injury in experimental severe acute necrotising pancreatitis in rabbits. (8/1858)

BACKGROUND: Interleukin 8 (IL-8) has recently been proposed to have an important role in mediating the development of the systemic sequelae associated with severe acute pancreatitis. AIMS: To define the role of IL-8 in acute pancreatitis by neutralising its effects with a monoclonal anti-IL-8 antibody (WS-4), in a rabbit model of severe acute pancreatitis. METHODS: Acute pancreatitis was induced by retrograde injection of 5% chenodeoxycholic acid into the pancreatic duct and duct ligation. Twenty rabbits were divided equally into two groups: acute pancreatitis controls received physiological saline and the treated group received WS-4, 30 minutes before induction of acute pancreatitis. RESULTS: Pretreatment of animals with WS-4 resulted in significant down regulation of serum IL-8 and tumour necrosis factor alpha (TNF-alpha) from three to six hours after induction of acute pancreatitis (p = 0.011 and 0.047 for IL-8 and 0.033 and 0.022 for TNF-alpha, respectively). In addition, a significant reduction in the CD11b and CD18 positive cells and the amount of interstitial neutrophil infiltration in the lungs from WS-4 treated animals was seen. In contrast, WS-4 did not alter the amount of pancreatic necrosis and the serum concentrations of amylase, lipase, calcium, and glucose. CONCLUSION: WS-4 cannot change the amount of pancreatic necrosis induced by injection of 5% bile acid, but does reduce the acute lung injury, presumably through inhibition of circulating IL-8 and TNF-alpha, and CD11b/CD18 in lung tissue. Therefore, a role of IL-8 in the progression of acute pancreatitis and the development of its systemic complications is suggested.  (+info)

*Accessory pancreas

Urine amylase and renal amylase clearance tests may also be ordered. Stool specimens may be analyzed for fat content. The ... Specific blood studies used to assess pancreatic function include measurements of serum amylase, lipase, glucose, calcium, and ...

*Acute pancreatitis

Reasons for false positive elevated serum amylase include salivary gland disease (elevated salivary amylase), bowel obstruction ... Lin, X. Z.; Wang, S. S.; Tsai, Y. T.; Lee, S. D.; Shiesh, S. C.; Pan, H. B.; Su, C. H.; Lin, C. Y. (1989). "Serum amylase, ... Serum amylase may be normal (in 10% of cases) for cases of acute or chronic pancreatitis (depleted acinar cell mass) and ... If the lipase level is about 2.5 to 3 times that of amylase, it is an indication of pancreatitis due to alcohol.Decreased serum ...

*B-amylase

The optimum pH for β-amylase is 4.0-5.0 Amylase Alpha-amylase Rejzek, M.; Stevenson, C. E.; Southard, A. M.; Stanley, D.; ... β-amylase is present in an inactive form prior to seed germination. Many microbes also produce amylase to degrade extracellular ... Beta-amylase (EC 3.2.1.2, saccharogen amylase, glycogenase) is an enzyme with the systematic name 4-alpha-D-glucan ... doi:10.1016/s0096-5332(08)60139-3. "Amylase, Alpha" , I.U.B.: 3.2.1.11,4-α-D-Glucan glucanohydrolase. Beta-amylase at the US ...

*Alpha-amylase

See amylase for more uses of the amylase family in general. α-Amylase has exhibited efficacy in degrading polymicrobial ... Medical laboratories will usually measure either pancreatic amylase or total amylase. If only pancreatic amylase is measured, ... In humans, all amylase isoforms link to chromosome 1p21 (see AMY1A). Amylase is found in saliva and breaks starch into maltose ... The alpha-Amylase Protein alpha-Amylase at the US National Library of Medicine Medical Subject Headings (MeSH) This article ...

*Alpha amylase inhibitor

In molecular biology, alpha-amylase inhibitor is a protein family which inhibits mammalian alpha-amylases specifically, by ... The binding of tendamistat to alpha-amylase leads to the steric blockage of the active site of the enzyme. The crystal ... This family of inhibitors has no action on plant and microbial alpha amylases. A crystal structure has been determined for ... König V, Vértesy L, Schneider TR (October 2003). "Structure of the alpha-amylase inhibitor tendamistat at 0.93 A". Acta ...

*List of amylase induced fermentations

This is a list of amylase induced fermentations. Saliva can be used as a source of the enzyme amylase to break down complex ...

*Arthur W. Thomas

Sherman, H. C., & Thomas, A. W. (1915). Studies on amylases. VIII. The influence of certain acids and salts upon the activity ... Thomas, A. W. (1917). A noteworthy effect of bromides upon the action of malt amylase. Journal of the American Chemical Society ... Isoelectric point of malt amylase. Journal of the American Chemical Society, 46, 1711-6. Thomas, A. W., & Kelly, M. W. (1925). ... Influence of hydrogen-ion concentration upon enzymatic activity of three typical amylases. Journal of the American Chemical ...

*Oligosaccharide 4-alpha-D-glucosyltransferase

Characterization of amylases". Biol. Chem. Hoppe-Seyler. 367 (3): 169-76. doi:10.1515/bchm3.1986.367.1.169. PMID 2423098. ... Other names in common use include amylase III, and 1,4-alpha-glucan:1,4-alpha-glucan 4-alpha-glucosyltransferase. Nebinger P ( ... Nebinger P (1986). "Separation and characterization of four different amylases of Entamoeba histolytica. II. ... 1986). "Separation and characterization of four different amylases of Entamoeba histolytica. I. Purification and properties". ...

*Exoenzyme

The different classes of amylases are α-amylases, β-amylases, and glucoamylases. The α-amylases hydrolyze starch by randomly ... In humans, amylases are secreted by both the pancreas and salivary glands with both sources of the enzyme required for complete ... Amylase breaks down carbohydrates into mono- and disaccharides, so a starch agar must be used for this assay. Once the bacteria ... Since iodine binds to starch but not its digested byproducts, a clear area will appear where the amylase reaction has occurred ...

*Reference ranges for blood tests

"Reference range (amylase)". GPnotebook. Ageno W, Finazzi S, Steidl L, et al. (2002). "Plasma measurement of D-dimer levels for ...

*ase

Amylase DNA polymerase. ...

*Glucan 1,4-a-glucosidase

Glucan 1,4-alpha-glucosidase (EC 3.2.1.3, glucoamylase, amyloglucosidase (AMG), gamma-amylase, lysosomal alpha-glucosidase, ... Tsujisaka, Y.; Fukimoto, J.; Yamamoto, T. (1958). "Specificity of crystalline saccharogenic amylase of moulds". Nature. 181: ... Amylase French, D.; Knapp, D.W. (1950). "The maltase of Clostridium acetobutylicum". J. Biol. Chem. 187: 463-471. PMID 14803428 ... acid maltase, exo-1,4-alpha-glucosidase, glucose amylase, gamma-1,4-glucan glucohydrolase, acid maltase, 1,4-alpha-D-glucan ...

*Plant defensin

Richardson M, Bloch Jr C (1991). "A new family of small (5 kDa) protein inhibitors of insect alpha-amylases from seeds or ... Inhibitors of insect alpha-amylases from sorghum. Probable protease inhibitor P322 from Solanum tuberosum (Potato). A ...

*Croissant

Goesaert, Hans; Slade, Louise; Levine, Harry; Delcour, Jan A. (2009-11-01). "Amylases and bread firming - an integrated view". ...

*Cervix

... enzymes such as amylase; and prostaglandins. Its consistency is determined by the influence of the hormones estrogen and ...

*Caldimonas taiwanensis

nov., a amylase producing bacterium isolated from a hot spring". Systematic and applied microbiology. 28 (5): 415-20. doi: ... Caldimonas taiwanensis produces amylase. Parte, A.C. "Caldimonas". www.bacterio.net. "Caldimonas taiwanensis Taxon Passport - ...

*Arthrobacter psychrolactophilus

... produces amylase. Smith, Michael R.; Zahnley, James C. (19 August 2005). "Characteristics of ... doi:10.1007/s10295-005-0015-x. Smith, Michael R.; Zahnley, James C. (2 June 2005). "Production of amylase by Arthrobacter ... "Characteristics of the amylase of Arthrobacter psychrolactophilus". Journal of Industrial Microbiology & Biotechnology. 32 (10 ... the amylase of Arthrobacter psychrolactophilus". Journal of Industrial Microbiology & Biotechnology. 32 (10): 439-448. doi: ...

*Mumps

Amylase: The Test Archived 29 March 2009 at the Wayback Machine., Lab Tests Online UK Skrha J, Stĕpán J, Sixtová E (October ... As with any inflammation of the salivary glands, the serum level of the enzyme amylase is often elevated. The most common ... 1979). "Amylase isoenzymes in mumps". Eur. J. Pediatr. 132 (2): 99-105. doi:10.1007/BF00447376. PMID 499265. Offit PA (2007). ...

*Philosophy of eating

The micronutrients amylases, proteases, and lipases aid digestion. to a variety of shared characteristics of the origins of ...

*Red imported fire ant

The midgut also contains amylases, roteases and upases. The narrow cells in its reservoir have little to no function in ... which includes proteases and amylases that function as an extraintestinal digestion of solid food. ...

*Beer chemistry

This heating process activates protein enzymes called amylases. The shape of these enzymes, their active site, gives them the ...

*Pancreatic fistula

An elevated amylase level, usually > 1,000 IU/L, with protein levels over 3.0 g/dL is diagnostic. Serum amylase is often ...

*Edmond H. Fischer

Fischer worked on alpha-amylase. After his PhD, Fischer went to the United States in 1950 for postdoctoral research. He was ...

*Glycoside hydrolase family 14

Beta-amylase is present in certain bacteria as well as in plants. Three highly conserved sequence regions are found in all ... Beta-amylase is an enzyme that hydrolyzes 1,4-alpha-glucosidic linkages in starch-type polysaccharide substrates so as to ... The 3D structure of a complex of soybean beta-amylase with an inhibitor (alpha-cyclodextrin) has been determined to 3.0A ... Glycoside hydrolase family 14 CAZY GH_14 comprises enzymes with only one known activity; beta-amylase (EC 3.2.1.2). A Glu ...

*Starch

Alpha-amylases are found in plants and in animals. Human saliva is rich in amylase, and the pancreas also secretes the enzyme. ... This process is important in the digestion of starch and is also used in brewing, where amylase from the skin of seed grains is ... Marc, A.; Engasser, J. M.; Moll, M.; Flayeux, R. (1983-02-01). "A kinetic model of starch hydrolysis by α- and β-amylase during ... Individuals from populations with a high-starch diet tend to have more amylase genes than those with low-starch diets; Beta- ...
Genetic stability of amylase activity after serial subcultivation experiments with amylolytic ruminalStreptococcus bovis strains was investigated. Two strains Amy+ and Amy− were obtained. Loss of amylase activity connected with the loss of plasmid DNA was not found in these strains. The presence of the gene responible for the amylase activity in the chromosome of these strains was revealed by hybridization of the α-amylase gene on pJK108 against chromosomal DNA ofS. bovis andBacillus subtilis after a complete restriction withEcoRI.
The major sources of amylase are the pancreas and the salivary glands. The most common cause of elevation of serum amylase is inflammation of the pancreas (pancreatitis). In acute pancreatitis, serum amylase begins to rise within 6-24 hours, remains elevated for a few days and returns to normal in 3-7 days. Other causes of elevated serum amylase are inflammation of salivary glands (mumps), biliary tract disease and bowel obstruction. Elevated serum amylase can also be seen with drugs (e.g., morphine) which constrict the pancreatic duct sphincter preventing excretion of amylase into the intestine ...
The polymorphic patterns of human salivary amylase of a large number of individuals of Caucasian origin were determined by using isoelectric focusing and polyacrylamide gel electrophoresis. Nine diffe
This is one of the Enzymology protocol on Effect of Temperature on Amylase activity (Enzymology Protocol). Download Salivary amylase activity assay Protocol
Starch degrading enzymes like amylase have received great deal of attention because of their perceived technological significance and economic benefits. Selection of a suitable strain is the most significant factor in the amylase production process. On the other hand the screening for a single amylase is difficult because one strain can produce different amylases with different specificities or the amount of amylase produced may be very low. Thus the cloning of one gene directing the synthesis of the desired amylase in a well characterized host like E. coli should help greatly in the characterization of new amylases and also allow a significant yield increase. Studies on the screening of amylase producing bacterial strains were carried out on soil and water samples collected from a hot spring located in Slim River, Perak, Malaysia. The bacteria were cultivated in a mineral medium containing soluble starch as the sole carbon source. Three of the isolates namely SR37, SR41, SR74 have demonstrated ...
Cytosolic free calcium concentrations ([Ca2+]i) and amylase secretion were measured in isolated rat pancreatic acini loaded with the intracellularly trapped fluorescent indicator quin2. Both caerulein and carbamoylcholine caused a rapid increase in [Ca2+]i, with a maximal 3-fold increase at 10(-9) M-caerulein and 10(-4) M-carbamoylcholine. However, caerulein (10(-12) M and 10(-11) M) as well as carbamoylcholine (10(-7) M) caused a significant stimulation of amylase release, while not inducing any detectable rise in [Ca2+]i. Changes in [Ca2+]i after addition of either secretagogue were transient and did not last more than 2-3 min. By contrast, when amylase secretion was monitored as a function of time, two distinct secretory phases could be observed upon addition of either carbamoylcholine (10(-5) M) or caerulein (10(-10) M). An initial, rapid phase (0-5 min) which caused a 6-7-fold increase above basal, followed by a sustained (5-30 min), but less marked, secretory rate (2-3-fold above basal). ...
Amylase test, 5x100 tablets [P1302] - Equl Amylase Test The amylase assay Equl Amylase Test is used in a variety of fields for precise determination of α-amylase activity. The presence of the α-amylase enzyme in for instance saliva, food and honey makes Equl tablets useful for forensic saliva tests, diastase tests in honey or amylase tests in
PAMY : Amylases are a group of hydrolases that degrade complex carbohydrates into fragments. Amylase is produced by the exocrine pancreas and the salivary glands to aid in the digestion of starch. It is also produced by the small intestine mucosa, ovaries, placenta, liver, and fallopian tubes. Since the clinical use of amylase activity is usually to detect pancreatitis, the pancreatic amylase (p-amylase) form provides the single most useful test in the laboratory diagnosis of acute pancreatitis. Total serum amylase continues to be the most widely used clinical test for the diagnosis of acute pancreatitis. Its use has been justified on the basis of its accuracy of 95%. The problem with its use is that it has relatively low specificity of between 70% and 80%.
TY - JOUR. T1 - Effect of nucleotide polymorphism in cis-regulatory and coding regions on amylase activity and fitness in Drosophila melanogaster. AU - Goto, Hiroki. AU - Szmidt, Alfred. AU - Yamazaki, T.. AU - Inomata, N.. PY - 2005/11/1. Y1 - 2005/11/1. N2 - In natural populations of Drosophila melanogaster, there are many amylase (AMY) isozymes encoded by the duplicated genes, but their adaptive significance remains unclear. One approach to elucidate this issue is to understand the molecular basis of functional differences between the allelic classes. In this study, the effects of nucleotide polymorphism in 5′-flanking (cis-regulatory) and coding regions on AMY activity were examined, both on glucose and starch food media and in larvae and adults, using three chimeric Amylase (Amy) genes, Amyc111, Amyc161 and Amy fc661. In this notation, the first number in the superscript indicates the sequence of the 5′-flnaking region (similar to Amy 1 or Amy6), the second number refers to the coding ...
In todays world, there seems to be a widespread belief that carbohydrates (more commonly referred as "carbs") are bad for you. This couldnt be farther from the truth.. Along with proteins and fats, carbohydrates are one of the 3 main macro-nutrients essential to the human body. Amylase is the digestive enzyme responsible for digesting carbohydrates and converting them into glucose and other forms of sugar. In this article, we will be taking a closer look at what exactly amylase is - and why it plays such a major role in your body.. So without further ado, let us begin!. What is amylase?. As we mentioned above, amylase is a digestive enzyme found in the human body. It is more specifically found in the pancreas and the salivary gland where it breaks down sugar and starch and converts them into more simple forms of sugar that can later be used for energy. While amylase is mainly found in humans, it is also found in other animals as well as plants.. Why is amylase important?. Amylase plays a key ...
We have recently summarized the evidence that the amylase of the serum is of heterogenous origin (1). Studies in this laboratory on the regulation of blood amylase levels (2, 3) have shown that [1] normal blood amylase is controlled in part at extrapancreatic sites, [2] blood amylase is lowered in states of increased carbohydrate utilization, and [3] the amylase responses to alterations of carbohydrate metabolism are markedly altered by liver disease but unaffected by total pancreatectomy. These findings led to the conclusion that the liver contributes to the blood amylase level and is an important site of regulation. Similar conclusions ...
The amylase electrophoretic patterns of 10 Brazilian brewing-barley varieties with different malting grades and diastatic power were analyzed during the 7-day germination which occurs during the malting process. Intra and inter-variety genetic variability was observed at both the structural and regulatory level. In the first few days after germination all varieties showed a few active loci, all of them with low activity. In subsequent days, new loci became active and those already detected since early germination showed increased activity. All varieties showed a continuous increase in amylase synthesis until the 3rd and/or 4th day after germination. Some varieties maintained high amylase activity until the last day of germination, while others showed a decrease in activity on the 5th or 6th day. No specific band increased or decreased its intensity independently of the others. A total of 14 loci were detected, out of which only one locus was polymorphic, indicating very low structural genetic ...
Serum amylase and lipase measurements are often used to diagnose acute pancreatitis. This study addresses the question of whether it is advantageous to order serum amylase and lipase tests simultaneously. We evaluated performance of the two tests separately and in combination through a retrospective study of patients for whom both amylase and lipase determinations were ordered. Initial analysis of test performance was conducted with a uniformly applied criterion based on determination of optimal sensitivity-specificity pairs. Individual tests and combinations of tests, including the "AND" and "OR" rules and discriminant functions, were examined. Only the discriminant approach demonstrated better performance than the lipase test alone. This finding was subsequently confirmed by logistic regression analysis. We conclude that ordering both tests simultaneously can be advantageous in diagnosing acute pancreatitis when a bivariate approach is used; however, this must be weighed against the ...
Pancreatic Amylase Beta RNAi available through Novus Biologicals. Browse our Pancreatic Amylase Beta RNAi catalog backed by our Guarantee+.
Malt Amylase Standard [ME-MAST] - High purity Malt Amylase Standard for use in research, biochemical enzyme assays and in vitro diagnostic analysis. A malt extract in which the levels of α-amylase and β-amylase have been standardised. The preparation is designed for use as a standard in the determination of α-amylase and dextrinising power.
Scientists published a paper in Nature Genetics Sunday in which they studied an enzyme called amylase thats produced in saliva and breaks down starch. Human amylase genes share a common ancestry with the amylase gene found in our close relative, the chimpanzee. But they are different in some important ways. Instead of one amylase gene, we have several. Human amylase genes range from 2 to 15 copies, averaging three times as many as chimpanzees. But our extra copies not sprinkled randomly across the worlds population. European Americans and tuber-eating African hunter-gatherers known as the Hadza have a lot of copies. Yakuts, who live in Siberia and eat mostly fish, and Mbuti pygmies who eat mostly animals they hunt, have fewer.. See a pattern? The people with few amylase genes are hunters who dont have much starch in their diet. The people with a lot of genes eat a lot of starch. How did this pattern arise? As cells give rise to eggs and sperm, chunks of their DNA sometimes get accidentally ...
All organisms that use starch for energy make enzymes that convert it back into glucose molecules. One of these enzymes is amylase, which breaks the chemical linkages between glucose molecules by inserting a water molecule into the bond, a process known as hydrolysis. Humans secrete amylase in their saliva, so conversion of starch to glucose begins as soon as starch enters the mouth. Besides being important for energy production in plants and animals, amylase is an important industrial enzyme. In fact, one of the most common industrial uses of enzymes today involves amylase. Amylase activity can be easily detected by following the hydrolysis of starch. The presence of starch can be detected with iodine. Because of the bond angles between glucose residues in starch, starch molecules assume a helical form. Iodine molecules nestle inside the coils of the helix, forming a complex that has a dark-blue color.
Biochemical analysis of blood is used to determine enzyme activity.Enzymes are protein molecules that speed up the flow in the body of all biochemical processes.Each person several types of enzymes, each of which is responsible only for a strictly definite reaction.Consider one of the enzymes that are actively involved in the digestive process - amylase.. There are three types of amylase: α-, β- and γ-amylase, but the most common definition is the activity of α-amylase.It is produced by the pancreas, and its content is maximum in saliva and pancreatic juice.This in turn means that an active center protrude amylase calcium ions.. ...
α-amylase is a very important enzyme, which is widely used in food processing, food industry, brewing, fermentation, textile industry and pharmaceutical industry, etc. It is one of the most widely used enzymes. As it has wide application, α- amylase has great commercial value.. In this report, ASKCI will further disclose market potential and commercial opportunities for α-amylase industry in China. Recommendations will be given at the end of the report to describe the prospect and provide suggestions for strategy making.. Browse Full Report Visit - http://www.acutemarketreports.com/report/market-analysis-and-prospect-of-alpha-amylase-industry-in-china-2015-2020-proposal. 1)The Aim of Report. -To provide readers with comprehensive and in-depth understanding of Chinese α-amylase industry;. -To analyze the market of the industry;. -To discover drivers and barriers of the industry;. -To reveal opportunities for α-amylase industry in China.. 2)Benefit from the Report. -Obtain latest info of ...
a amylase enzyme & a amylase enzyme online Wholesalers - choose a amylase enzyme from 2908 list of China a amylase enzyme Manufacturers.
Computer graphics representation of taka amylase, an enzyme. Amylases are a group of related enzymes that break down starch, glycogen and other polysaccharides. Plants contain both the alpha and beta types of amylases; animals possess only the alpha form, found in pancreatic secretions and (in humans) in saliva. Amylases break the long polysaccharide chains, leaving a mixture of the sugars glucose and maltose. Blue sticks, light blue ribbons. - Stock Image A605/0025
Technically, starch blockers are amylase inhibitors. Amylase is one of the main enzymes the body uses to digest starch. In theory, when amylase is blocked, starch can pass through the body undigested. If the body is unable to digest a part of the meal the calorie intake will be lower which can aid in weight loss. However, theory is one thing, reality another and clinical studies of amylase inhibitors have not established definitive benefits.1-3 For example, one published study failed to find that use of a phaseolus product reduced the usual blood sugar rise that follows a meal.7 Several possible reasons for this discrepancy have been proposed, such as that the amylase inhibitor may be broken down and made ineffective in the stomach, the product may supply enough of its own amylase to counteract any benefit, and that another enzyme, glucoamylase, may be able to take over when amylase cant do the job. However, according to the manufacturer of a current product, more concentrated extracts of ...
Technically, starch blockers are amylase inhibitors. Amylase is one of the main enzymes the body uses to digest starch. In theory, when amylase is blocked, starch can pass through the body undigested. If the body is unable to digest a part of the meal the calorie intake will be lower which can aid in weight loss. However, theory is one thing, reality another and clinical studies of amylase inhibitors have not established definitive benefits.1-3 For example, one published study failed to find that use of a phaseolus product reduced the usual blood sugar rise that follows a meal.7 Several possible reasons for this discrepancy have been proposed, such as that the amylase inhibitor may be broken down and made ineffective in the stomach, the product may supply enough of its own amylase to counteract any benefit, and that another enzyme, glucoamylase, may be able to take over when amylase cant do the job. However, according to the manufacturer of a current product, more concentrated extracts of ...
α-Amylase hydrolyzes the 2-chloro-p-nitrophenyl-α-D-maltotrioside (CNPG3) to release 2-chloro-nitrophenol and form 2-chloro-p-nitrophenyl-α-D-maltoside (CNPG2), maltotriose (G3) and glucose (G). The rate of increase in absorbance is measured at 405 nm and is proportional to the α-amylase activity in the sample.(G). The rate of increase in absorbance is measured at 405 nm and is proportional to the α-amylase activity in the sample.. ...
The accumulation of starch in rice endosperm is impaired at high temperatures, causing grains to appear chalky because of the imperfect filling of endosperm cells with starch granules (Yamakawa et al., 2007). The present study showed that a starch-hydrolyzing enzyme, α-amylase, was induced in ripening grains by an elevated temperature at both the gene expression and activity levels (Figure 1). Furthermore, the suppression of α-amylase genes by a transgenic approach improved grain filling under high temperature and reduced the amount of chalky grain produced by heat stress (Figure 3), revealing the unexplored physiological significance of α-amylase in developing seeds and a potential new strategy for controlling grain quality by modulating the expression of a starch-metabolizing enzyme.. The high temperature conditions employed in the present study, 33 °C/28 °C and 31 °C/26 °C, closely mimic conditions often encountered by rice plants in paddy fields because of recent global warming. Such ...
Introduction. The Effect that Temperature Has on the Rate at which the Enzyme (Amylase) can Breakdown its Substrate Aim: The aim of this experiment is to find out the effect that the temperature has on the rate at which the enzyme (Amylase) can breakdown its substrate, which is Starch. Amylase: Enzyme having physiological, commercial, and historical significance, also called diastase. It is found in both plants and animals. Amylase hydrolyzes starch, glycogen, and dextrin to form in all three instances glucose, maltose, and the limit-dextrins. Prediction: I predict that as the temperature increases, the speed of the reaction will increase. Since temperature is a measure of the motion of particles, increasing the temperature will cause the particles to move faster. When particles move faster, more collisions occur and the collisions are more violent. This should increase the reaction rate. This is backed up by the collision theory, according to this theory; reacting molecules must collide with ...
α-Amylase is a protein enzyme EC 3.2.1.1 that hydrolyses alpha bonds of large, alpha-linked polysaccharides, such as starch and glycogen, yielding glucose and maltose. It is the major form of amylase found in humans and other mammals. It is also present in seeds containing starch as a food reserve, and is secreted by many fungi. Although found in many tissues, amylase is most prominent in pancreatic juice and saliva, each of which has its own isoform of human α-amylase. They behave differently on isoelectric focusing, and can also be separated in testing by using specific monoclonal antibodies. In humans, all amylase isoforms link to chromosome 1p21 (see AMY1A). Amylase is found in saliva and breaks starch into maltose and dextrin. This form of amylase is also called "ptyalin" /ˈtaɪəlɪn/ It will break large, insoluble starch molecules into soluble starches (amylodextrin, erythrodextrin, and achrodextrin) producing successively smaller starches and ultimately maltose. Ptyalin acts on linear ...
Fran, We use the monoclonal anti- Pancreatic Amylase Cat# MU099-UC from Biogenex. Formaldehyde-fixed(16-24hrs) paraffin-embedded, 4 micron thick sections are dried overnight at 45C, de-waxed in Xylene 3X10 min., rinsed X2 in 100% ETOH, endogenous peroxidase blocked in 5% H2O2 in methanol for 30 min., 95% ETOH X2 @ 1min, 70%ETOH-water. Sections are pretreated by digestion for 10 [email protected] in 0.6% w/v Ficin dissolved in 0.01M NaOH containing 0.1mg CaCl2 per 100ml, pH is adjusted to pH7.8 with 1/N HCl. Following blocking in 1% v/v Normal Goat Serum (NGS) in TBS, sections are incubated for 1 hour at RT in 1:100 dilution of Ab in 1%NGS in TBS. Detection is with LSAB(Zymeds Histostain, GaM), chromogen is AEC. The results have always been consistent on our controls( pancreas fixed in NBF for several time points), test specimens are prone to reflect the quality of fixation and processing( particularly short fixation!). Hope this helps Bryan , ---------- , From: [email protected][SMTP:[email protected]] , ...
Analysis of enzymatic activity of PCR mutated alpha- amylase gene , Analysis of enzymatic activity of PCR mutated alpha- amylase gene , کتابخانه دیجیتال دانشگاه علوم پزشکی اصفهان
In this experiment, students investigate and compare amylase activity in different life stages of barley. The experiment allows students to make connections between concepts and processes previously covered in lectures and reading materials and is relevant to learning and skills development in the scientific method and related areas such report writing and the interpretation of results. With regard to theoretical and conceptual knowledge, the practical investigates the function of an enzyme in a living organism and explores concepts around the ontogenic regulation of metabolism in an organism as it develops. Development of skills in the scientific method and the communication of science are also important components of this exercise.. ...
We describe here the properties of tert-butyloxycarbonyl-Trp-Leu-Asp-Phe-NHNH2 (A-57696), a C-terminal hydrazide analogue of tert-butyloxycarbonyl-CCK4 (Boc-Trp-Met-Asp-Phe-NH2), at four cholecystokinin (CCK) receptor-bearing tissues, the guinea pig pancreas and gall bladder (Type A), guinea pig cortex (Type B), and NCI-H345 cells, a human small cell lung cancer cell line that expresses CCK-B/gastrin receptors. Using 125I-Bolton-Hunter-cholecystokinin octapeptide (26-33) (125I-Bolton-Hunter-CCK8) as the radioligand, A-57696 was found to be selective for cortical CCK-B receptors (IC50 = 25 nM), compared with pancreatic CCK-A receptors (IC50 = 15 microM). A-57696 behaved as a competitive antagonist in reversing CCK8-stimulated pancreatic amylase secretion and phosphoinositide breakdown. By Schild analysis, its Kd was determined to be 4.7 and 6.8 microM in amylase and phosphoinositide assays, respectively. A-57696 (100 microM) did not elicit gall bladder contraction, and it inhibited contractions ...
An α-amylase produced by Scytalidium thermophilum was purified using DEAE-cellulose and CM-cellulose ion exchange chromatography and Sepharose 6B gel filtration. The purified protein migrated as a single band in 6% PAGE and 7% SDS-PAGE. The estimated molecular mass was 36 kDa (SDS-PAGE) and 49 kDa (Sepharose 6B). Optima of pH and temperature were 6.0 and 60°C, respectively. In the absence of substrate the purified α-amylase was stable for 1 h at 50°C and had a half-life of 12 min at 60°C, but was fully stable in the presence of starch. The enzyme was not activated by several metal ions tested, including Ca2+ (up to 10 mM), but HgCl2 and CuCl2 inhibited its activity. The α-amylase produced by S. thermophilum preferentially hydrolyzed starch, and to a lesser extent amylopectin, maltose, amylose and glycogen in that order. The products of starch hydrolysis (up to 6 h of reaction) analyzed by thin layer chromatography, showed oligosaccharides such as maltotrioses, maltotetraoses and ...
A virus-based single-enzyme nanoreactor. Comellas-Aragonès, Marta; Engelkamp, Hans; Claessen, Victor I.; Sommerdijk, Nico A. J. M.; Rowan, Alan E.; Christianen, Peter C. M.; Maan, Jan C.; Verduin, Benedictus J. M.; Cornelissen, Jeroen J. L. M.; Nolte, Roeland J. M. // Nature Nanotechnology;Oct2007, Vol. 2 Issue 10, p635 Most enzyme studies are carried out in bulk aqueous solution, at the so-called ensemble level, but more recently studies have appeared in which enzyme activity is measured at the level of a single molecule, revealing previously unseen properties. To this end, enzymes have been chemically or... ...
A 2013 study published in the Journal of Clinical & Diagnostic Research was designed to determine the serum amylase, blood glucose and the serum lipid profile in 110 type 2 diabetes patients compared to healthy individuals of the same age and sex. The research showed that for the diabetic subjects wherever blood sugar levels were higher, serum amylase activity was found to be significantly lower. This finding was reflective of pancreas malfunction and speaks to the importance of a healthy pancreas producing healthy amounts of amylase. ...
Introduction. Investigation into the effect of temperature on the working of the enzyme amylase Plan and Prediction The aim of this investigation is to find out how temperature affects the rate of reaction of the enzyme amylase, which is found in the salivary glands. Prediction My prediction is correct that at low temperatures the time taken for digestion will be slow as there is insufficient energy to make many molecules collide, at a higher temperature there will be more energy therefore more collisions and the reaction will be faster. The molecules have kinetic energy and as this increases so does their mobility, resulting in more collisions. I know that enzymes have optimum temperatures and the enzyme amylase should be 36.8`C- body temperature, so after about 40`C I think that more and more enzymes will be denatured due to the heat. When enzymes are denatured the active sites shape changes so that the substrates can no longer fit and so less and less reactions are able to occur. I have ...
Amylase is a digestive enzyme that acts on starch in food, breaking it down into smaller carbohydrate molecules. Because it helps the body digest and excrete dead white blood cells, having optimum amylase activity helps in avoiding degenerative diseases. Without proper amylase activity, there may be excessive irritation. Low amylase is also thought to be a factor in a variety of diseases including type II diabetes, blood sugar imbalances, hypoglycemia, carbohydrate and sugar cravings, and many forms of food sensitivities. The health benefits of amylase include helping lower autoimmune responses, providing resistance for swelling and redness, inhibiting the growth of tumor cells with metastatic capacities, and lessening aging effects ...
Bacillus licheniformis RM44 was isolated from hot spring near Karachi and screened forthe production of extracellular amylase Amy RM44. Amy RM44 was purified to homogeneityon a single step by affinity chromatography using insoluble corn starch. The molecular weightof Amy RM44 was estimated to be 66 kDa by SDS-PAGE and zymographic analysis. Nine foldpurification was achieved with the specific activity of 870 U/mg that provides the total yieldof the enzyme up to 31%. Studies on purified AmyRM44 characterization revealed that theoptimum temperature of enzyme was 100 ºC. Amy RM44 was proved to be highly thermostableas it retained 50% activity after 2 h at 100 ºC. Amy RM44 was stable over wide range of pHwith optimum activity at pH 5. Enzyme activity was not significantly inhibited by SDS andEDTA. Amy RM44 also exhibited its activity towards various carbohydrates such as dextrin,pullulan, α-cyclodextrin, β-cyclodextrin, and γ-cyclodextrin.
The optimum pH of salivary amylase is approximately 6.7 to 7, according to Worthington Biochemical Corporation, meaning very slightly acidic. If the pH is significantly out of this range, the enzyme...
Essential Therapeutics Digestive Enzymes is a high potency pancreatic supplement that breaks down fats, proteins, and carbohydrates to prevent malabsorption and gastric discomfort.
Lists the various brand names available for medicines containing amylase. Find information on amylase use, treatment, drug class and molecular formula.
An amylase test measures the amount of this enzyme in a sample of blood taken from a vein or in a sample of urine. Many conditions can change amylase levels. Your doctor will discuss any significant abnormal results with you in relation to your symptoms and past health.. Results are normally available within 72 hours. The normal values listed here-called a reference range-are just a guide. These ranges vary from lab to lab, and your lab may have a different range for whats normal. Your lab report should contain the range your lab uses. Also, your doctor will evaluate your results based on your health and other factors. This means that a value that falls outside the normal values listed here may still be normal for you or your lab.. ...
Meisler, M and Strahler, J R., "Two distinct amylase genes active in pancreas of ybr mice. Abstr." (1982). Subject Strain Bibliography 1982. 1964 ...
Torulopsis ingeniosaDi Menna was found to possess an α-amylase strongly attached to the cell wall, its pH optimum being at 5.5, optimum temperature at 50 °C, highly sensitive to thermal inactivation. The enzyme was found to be induced by starch but the synthesis is not subject to a glucose effect.
Digestion begins immediately in the oral cavity with both mechanical and chemical digestion. Mechanical digestion in the oral cavity consists of grinding of food into smaller pieces by the teeth; a process called mastication. Chemical digestion in the mouth is minor but consists of salivary amylase (ptyalin, or alpha-amylase) and lingual lipase; both contained in the saliva. Salivary amylase is chemically identical to pancreatic amylase and digests starch into maltose and maltotriose, working at a pH optimum of 6.7 to 7.0. Lingual lipase, also contained in the saliva, hydrolyzes the ester bonds in triglycerides to form diacylglycerols and monoacylglycerols.[1] After sufficient digestion in the oral cavity, the partially digested foodstuff, or bolus, is swallowed into the esophagus. No digestion occurs in the esophagus.. After passage through the esophagus, the bolus will enter the stomach and undergo mechanical and chemical digestion. Mechanical digestion in the stomach occurs via peristaltic ...
Sigma-Aldrich offers Sigma-Aldrich-10067, α-Amylase from Bacillus licheniformis for your research needs. Find product specific information including CAS, MSDS, protocols and references.
Amylase is one of several enzymes produced by the pancreas to help digest proteins, fats, and carbohydrates. Secreted through the pancreatic duct into the duodenum, it there helps break down dietary carbohydrates. Amylase is also produced by other
Your body needs calories to meet its energy requirement. One of the primary sources of energy is carbohydrates. Carbohydrates come from many sources such as fruits and vegetables, whole grains and rice. Increasingly the modern world has witnessed the profusion of processed foods that contain a significant amount of carbohydrates, foods such as biscuits, cakes, pastries or pre-processed noodles. Research into the eating habits of man reveals that before the domestication of animals and the prevalence of farming, a man consumed approximately 35% of his calories from carbohydrates. Post agriculture, this increased to about 49%. The human body had to adapt to these changes.. To keep the body in homeostasis or balance the body started to produce increased amounts of an enzyme called amylase. Amylase is an enzyme that helps you break down carbohydrates into a form that can be digested by your body called glucose. The process of breakdown starts in the mouth by the secretion of saliva. Saliva contains ...
The amylase enzyme begins the digestion of starch, breaking the long polysaccharide starch chains into smaller molecular units. Amylase is produced by the salivary glands in the mouth and the...
Amylase is an enzyme found in saliva that helps break down starches into glucose. Which of these statements best describes how amylase starts this r...
RESULTS Over 56 weeks, liraglutide 3.0 mg versus placebo was associated with increases in mean levels of 7% (amylase) and 31% (lipase), respectively. Similar changes in amylase/lipase levels were observed with liraglutide 1.8 mg. More participants receiving liraglutide 3.0 mg versus placebo experienced amylase (9.4% vs. 5.9%) and lipase (43.5% vs. 15.1%) elevations greater than or equal to the upper limit of normal (ULN); few had elevations ≥3 × ULN for amylase (,0.1% with liraglutide 3.0 mg or placebo) or lipase (2.9% vs. 1.5%, respectively). After liraglutide discontinuation, enzymes returned to baseline levels. Thirteen participants developed AP: 12 on (n = 9, 0.3%) or after (n = 3, 0.1%) liraglutide 3.0 mg treatment and one (0.1%) with placebo. A total of 6/13 participants with AP (5/12 liraglutide; 1 placebo) had gallstone disease evident at AP onset. Amylase/lipase elevations either 1 × ULN or ≥3 × ULN before AP onset had very low positive predictive value for AP (,1%). ...
Container/Tube:. Preferred: Urine from a 2-hour timed collection.. Specimen Volume: 0.1 mL from a 2-hour timed urine collection.. Stability: No preservative. Refrigerate specimen during collection, and send specimen refrigerated.. Urine amylase is less stable and should be adjusted to an alkaline pH before. storage at 2-8°C for up to 2 days or at -70°C for up to 2 weeks.. Collection Instructions: Obtain collection jug from laboratory.. Note: Starting and ending times of collection are required.. ...
Caffeine inhibits a low affinity but not a high affinity mechanism for cholecystokinin-evoked Ca2+ signalling and amylase release from guinea pig pancreatic acini.Naunyn ...
I have had upper abdominal pain for years and recently had some blood work checking on my pancreas. The results showed a low Amylase level of 22 (30-140 being normal range). What does this mean? Is ...
Using a simple photometer to detect digestion of iodine-stained arrowroot starch by salivary amylase, I have gotten a graph that is FAIRLY closely modeled by the Michaelis-Menten equation. But it deviates significantly. Do you have any suggestions as to why? Bruce Ratcliffe BruceRat at AOL.COM ...
High Amylase plasma levels and acute pancreatitis usually go hand in hand. Find out reasons, preparations & methods of testing plasma level.
Ikeno, T.; Sakamoto, H.; Ikeno, K.; Niwa, K., 1992: The embryo pancreas is a source of increased yolk amylase in the fertilized eggs of domestic fowls
My primary physician today told me that my stomach pain could not be due to pancreatic cancer because my amylase and lipase numbers are all good (along with all other CBC #s and a recent cholesterol/li...
α-Amylase is a protein enzyme EC 3.2.1.1 that hydrolyses alpha bonds of large, alpha-linked polysaccharides, such as starch and glycogen, yielding glucose and maltose. I
α-Amylase is a protein enzyme EC 3.2.1.1 that hydrolyses alpha bonds of large, alpha-linked polysaccharides, such as starch and glycogen, yielding glucose and maltose. I
An amylase test may be ordered if a doctor suspects inflammation of the pancreas, gallstones, or other pancreatic problems. The test may also be used to help monitor cystic fibrosis.
Hi guys, ive got to do a project for school on the investigation of the effect of pH on the enzyme amylase. Im abit lost right now only just started A levels. Can someone suggest how i would carry out this investigation? Equipment and method would be much appreciated! And the results need to be quantitative and not qualitative. so how can i adapt the experiment so i get quantitative results ...
An ideal way for the analysis of amylase by PGC chromatography. differ, for instance, with the existence/lack of fucose, galactose, or even a bisecting GlcNAc, as well as the deviations could be bigger, but modification with elements for the particular nearest neighbor will produce reasonably great approximations of accurate values (Desk ?(Desk2).2). Huge differences in retention period and solvent structure might decrease the gain in correction hence. For example, the acetonitrile articles changes by one factor of just one 1.25 through the Rabbit Polyclonal to OR10A5 elution from the trisialoglycans (Fig.?2) and therefore can lead to deviations that, however, appear little weighed against the huge first mistake. Fig. 2 PGC-LC splitting up of triantennary, trisialylated symbolize 13C atoms within the chemical substance formulas. galactose, galactose 1-phosphate, blood sugar GnGn (i.electronic., a desialylated and degalactosylated diantennary N-glycan) was incubated with UDP-13 C 6-galactose and ...
female ExoticBeautty amylase free diet I m an unstoppable Sex-Machine I can do the craziest things You dreamed about Get on board and forgot about world existing around You - this is going to be another dimension Let me be Your tour guide on this journey
I would love to make an amylase schnapps session. That means, we attempt to produce alcohol with the minimum requirements and whats at hand: our bodies and some carbohydrates. A few folks around the earth figured out th…
Anti-beta Amylase antibody conjugated to HRP validated for WB, ELISA, Dot, EM. Immunogen corresponding to full length native protein (purified)
The IUPHAR/BPS Guide to Pharmacology. amylase, alpha 2A (pancreatic) - 3.2.1.- Glycosidases. Detailed annotation on the structure, function, physiology, pharmacology and clinical relevance of drug targets.
View Notes - bio writeup from BISC 220L at USC. Kunal Bhan BISC 220: Friday Lab 11 1:50 pm TA: Erin Ragland Determining the Ideal Conditions at Which Amylase Best Functions Based on the Concentration
Lab Report DIFFUSION AND THE EFFECT OF AMYLASE. Aim: We will interpret and explain the activity of an enzyme added to a solution. We will analyze reactions
My daughter aged 8 years got severe abdomen pain about 5 months ago. When we consulted gastroenterologist, he preferred CT scan and MRCP scan to diagnose
Many people think that designing a digestive enzyme formula is as simple as racking up big numbers in the key enzymes such as protease, amylase, and lipase. Some companies go so far as to present tables in their literature comparing their protease levels in their formula to the levels found in competitors formulas, with the implied understanding that he who has the most wins. If only it were that simple. The fact is that a good digestive enzyme needs to work with real world diets. The simple truth is that too many formulas on the market put in far more protease than is required for a typical diet (simply to show a big number on the label) - and far too little amylase or lactase-not to mention almost none of the specialized carbohydrate enzymes. (Remember, you can only fit so much in a capsule. If you add more of one ingredient, you have to use less of something else.) In the end, its not about the numbers, its about the ability of the supplement to work with real world diets. Keep in mind, ...
... : Effect of Municipal auto-battery recycling-site leachate (MABL) on α-Amylase activity. Values represent mean ± standard deviation. Values are significantly higher (p,0.05) against the control, n=3 ...
This was our second test to determine the value of various enzyme preparations added to beef cattle rations. The first involved amylase and a combination of amylase and protease. Amylase apparently depressed the appetite ...
DigeZyme® can be a multienzyme complicated composed primarily of amylases (starch hydrolyzing enzymes), proteases (protein hydrolyzing enzymes) and lipases (lipid hydrolyzing enzymes). These digestive enzymes collectively assistance the breakdown of complex macromolecules into Power resources and market the discharge of the nutrient written content from your foods we consume. The digestive program The natural way makes digestive enzymes. DigeZyme® supplements the gastrointestinal tract with enzymes to adequately guidance the human bodys power to digest food ...
These statements have not been evaluated by the Food and Drug Administration. This product(s) is not intended to diagnose, treat, cure or prevent any disease.. __________________________________________________________________. What Makes Isotonix® Digestive Enzymes with Probiotics Unique?. Enzymes are important for the bodys proper absorption and utilization of food. Over time, the bodys ability to make certain enzymes reduces as part of the natural aging process. Many scientists now believe that maintaining normal levels of key enzymes is important to maintaining overall health. Enzymes are responsible for every activity of life. Digestive and metabolic are the two primary classifications of enzymes within the body. Proteases (aids in digesting protein), amylases (aids in digesting carbohydrates), and lipases (aids in digesting fats) are the three primary digestive enzymes, which function as the biological catalyst to breaking down food. In todays world of processed and fast foods, the ...
identical to pancreatic amylase - cleaves a-1,4-glycosidic bonds of carbohydrates ... pancreatic a-amylase - cleaves starch and glycogen into di- and ... – A free PowerPoint PPT presentation (displayed as a Flash slide show) on PowerShow.com - id: 1b2d74-ZDc1Z
b 13-36 months old.. *Significantly different from control at P , .05.. Such sophisticated items of equipment as ovens are not generally available at the community level in India, but there is abundant sunshine for nine to ten months a year, and it would therefore be easy to introduce the simple technology of ARF preparation by sun-drying. Though sun-dried ARF had the optimum amylase activity, however, it had a poor shelf life (10 days). Toasted ARF had a good shelf life because of a lower initial moisture content (due to the higher temperature of processing). Low moisture content inhibits the growth and proliferation of microorganisms, thereby extending the keeping quality. In addition, a higher processing temperature (80 4 C in the case of the toasted ARF) may itself lower the initial surface microbial load.. Since the toasted ARF was found to have a longer shelf life, which is a desired characteristic for any processed food and makes the product more readily acceptable, the viscosity ...
Insert to Cart Enzymes are important for the bodys good absorption and utilization of foodstuff. After a while, your bodys ability to make certain enzymes decreases as A part of the all-natural growing older procedure. Lots of experts now feel that sustaining usual levels of essential enzymes is essential to maintaining overall health. Enzymes are to blame for every single exercise of everyday living. Digestive and metabolic are The 2 Most important classifications of enzymes inside the body. Proteases (aids in digesting protein), amylases (aids in digesting carbohydrates), and lipases (aids in more info digesting fats) will be the three Principal digestive enzymes, which function because the Organic catalyst to breaking down food items ...
Submit only 1 of the following specimens: Serum Draw blood in a plain, red-top tube(s). Serum gel tube is acceptable. Spin down and send 1 mL of serum refrigerated in a plastic vial. Plasma Draw blood in a green-top (sodium or lithium heparin) tube(s). Spin down and send 1 mL plasma refrigerated in a plastic vial.
青棵(大麥(最早在肥沃月彎(Fertile Crescent(馴化3由於它的成熟期比小麥短3又比較耐旱耐鹽3對肥份也不那麼挑剔3因此在肥沃月彎與雅典3尤其是在這兩個文明的後期3它也是重要的穀物》在青藏高原3由於高山上可種植季節相對縮短3此時成熟期較短又耐旱 耐鹽且耐寒的青棵3當然就當仁不讓地成為高地藏人的主食》雖然在近代大麥常被做為飼料3但對於釀造業來說3由於大麥有兩種澱粉酶(α-amylase以及β-amylase(3可以讓澱粉分解得更快更完全3使啤酒釀造更順利》因此3大麥一直都是不可或缺的穀物(3(》最近的這個發現3當然使得大麥的「獲獎記錄「上3又增添了一筆 ...
I predicted that in a neutral or slightly alkaline condition the rate of the reaction would be the fastest but my results show differently. These results are not completely accurate because the amylase we used is not the same enzyme as the one in our mouths, it is synthetic and therefore will not work at the exact same rate or in the same conditions as our mouths. We couldnt test the amylase which is in our mouths as it is unhygienic and isnt safe to use in our school lab. If we had have tested that I would still stick to my original prediction and say that the quickest result would occur around neutral or maybe slightly alkaline conditions ...
This website uses cookies to improve your experience while you navigate through the website. Out of these cookies, the cookies that are categorized as necessary are stored on your browser as they are essential for the working of basic functionalities of the website. We also use third-party cookies that help us analyze and understand how you use this website. These cookies will be stored in your browser only with your consent. You also have the option to opt-out of these cookies. But opting out of some of these cookies may have an effect on your browsing experience ...
Information on industrial baking formulation and R&D, profiles of wholesale baking companies, processing and packaging innovations, marketing trends and special reports.
Id had my Scrubs episode encounter before I ran home. When I returned, one of those doctors was waiting for me. With news. I dont remember much of what she said. Blame it on fatigue, blame it on now once in the hospital, everything seemed to run together. Blame it on whatever you like, it wont change the outcome. I still wont remember a lot of it. I do remember her saying initial bloodwork showed elevated amylase and lipase levels, which is why they had to cut off my sons food and drink. I also remember her saying the bloodwork results could indicate Pancreatitis. The plan was to restrict food and drink for a couple of days and they still thought wed be out over the weekend ...
Id had my Scrubs episode encounter before I ran home. When I returned, one of those doctors was waiting for me. With news. I dont remember much of what she said. Blame it on fatigue, blame it on now once in the hospital, everything seemed to run together. Blame it on whatever you like, it wont change the outcome. I still wont remember a lot of it. I do remember her saying initial bloodwork showed elevated amylase and lipase levels, which is why they had to cut off my sons food and drink. I also remember her saying the bloodwork results could indicate Pancreatitis. The plan was to restrict food and drink for a couple of days and they still thought wed be out over the weekend ...
P-A-L Enzymes (Protease, Amylase, Lipase) are potent, plant-based enzymes formulated to aid digestion and assist with the bodys enzymatic cleansing process. If your diets consists primarily of cooked, processed and refined foods, youre likely to be deficient in enzymes to one degree or another..
Solgar Vegan Digestive Enzymes 50 Chewable Tabs. It provides digestive enzymes for the breakdown of proteins, carbohydrates, fats and fiber - 50 chewable tablets
Protein With Digestive Enzymes at Walgreens. View current promotions and reviews of Protein With Digestive Enzymes and get free shipping at $35.
... | Shop for Digestive Enzymes products at discount prices from NZs favourite online health shop. Fast delivery.
mmu:100043688 K01176 alpha-amylase [EC:3.2.1.1] , (RefSeq) Amy2a2, mAmy2-5; amylase 2a2 (A) MKFVLLLSLIGFCWAQYDPHTSDGRTAIVHLFEWRWVDIAKECERYLAPKGFGGVQVSPP NENVVVHNPSRPWWERYQPISYKICTRSGNEDEFRDMVTRCNNVGVRIYVDAVINHMCGA GNPAGTSSTCGSYLNPNNREFPAVPYSAWDFNDNKCNGEIDNYNDAYQVRNCRLTGLLDL ALEKDYVRTKVADYMNHLIDIGVAGFRLDAAKHMWPGDIKAVLDKLHNLNTKWFSQGSRP FIFQEVIDLGGEAIKGSEYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGLVP SDRALVFVDNHDNQRGHGAGGSSILTFWDARMYKMAVGFMLAHPYGFTRVMSSYRWNRNF QNGKDQNDWIGPPNNNGVTKEVTINADTTCGNDWVCEHRWRQIRNMVAFRNVVNGQPFSN WWDNNSNQVAFSRGNRGFIVFNNDDWALSATLQTGLPAGTYCDVISGDKVDGNCTGLRVN VGSDGKAHFSISNSAEDPFIAIHADSKL ...
There are 11 eight-letter words containing 2A, L, M, S and Y: AMYGDALS AMYLASES LAMASERY ... SHAMABLY YAMALKAS YAMULKAS. Every word on this site can be played in scrabble. Build other lists, starting with or ending with letters of your choice.
Life Choice Full Spectrum Digestive Enzyme - Broad spectrum means the complete digestion of fats, proteins, and carbohydrates, as well as fiber
Life Choice Full Spectrum Digestive Enzyme Details Broad spectrum means the complete digestion of fats, proteins, and carbohydrates, as well as fiber in the diet.
Udos Choice Digestive Enzyme Blend contains 7 active plant-based enzymes chosen to assist the breakdown of proteins, fats, carbohydrates and fibre. They do this by providing enzyme activity combinations.
Powerful, fast acting, high potency, full spectrum digestive enzyme to help break down food, absorb nutrients and prevent gas and bloating.
OmegaZyme 90 Caps Garden of LifeALSO AVAILABLE IN 180 Caplets Garden of Life Omegazyme Nutritional DataGarden of Life Omegazyme is a highly effective digestive enzyme product that helps the body process proteins, carbohydrates, fats and dairy. With more t
Digestive Enzymes Advantage assists in regulating all of the metabolic processes in our bodies while ensuring that the nutrients we consume are fully absorbed.*. ...
The human body is an incredibly complex network of systems. In order for all these systems to work, we need our digestive enzymes which can ...
Are digestive enzymes all that effective in helping with a bulking diet? Ive heard that they can actually slow down the endogenous production of
Orland Park, IL (PRWEB) October 23, 2012 -- Vital Health, Inc. introduces MyZymes, a chewable digestive enzyme for children. MyZymes is part of the Vital
In Diabetic ketoacidosis when pain abdomen is one of the major clinical finding, serum amylase levels are obtained, to rule out the diagnosis of acute pancreatitis (since the latter too can present with acute pain abdomen). If the serum amylase levels are found high in patients with Diabetic ketoacidosis, it may not be due…
We examined the clinical utility of urine trypsinogen-2 as a marker of acute pancreatitis (AP). Fifty-nine patients with AP, 42 with acute abdominal diseases of extrapancreatic origin, and 63 without evidence of acute abdominal disease were studied. Urine trypsinogen-2 was determined by a time-resolved immunofluorometric assay. As reference methods we used serum trypsinogen-2, urine amylase, and serum amylase. The diagnostic accuracy of the markers was evaluated by receiver-operating characteristic (ROC) analysis. At admission, urine trypsinogen-2 differentiated patients with AP from controls with high accuracy. The area under the ROC curve (AUC) was 0.978, which was equal to that of serum trypsinogen-2 (0.998) and serum amylase (0.969) and significantly larger than that of urine amylase. For differentiation between severe and mild AP, urine trypsinogen-2 (0.730) was equal to serum trypsinogen-2 (0.721), and clearly better than amylase in serum and urine. These results suggest that determination of
The role of routine isoamylase determinations in differentiating acute pancreatitis from other causes of an acute abdomen with hyperamylasemia and/or hyperamylasuria was evaluated. Values were analyzed from a control group of 21 patients with acute pancreatitis (group I) and from 100 consecutive patients diagnosed in our emergency department as having an acute abdomen (group II). In group I, 100% of patients had hyperamylasemia, hyperamylasuria, and a P isoamylase fraction greater than 0.75 of the total amylase value. In group II, 50% of patients had hyperamylasemia and/or hyperamylasuria. Of these patients, 44% had a P isoamylase fraction less than 0.75 of the total amylase value, a finding apparently incompatible with a diagnosis of acute pancreatitis as identified by our control group. We conclude that routine isoamylase determinations in patients with an acute abdomen and hyperamylasemia and/or hyperamylasuria allows the differentiation from acute pancreatitis in 44% of cases.
article{2099b06f-26cd-445d-9373-98395346f840, abstract = {Background and purpose: Severe acute pancreatitis (SAP) is characterized by trypsinogen activation, infiltration of leucocytes and tissue necrosis but the intracellular signalling mechanisms regulating organ injury in the pancreas remain elusive. Rho-kinase is a potent regulator of specific cellular processes effecting several pro-inflammatory activities. Herein, we examined the role of Rho-kinase signalling in acute pancreatitis. Experimental approach: Pancreatitis was induced by infusion of taurocholate into the pancreatic duct in C57BL/6 mice. Animals were treated with a Rho-kinase inhibitor Y-27632 (0.5-5 mg kg(-1) ) before induction of pancreatitis. Key results: Taurocholate infusion caused a clear-cut increase in serum amylase, pancreatic neutrophil infiltration, acinar cell necrosis and oedema formation in the pancreas. Levels of pancreatic myeloperoxidase (MPO), macrophage inflammatory protein-2 (MIP-2), trypsinogen activation ...
For the first time, we have shown that transient obstruction of the SO produced by carbachol administration resulted in hyperamylasaemia and histological changes consistent with acute pancreatitis. These changes were comparable with those induced in possums with combined pancreatic duct ligation and CCK-8/secretin administration, a well established method on inducing hyperamylasaemia and acute pancreatitis in other species. In both the carbachol induced and pancreatic duct ligation with secretin/CCK-8 models, the concurrent increase in pancreatic duct pressure with a combination of pancreatic exocrine stimulation was necessary to produce hyperamylasaemia and acute pancreatitis.. The increase in pressure in the pancreatic duct was similar whether it followed pancreatic duct ligation or was induced by carbachol administration. The increase in plasma amylase in all cases corresponded with the increase in pancreatic duct pressure following pancreatic duct ligation or stimulated SO obstruction in ...
Introduction: Minimally invasive approches in treatment of acute necrotizing pancreatitis and/or infected pancreatic necrosis gain a notable advantage compared with open surgery.. Aim: We present our experience in treatment of acute necrotizing pancreatitis by an original minimally invasive retroperitoneal necrosectomy technique, evaluate feasibility and safety of this method, compare our results to other studies.. Patients and methods: A retrospective analysis of 22 patients with acute necrotizing pancreatitis and large fluid collections in retroperitoneal space was performed. All patients underwent retroperitoneal necrosectomy as an initial interventional procedure in treatment of infected pancreatic necrosis.. Results: Sixteen males and six females aged between 24 and 60 with an average age of 42.59 ±7.3 years were included. Alcohol abuse was an etiologic factor of acute necrotizing pancreatitis for 18 patients (81.8%). Average time between diagnosis and performance of necrosectomy was 28.6 ...
Alcoholic pancreatitis continues to stir up controversy. One of the most debated points is whether from onset it is a chronic disease or whether it progresses to a chronic form after repeated episodes of acute pancreatitis. Histological studies on patients with alcoholic pancreatitis have shown that the disease is chronic from onset and that alcoholic acute pancreatitis occurs in a pancreas already damaged by chronic lesions. Genetic factors may also play a role in the pathogenesis of alcoholic disease. The incidence of chronic alcoholic pancreatitis seems to have decreased in the last twenty years. Finally, recent therapeutic studies which have shown medical or surgical approaches capable of reducing the pain episodes in chronic pancreatitis patients will be described.
More than a century ago, a German pathologist noted at autopsies of patients who had succumbed to acute pancreatitis that their intrapancreatic digestive enzymes had been activated.1 His fateful observation engendered the surprisingly long-lived belief that pancreatitis is an autodigestive phenomenon resulting from the inappropriate activation of digestive enzymes within the pancreas itself. The past three decades have seen the development of several animal models of pancreatitis and remarkably, early intracellular trypsinogen activation has been observed consistently during the course of pancreatitis in all of them.2-5 Subsequently, pancreatitis research began to focus on the mechanisms of premature intracellular trypsinogen activation. We and others have shown that premature trypsinogen activation takes place in membrane-bound compartments resembling autophagic vesicles within which zymogen and lysosomal contents are colocalised.6-9 In these colocalisation vacuoles, the lysosomal protease ...
CONTEXT: Acute pancreatitis in ectopic pancreatic tissue is an uncommon cause of acute abdominal pain and can be difficult to diagnose on imaging. Our aim is to raise awareness and aid in the diagnosis of this entity by highlighting helpful dynamic contrast-enhanced MRI imaging findings. CASE REPORT: We report a 51-year-old man with acute onset epigastric pain presented to ER. With the presence of elevated serum lipase, the clinical diagnosis of acute pancreatitis was made. Contrast enhanced CT demonstrated normal pancreas and a focal mass at the duodenojejunal flexure, mimicked a neoplasm. Subsequent dynamic contrast enhanced MR images demonstrated enhancement pattern of the lesion similar to the native pancreatic tissue enhancement, a finding raised the possibility of acute pancreatitis in ectopic pancreatic tissue, but tumor was not excluded. Finally, patient undergone surgical bowel resection including the suspected mass that was proved as an ectopic pancreatic tissue on microscopic examination.

Amylase - WikipediaAmylase - Wikipedia

Amylase finnes i spytt og i sekresjoner fra bukspyttkjertelen. Den starter virkningen på stivelse alt i munnhulen. Stivelse ... Et diagram av et amylase-molekyl fra menneskespytt. Kalsiumionet er synlig i lys khaki, kloridionet i grønt. Fra PDB 1SMD. ... Amylase er en gruppe enzymer som spalter stivelse (polysakkarider) til sukker (disakkarider). ... Et forhøyet nivå av amylase i blod og urin kan være et signal på betennelse i bukspyttkjertelen, såkalt pancreatitt. ...
more infohttps://no.wikipedia.org/wiki/Amylase

Amylase | Buzzle.comAmylase | Buzzle.com

Amylase Vs. Lipase. Of the scores of different enzymes in the body, amylase and lipase are two enzymes that help us digest the ... Amylase Levels in the Blood. Amylase breaks down the starch and carbohydrate present in the food into simple forms that are ... Amylase Test. Amylase is a digestive enzyme that is produced by the salivary gland and the pancreas. This write-up provides ... Salivary Amylase. Salivary amylase, as the name suggests, is secreted in human and animal saliva. The article below explains ...
more infohttps://www.buzzle.com/articles/amylase/

Amylase FractionationAmylase Fractionation

... ,ARUP Laboratories is a national reference laboratory and a worldwide leader in innovative laboratory ... Infinity Amylase (Powder). 6. Infinity Amylase CNPG3 (Liquid). 7. Infinity Amylase EPS (Liquid). 8. Amylase. 9. Amylase, Body ... Amylase Reagent. 2. Amylase (Colorimetric Method). 3. Amylase (Kinetic Method). 4. Amylase (EPS-G7, kinetics). 5. ...
more infohttp://www.bio-medicine.org/medicine-products/Amylase-Fractionation-21072-1/

Pancreatic amylase | biochemistry | Britannica.comPancreatic amylase | biochemistry | Britannica.com

... amylase: …by the salivary glands, whereas pancreatic amylase is secreted by the pancreas into the small intestine. ... In amylase. …by the salivary glands, whereas pancreatic amylase is secreted by the pancreas into the small intestine. ... Other articles where Pancreatic amylase is discussed: ... Pancreatic amylase. biochemistry. THIS IS A DIRECTORY PAGE. ...
more infohttps://www.britannica.com/science/pancreatic-amylase

Amylase, Urine OutputAmylase, Urine Output

Record start and stop time and date on the requisition. Instruct patient on proper collection. At the beginning of collection have patient void and discard this urine. Begin timing collection at this point and collect all urine until the end of the collection period. Have patient void and save urine at the final collection point.. ...
more infohttps://www.nationwidechildrens.org/specialties/laboratory-services/lab-test-directory/amylase-urine-timed

Low Amylase - Gastroenterology - MedHelpLow Amylase - Gastroenterology - MedHelp

The results showed a low Amylase level of 22 (30-140 being normal range). What does this mean? Is ... ... Low Amylase Levels in Blood Low level of amylase in the body is mostly resulted due to consumption of high amounts of ... Low Amylase Levels in Blood Low level of amylase in the body is mostly resulted due to consumption of high amounts of ... The results showed a low Amylase level of 22 (30-140 being normal range). What does this mean? Is it bad that my amylase level ...
more infohttps://www.medhelp.org/posts/Gastroenterology/Low-Amylase/show/624326

Amylase (Kinetic Method)Amylase (Kinetic Method)

For the quantitative kinetic determination of amylase activity, using manual or automated procedures, in human serum and urine ... Infinity Amylase CNPG3 (Liquid). 6. Infinity Amylase EPS (Liquid). 7. Amylase. 8. Amylase, Body Fluid. 9. Amylase, Isoenzymes. ... Amylase Reagent. 2. Amylase (Colorimetric Method). 3. Amylase (EPS-G7, kinetics). 4. Infinity Amylase (Powder). 5. ... For the quantitative kinetic determination of amylase activity, using manual or automated procedures, in human serum and urine. ...
more infohttp://www.bio-medicine.org/medicine-products/Amylase--28Kinetic-Method-29-2542-1/

Alpha amylase (IPR006046) | InterPro | EMBL-EBIAlpha amylase (IPR006046) | InterPro | EMBL-EBI

Alpha amylase (IPR006046). Short name: Alpha_amylase Overlapping homologous superfamilies *Glycoside hydrolase superfamily ( ... Alpha-amylases, which belong to glycoside hydrolase family 13, are 1,4-alpha-D-glucan glucanohydrolases, which degrade both the ...
more infohttps://www.ebi.ac.uk/interpro/entry/IPR006046

Plus itPlus it

Plasma Amylase After Gastrectomy. Br Med J 1964; 1 doi: https://doi.org/10.1136/bmj.1.5394.1381-a (Published 23 May 1964) Cite ...
more infohttp://www.bmj.com/content/1/5394/1381.2

Alpha-amylase - Lactobacillus amylovorusAlpha-amylase - Lactobacillus amylovorus

IPR031319. A-amylase_C. IPR006046. Alpha_amylase. IPR031965. CBM26. IPR006047. Glyco_hydro_13_cat_dom. IPR013780. Glyco_hydro_b ... IPR031319. A-amylase_C. IPR006046. Alpha_amylase. IPR031965. CBM26. IPR006047. Glyco_hydro_13_cat_dom. IPR013780. Glyco_hydro_b ... Alpha-amylaseImported. ,p>Information which has been imported from another database using automatic procedures.,/p> ,p>,a href ... tr,Q48502,Q48502_LACAM Alpha-amylase OS=Lactobacillus amylovorus OX=1604 PE=3 SV=2 ...
more infohttp://www.uniprot.org/uniprot/Q48502

Amylase - DoctorMyhillAmylase - DoctorMyhill

This test measures the level of the enzyme amylase in the blood serum. This enzyme is specific to the pancreas and raised ... Retrieved from "http://drmyhill.co.uk/drmyhill/index.php?title=Amylase&oldid=14647" ...
more infohttps://drmyhill.co.uk/wiki/Amylase

What is pancreatic amylase? | Reference.comWhat is pancreatic amylase? | Reference.com

Amylase enters the bloodstream when the pancreas becomes inflamed... ... The pancreas and the glands that produce saliva also produce amylase, an enzyme that helps the body digest food, notes ... What does the amylase test indicate for the pancreas?. A: The amylase test indicates whether the pancreas is damaged or blocked ... What is the function of salivary amylase?. A: Salivary amylase is an enzyme responsible for breaking down starch, according to ...
more infohttps://www.reference.com/health/pancreatic-amylase-83fa42eee3f7badd

Beta-amylase - Oryza sativa (Rice)Beta-amylase - Oryza sativa (Rice)

PS00506. BETA_AMYLASE_1. 1 hit. PS00679. BETA_AMYLASE_2. 1 hit. ... PS00506. BETA_AMYLASE_1. 1 hit. PS00679. BETA_AMYLASE_2. 1 hit ... Beta-amylaseUniRule annotation. ,p>Information which has been generated by the UniProtKB automatic annotation system, without ... tr,Q42989,Q42989_ORYSA Beta-amylase OS=Oryza sativa OX=4530 PE=3 SV=1 ...
more infohttp://www.uniprot.org/uniprot/Q42989

Biotechnological Processes in Microbial Amylase ProductionBiotechnological Processes in Microbial Amylase Production

... Subash C. B. Gopinath,1,2 Periasamy Anbu,3 M. K. Md Arshad,1 ... Amylase is an important and indispensable enzyme that plays a pivotal role in the field of biotechnology. It is produced mainly ... Herein, the importance of microbial (bacteria and fungi) amylase is discussed along with its production methods from the ... Industrial sectors with top-down and bottom-up approaches are currently focusing on improving microbial amylase production ...
more infohttps://www.hindawi.com/journals/bmri/2017/1272193/abs/

Amylase activity-Michaelis-Menten modelling?Amylase activity-Michaelis-Menten modelling?

... BruceRat brucerat at aol.com Mon Oct 23 19:25:25 EST 1995 *Previous message: ... Using a simple photometer to detect digestion of iodine-stained arrowroot starch by salivary amylase, I have gotten a graph ...
more infohttp://www.bio.net/bionet/mm/comp-bio/1995-October/000780.html

Amylase - brand name list from Drugs.comAmylase - brand name list from Drugs.com

Find information on amylase use, treatment, drug class and molecular formula. ... Lists the various brand names available for medicines containing amylase. ... Medications containing amylase:. Multi-ingredient medications containing amylase:. amylase/cellulase/hyoscyamine/lipase/ ... Amylase. Important: The information below refers to medicines available in the United States that contain amylase. ...
more infohttps://www.drugs.com/ingredient/amylase.html

Investigate the effect of temperature on amylase activityInvestigate the effect of temperature on amylase activity

Amylase is an enzyme that catalyses the breakdown of starch into sugars. Amylases are f… ... Investigate the effect of temperature on amylase activityIntroduction ... Amylases are foundin almost all plants, animals and microorganisms. Large amounts of amylase occur in germinatingcereals, and ... If the volume of amylase solution is same ineach test tube, the lower concentration means that there are less amylase molecules ...
more infohttps://www.slideshare.net/lanceqwerty/investigate-the-effect-of-temperature-on-amylase-activity

What is Alpha Amylase? (with pictures)What is Alpha Amylase? (with pictures)

If a persons alpha amylase levels are too... ... Alpha amylase is a protein that breaks down large molecules of ... Alpha amylase is a protein involved in the digestion of food. This type of digestive enzyme cleaves large molecules of food ... Alpha amylases are enzymes and, by definition, speed up the rate of reactions. In this case, the reaction is to cleave the ... Pancreatic alpha amylase cleaves the linkages of amylose. This compound is a linear form of starch that lacks the side branches ...
more infohttps://www.wisegeek.com/what-is-alpha-amylase.htm

Enzyme Inhibitors: Pancreatic Amylase | GreenMedInfoEnzyme Inhibitors: Pancreatic Amylase | GreenMedInfo

Pharmacological Actions : Alpha-amylase inhibitor, Alpha-glucosidase inhibitor , Enzyme Inhibitors: Pancreatic Amylase ... 6 Abstracts with Enzyme Inhibitors: Pancreatic Amylase Research. Filter by Study Type. Animal Study. ... Additional Keywords : Alpha-amylase inhibitor, Anthocyanins, Diabetes mellitus: Type 2, Diabetes Mellitus: Type 2: Prevention ... Bisdemethoxycurcumin from Curcuma longa rhizome is a potent small molecule inhibitor of human pancreatic α-amylase, a target ...
more infohttps://www.greenmedinfo.com/pharmacological-action/enzyme-inhibitors-pancreatic-amylase

amylase facts, information, pictures | Encyclopedia.com articles about amylaseamylase facts, information, pictures | Encyclopedia.com articles about amylase

Make research projects and school reports about amylase easy with credible articles from our FREE, online encyclopedia and ... amylase Digestive enzyme secreted by the salivary glands (salivary amylase) and the pancreas (pancreatic amylase. It aids ... as pancreatic amylase) and also (in humans and some other species) in saliva (as salivary amylase or ptyalin). Amylases cleave ... Plants contain both α- and β-amylases; the name diastase is given to the component of malt containing β-amylase, important in ...
more infohttps://www.encyclopedia.com/science-and-technology/biochemistry/biochemistry/amylase

Amylase - WellSpan Health LibraryAmylase - WellSpan Health Library

In the blood, amylase levels rise for only a short time. In the urine, amylase may remain high for several days. ... Babies have little or no amylase at birth. By the end of the first year, a babys amylase level is the same as an adults level ... Pancreatitis usually causes levels of amylase in the urine to remain high for several days longer than blood amylase levels. ... Amylase in bloodfootnote 1. Adults age 60 and younger:. 25-125 units per liter (U/L) or 0.4-2.1 microkatals/liter (mckat/L) ...
more infohttps://www.wellspan.org/health-library/Document.aspx?id=hw1882

Glycosylation and secretion of human α-amylasesGlycosylation and secretion of human α-amylases

Three human α-amylases exist: Amy1 (salivary amylase), Amy2A (pancreatic amylase), and Amy2B (expressed in various tissues). ... Glycosylation patterns of pancreatic amylase and salivary amylase. Human pancreatic amylase and saliva were treated with or ... To detect amylase, the mouse anti-human amylase monoclonal antibody (G-10:sc-46657, Santa Cruz, Santa Cruz, CA) was used as a ... There are three types of human α-amylases: Amy1 is the so-called salivary amylase and is mainly secreted in saliva; Amy2A is ...
more infohttp://file.scirp.org/Html/2-1350038_17272.htm

Eradicake Alpha-AmylaseEradicake Alpha-Amylase

Fuelzyme Alpha-amylase. Industrial Enzyme from USA by Dupont, Verenium. Detalzym GA L-E5 Glucoamylase. Industrial Enzyme from ... Using Eradicake™ alpha-amylase to break down the polymer structures of filter cake is easy and convenient (no specialized ... Eradicake™ alpha-amylase performs at higher temperatures and across a wider range of operating conditions than competitive ... In support of reservoir clean-up needs, Vereniums Eradicake™ alpha-amylase product addresses the removal of filter cake from ...
more infohttp://www.synbioproject.org/cpi/applications/eradicake-alpha-amylase/

Oramyl (Alpha-Amylase) NovartisOramyl (Alpha-Amylase) Novartis

Oramyl information about active ingredients, pharmaceutical forms and doses by Novartis, Oramyl indications, usages and related health products lists
more infohttp://drugs-about.com/drugs-o/oramyl.html

Amylase and Hypersomnia - Full Text View - ClinicalTrials.govAmylase and Hypersomnia - Full Text View - ClinicalTrials.gov

Amylase and Hypersomnia (Amylase). The safety and scientific validity of this study is the responsibility of the study sponsor ... Show an increase of salivary amylase for children with hypersomnia or narcolepsy compared to a group of children matched on age ... Studies have shown for healthy subjects, that the expression and activity of salivary amylase are increased when subjects are ... Evaluation of Excessive Diurnal Sleepiness by the Expression and Activity of Salivary Amylase in Children With Hypersomnia.. ...
more infohttps://clinicaltrials.gov/ct2/show/NCT01926405?term=Hypersomnia&rank=3
  • Herein, the importance of microbial (bacteria and fungi) amylase is discussed along with its production methods from the laboratory to industrial scales. (hindawi.com)
  • Optimum pH - 7.0 Human body temperature[citation needed] Presence of certain anions and activators: Chloride and bromide - most effective Iodide - less effective Sulfate and phosphate - least effective The salivary amylase gene has undergone duplication during evolution, and DNA hybridization studies indicate many individuals have multiple tandem repeats of the gene. (wikipedia.org)
  • For example, a Japanese individual had 14 copies of the amylase gene (one allele with 10 copies, and a second allele with four copies). (wikipedia.org)
  • Perry and colleagues speculated the increased copy number of the salivary amylase gene may have enhanced survival coincident to a shift to a starchy diet during human evolution. (wikipedia.org)
  • α-Amylase is used in ethanol production to break starches in grains into fermentable sugars. (wikipedia.org)
  • The first step in the production of high-fructose corn syrup is the treatment of cornstarch with α-amylase, producing shorter chains of sugars oligosaccharides. (wikipedia.org)
  • salivary - AMY1A, AMY1B, AMY1C pancreatic - AMY2A, AMY2B α-Amylase activity in grain is measured by, for instance, the Hagberg-Perten Falling Number, a test to assess sprout damages, or the Phadebas method. (wikipedia.org)
  • Amylases are foundin almost all plants, animals and microorganisms. (slideshare.net)
  • Low level of amylase in the body is mostly resulted due to consumption of high amounts of carbohydrates. (medhelp.org)
  • The normal amylase levels in the blood is 25 to 160 U/L (units per liter). (buzzle.com)
  • In general, salivary amylase is more frequently glycosylated than pancreatic amylase, and it is still uncertain why differences in the glycosylation pattern among human amylase isozymes occur. (scirp.org)
  • Although there are two potential N-glycosylation sites (N427 and N476) in the C-terminal region of these amylases, glycosylation of the amylases seems to occur in a tissuespecific manner. (scirp.org)
  • It is still uncertain, however, why differences in the glycosylation pattern among human amylase isozymes occur. (scirp.org)
  • Medications such as aspirin, birth control pills, opiates and thiazide diuretics may cause false readings on an amylase test. (reference.com)
  • The normal range of amylase in the blood is between 23 and 85 units per liter, though some laboratories use different ranges, and patients should rely on their doctors to advise if their results are abnormal, states MedlinePlus. (reference.com)
  • As with other tests that involve blood samples, fainting or feeling light-headed, hematoma, infection and excessive bleeding are possible side effects of an amylase blood test. (reference.com)
  • In the blood, amylase levels rise for only a short time. (wellspan.org)
  • For a blood test for amylase, do not eat or drink anything except water for at least 2 hours before having the test. (wellspan.org)
  • An amylase test measures the amount of amylase in the blood. (childrensmn.org)
  • If you have questions about the amylase test, speak with your doctor or the health professional doing the blood draw. (childrensmn.org)
  • Salivary α-amylase has been used as a biomarker for stress and as a surrogate marker of sympathetic nervous system (SNS) activity that does not require a blood draw. (wikipedia.org)
  • In the case of human amylase, glycosylation may not be important since the unglycosylated form of amylases is fully secreted and active. (scirp.org)
  • β-amylase is present in an inactive form prior to seed germination. (wikipedia.org)
  • Bisdemethoxycurcumin from Curcuma longa rhizome is a potent small molecule inhibitor of human pancreatic α-amylase, a target for type-2 diabetes. (greenmedinfo.com)
  • The difference in the glycosylation efficiency of each N-glycosylation site also seemed to contribute in part to generate different glycosylation patterns of human amylases. (scirp.org)
  • We also confirmed that the C-terminal region of human amylase plays a critical role in secretion, although glycosylation does not play a part in this effect. (scirp.org)
  • The N-glycan structures of human amylase from the parotid are complex-type glycans with several glycoforms . (scirp.org)
  • The N-glycan structures of human amylase from tumors were similar but modified compared to those of parotid amylase [3, (scirp.org)
  • These findings seem to be highly related to the different glycosylation pattern of human amylases. (scirp.org)
  • In addition, we discuss the importance of the C-terminal region of human amylase in secretion. (scirp.org)
  • Human pancreatic amylase was purchased from Meridian Life Science, Inc. (Saco, ME). (scirp.org)
  • human salivary α-amylase. (sigmaaldrich.com)