Amitrole: A non-selective post-emergence, translocated herbicide. According to the Seventh Annual Report on Carcinogens (PB95-109781, 1994) this substance may reasonably be anticipated to be a carcinogen. (From Merck Index, 12th ed) It is an irreversible inhibitor of CATALASE, and thus impairs activity of peroxisomes.Pesticide Residues: Pesticides or their breakdown products remaining in the environment following their normal use or accidental contamination.Lethal Dose 50: The dose amount of poisonous or toxic substance or dose of ionizing radiation required to kill 50% of the tested population.Carbonates: Salts or ions of the theoretical carbonic acid, containing the radical CO2(3-). Carbonates are readily decomposed by acids. The carbonates of the alkali metals are water-soluble; all others are insoluble. (From Grant & Hackh's Chemical Dictionary, 5th ed)Toxicity Tests, Acute: Experiments designed to determine the potential toxic effects of one-time, short-term exposure to a chemical or chemicals.Sodium Bicarbonate: A white, crystalline powder that is commonly used as a pH buffering agent, an electrolyte replenisher, systemic alkalizer and in topical cleansing solutions.Pesticides: Chemicals used to destroy pests of any sort. The concept includes fungicides (FUNGICIDES, INDUSTRIAL); INSECTICIDES; RODENTICIDES; etc.Dogs: The domestic dog, Canis familiaris, comprising about 400 breeds, of the carnivore family CANIDAE. They are worldwide in distribution and live in association with people. (Walker's Mammals of the World, 5th ed, p1065)Plant Extracts: Concentrated pharmaceutical preparations of plants obtained by removing active constituents with a suitable solvent, which is evaporated away, and adjusting the residue to a prescribed standard.Toxicology: The science concerned with the detection, chemical composition, and biological action of toxic substances or poisons and the treatment and prevention of toxic manifestations.United States Indian Health Service: A division of the UNITED STATES PUBLIC HEALTH SERVICE that is responsible for the public health and the provision of medical services to NATIVE AMERICANS in the United States, primarily those residing on reservation lands.AlaskaIndians, North American: Individual members of North American ethnic groups with ancient historic ancestral origins in Asia.Inuits: Inuktitut-speakers generally associated with the northern polar region.Federal Government: The level of governmental organization and function at the national or country-wide level.Health Services, Indigenous: Health care provided to specific cultural or tribal peoples which incorporates local customs, beliefs, and taboos.United StatesSouth DakotaUnited States Public Health Service: A constituent organization of the DEPARTMENT OF HEALTH AND HUMAN SERVICES concerned with protecting and improving the health of the nation.Comprehensive Health Care: Providing for the full range of personal health services for diagnosis, treatment, follow-up and rehabilitation of patients.2H-Benzo(a)quinolizin-2-ol, 2-Ethyl-1,3,4,6,7,11b-hexahydro-3-isobutyl-9,10-dimethoxy-: Proposed catecholamine depletor.WashingtonFlatfishes: Common name for the order Pleuronectiformes. A very distinctive group in that during development they become asymmetrical, i.e., one eye migrates to lie adjacent to the other. They swim on the eyeless side. FLOUNDER, sole, and turbot, along with several others, are included in this order.Oncorhynchus kisutch: An anadromous species of SALMON ranging from the Arctic and Pacific Oceans to Monterey Bay, California and inhabiting ocean and coastal streams. It is familiarly known as the coho or silver salmon. It is relatively small but its light-colored flesh is of good flavor.Pacific OceanSound: A type of non-ionizing radiation in which energy is transmitted through solid, liquid, or gas as compression waves. Sound (acoustic or sonic) radiation with frequencies above the audible range is classified as ultrasonic. Sound radiation below the audible range is classified as infrasonic.Water Pollutants, Chemical: Chemical compounds which pollute the water of rivers, streams, lakes, the sea, reservoirs, or other bodies of water.Fish Diseases: Diseases of freshwater, marine, hatchery or aquarium fish. This term includes diseases of both teleosts (true fish) and elasmobranchs (sharks, rays and skates).Sound Localization: Ability to determine the specific location of a sound source.Heart Sounds: The sounds heard over the cardiac region produced by the functioning of the heart. There are four distinct sounds: the first occurs at the beginning of SYSTOLE and is heard as a "lubb" sound; the second is produced by the closing of the AORTIC VALVE and PULMONARY VALVE and is heard as a "dupp" sound; the third is produced by vibrations of the ventricular walls when suddenly distended by the rush of blood from the HEART ATRIA; and the fourth is produced by atrial contraction and ventricular filling.South Australia: A state in south central Australia. Its capital is Adelaide. It was probably first visited by F. Thyssen in 1627. Later discoveries in 1802 and 1830 opened up the southern part. It became a British province in 1836 with this self-descriptive name and became a state in 1901. (From Webster's New Geographical Dictionary, 1988, p1135)Lolium: Common member of the Gramineae family used as cattle FODDER. It harbors several fungi and other parasites toxic to livestock and people and produces allergenic compounds, especially in its pollen. The most commonly seen varieties are L. perenne, L. multiflorum, and L. rigidum.Herbicides: Pesticides used to destroy unwanted vegetation, especially various types of weeds, grasses (POACEAE), and woody plants. Some plants develop HERBICIDE RESISTANCE.Herbicide Resistance: Diminished or failed response of PLANTS to HERBICIDES.Proline: A non-essential amino acid that is synthesized from GLUTAMIC ACID. It is an essential component of COLLAGEN and is important for proper functioning of joints and tendons.Acetolactate Synthase: A flavoprotein enzyme that catalyzes the formation of acetolactate from 2 moles of PYRUVATE in the biosynthesis of VALINE and the formation of acetohydroxybutyrate from pyruvate and alpha-ketobutyrate in the biosynthesis of ISOLEUCINE. This enzyme was formerly listed as EC 4.1.3.18.Australia: The smallest continent and an independent country, comprising six states and two territories. Its capital is Canberra.Sulfonylurea CompoundsTriazines: Heterocyclic rings containing three nitrogen atoms, commonly in 1,2,4 or 1,3,5 or 2,4,6 formats. Some are used as HERBICIDES.Codon: A set of three nucleotides in a protein coding sequence that specifies individual amino acids or a termination signal (CODON, TERMINATOR). Most codons are universal, but some organisms do not produce the transfer RNAs (RNA, TRANSFER) complementary to all codons. These codons are referred to as unassigned codons (CODONS, NONSENSE).

Role of antioxidant defenses against ethanol-induced damage in cultured rat gastric epithelial cells. (1/160)

Reactive oxygen species appears to be involved in the pathogenesis of ethanol-induced gastric mucosal injury in vivo. Because ingested ethanol diffuses into the gastric mucosa, targeting both epithelium and endothelium, in the present study we examined the possible protective effect of antioxidants on ethanol damage in gastric epithelial cells and endothelial cells in vitro. Cytotoxicity by ethanol was quantified by measuring 51Cr release. The effects of impairment of the glutathione redox cycle and of inhibition of cellular catalase were examined. The generation of superoxide was assessed by the reduction in cytochrome c. Ethanol caused a time- and dose-dependent increase in 51Cr release from epithelial cells. Incubation of cells with DL-buthionine-(S,R)-sulfoximine, while reducing glutathione production, dose dependently enhanced ethanol-induced injury. 1,3-Bis(chloroethyl)-nitrosourea, while inhibiting glutathione reductase activity, also sensitized cells to ethanol. In contrast, the inhibition of catalase with 3-amino-1,2, 4-triazole did not alter the susceptibility of epithelial cells to ethanol. Ethanol induced damage to endothelial cells in a similar fashion. In endothelial cells, however, neither impairment of the glutathione cycle nor inhibition of catalase influenced ethanol-induced damage. Epithelial cells, when exposed to ethanol, increased superoxide production as a function of ethanol concentration, whereas endothelial cells did not. The glutathione redox cycle, but not cellular catalase, plays a critical role in protecting epithelial cells against ethanol damage, whereas neither antioxidant seems to play a role in protection of endothelial cells. The distinct difference in antioxidant protection against ethanol appears to depend on the capability of each cell to produce cytotoxic oxygen species in response to ethanol exposure.  (+info)

Reactive oxygen species participate in mdr1b mRNA and P-glycoprotein overexpression in primary rat hepatocyte cultures. (2/160)

P-glycoproteins encoded by multidrug resistance type 1 (mdr1) genes mediate ATP-dependent efflux of numerous lipophilic xenobiotics, including several anticancer drugs, from cells. Overexpression of mdr1-type transporters in tumour cells contributes to a multidrug resistance phenotype. Several factors shown to induce mdr1 overexpression (UV irradiation, epidermal growth factor, tumour necrosis factor alpha, doxorubicin) have been associated with the generation of reactive oxygen species (ROS). In the present study, primary rat hepatocyte cultures that exhibit time-dependent overexpression of the mdr1b gene were used as a model system to investigate whether ROS might participate in the regulation of intrinsic mdr1b overexpression. Addition of H2O2 to the culture medium resulted in a significant increase in mdrlb mRNA and P-glycoprotein after 3 days of culture, with maximal (approximately 2-fold) induction being observed with 0.5-1 mM H2O2. Furthermore, H2O2 led to activation of poly(ADP-ribose) polymerase, a nuclear enzyme activated by DNA strand breaks, indicating that ROS reached the nuclear compartment. Thus, extracellularly applied H2O2 elicited intracellular effects. Treatment of rat hepatocytes with the catalase inhibitor 3-amino-1,2,4-triazole (2-4 mM for 72 h or 10 mM for 1 h following the hepatocyte attachment period) also led to an up-regulation of mdrlb mRNA and P-glycoprotein expression. Conversely, antioxidants (1 mM ascorbate, 10 mM mannitol, 2% dimethyl sulphoxide, 10 mM N-acetylcysteine) markedly suppressed intrinsic mdr1b mRNA and P-glycoprotein overexpression. Intracellular steady-state levels of the mdrl substrate rhodamine 123, determined as parameter of mdr1-type transport activity, indicated that mdr1-dependent efflux was increased in hepatocytes pretreated with H2O2 or aminotriazole and decreased in antioxidant-treated cells. The induction of mdr1b mRNA and of functionally active mdr1-type P-glycoproteins by elevation in intracellular ROS levels and the repression of intrinsic mdrlb mRNA and P-glycoprotein overexpression by antioxidant compounds support the conclusion that the expression of the mdr1b P-glycoprotein is regulated in a redox-sensitive manner.  (+info)

Susceptibility to hydrogen peroxide and catalase activity of root nodule bacteria. (3/160)

The root nodule bacteria (free-living cells) tested had higher susceptibility to hydrogen peroxide (H2O2) than the other genera of aerobic or facultative anaerobic bacteria tested. The catalase activities tended to have a positive correlation with H2O2 resistance among all bacteria tested. Addition of a catalase inhibitor such as 3-amino-1, 2, 4-triazole increased the susceptibility to H2O2. These results suggest that the lower catalase activity brings about the higher susceptibility of root nodule bacteria to H2O2. Root nodule bacteria seemed to have two or three catalase isozymes during growth and their catalase activities were higher in log phase than in stationary phase, contrary to other genera of bacteria tested.  (+info)

A TATA-binding protein mutant defective for TFIID complex formation in vivo. (4/160)

Using an intragenic complementation screen, we have identified a temperature-sensitive TATA-binding protein (TBP) mutant (K151L, K156Y) that is defective for interaction with certain yeast TBP-associated factors (TAFs) at the restrictive temperature. The K151L,K156Y mutant appears to be functional for RNA polymerase I (Pol I) and Pol III transcription, and it is capable of supporting Gal4-activated and Gcn4-activated transcription by Pol II. However, transcription from certain TATA-containing and TATA-less Pol II promoters is reduced at the restrictive temperature. Immunoprecipitation analysis of extracts prepared after culturing cells at the restrictive temperature for 1 h indicates that the K151L,K156Y derivative is severely compromised in its ability to interact with TAF130, TAF90, TAF68/61, and TAF25 while remaining functional for interaction with TAF60 and TAF30. Thus, a TBP mutant that is compromised in its ability to form TFIID can support the response to Gcn4 but is defective for transcription from specific promoters in vivo.  (+info)

Generation of reactive oxygen species by human mesothelioma cells. (5/160)

Malignant mesothelioma cells contain elevated levels of manganese superoxide dismutase (MnSOD) and are highly resistant to oxidants compared to non-malignant mesothelial cells. Since the level of cellular free radicals may be important for cell survival, we hypothesized that the increase of MnSOD in the mitochondria of mesothelioma cells may alter the free radical levels of these organelles. First, MnSOD activity was compared to the activities of two constitutive mitochondrial enzymes; MnSOD activity was 20 times higher in the mesothelioma cells than in the mesothelial cells, whereas the activities of citrate synthase and cytochrome c oxidase did not differ significantly in the two cell lines. This indicates that the activity of MnSOD per mitochondrion was increased in the mesothelioma cells. Superoxide production was assayed in the isolated mitochondria of these cells using lucigenin chemiluminescence. Mitochondrial superoxide levels were significantly lower (72%) in the mesothelioma cells compared to the mesothelial cells. Oxidant production in intact cells, assayed by fluorimetry using 2',7'-dichlorodihydrofluorescein as a fluorescent probe, did not differ significantly between these cells. We conclude that mitochondrial superoxide levels are lower in mesothelioma cells compared to nonmalignant mesothelial cells, and that this difference may be explained by higher MnSOD activity in the mitochondria of these cells. Oxidant production was not different in these cells, which may be due to the previously observed increase in H2O2-scavenging mechanisms of mesothelioma cells.  (+info)

Arsenic trioxide selectively induces acute promyelocytic leukemia cell apoptosis via a hydrogen peroxide-dependent pathway. (6/160)

Low concentrations of As(2)O(3) (+info)

Role of megalin (gp330) in transcytosis of thyroglobulin by thyroid cells. A novel function in the control of thyroid hormone release. (7/160)

When thyroglobulin (Tg) is endocytosed by thyrocytes and transported to lysosomes, thyroid hormones (T4 and T3) are released. However, some internalized Tg is transcytosed intact into the bloodstream, thereby avoiding proteolytic cleavage. Here we show that megalin (gp330), a Tg receptor on thyroid cells, plays a role in Tg transcytosis. Following incubation with exogenous rat Tg at 37 degrees C, Fisher rat thyroid (FRTL-5) cells, a differentiated thyroid cell line, released T3 into the medium. However, when cells were incubated with Tg plus either of two megalin competitors, T3 release was increased, suggesting that Tg internalized by megalin bypassed the lysosomal pathway, possibly with release of undegraded Tg from cells. To assess this possibility, we performed experiments in which FRTL-5 cells were incubated with either unlabeled or (125)I-labeled Tg at 37 degrees C to allow internalization, treated with heparin to remove cell surface-bound Tg, and further incubated at 37 degrees C to allow Tg release. Intact 330-kDa Tg was released into the medium, and the amount released was markedly reduced by megalin competitors. To investigate whether Tg release resulted from transcytosis, we studied FRTL-5 cells cultured as polarized layers with tight junctions on permeable filters in the upper chamber of dual chambered devices. Following the addition of Tg to the upper chamber and incubation at 37 degrees C, intact 330-kDa Tg was found in fluids collected from the lower chamber. The amount recovered was markedly reduced by megalin competitors, indicating that megalin mediates Tg transcytosis. We also studied Tg transcytosis in vivo, using a rat model of goiter induced by aminotriazole, in which increased release of thyrotropin induces massive colloid endocytosis. This was associated with increased megalin expression on thyrocytes and increased serum Tg levels, with reduced serum T3 levels, supporting the conclusion that megalin mediates Tg transcytosis. Tg transcytosis is a novel function of megalin, which usually transports ligands to lysosomes. Megalin-mediated transcytosis may regulate the extent of thyroid hormone release.  (+info)

Salicylic acid mediated by the oxidative burst is a key molecule in local and systemic responses of cotton challenged by an avirulent race of Xanthomonas campestris pv malvacearum. (8/160)

We analyzed the production of reactive oxygen species, the accumulation of salicylic acid (SA), and peroxidase activity during the incompatible interaction between cotyledons of the cotton (Gossypium hirsutum) cv Reba B50/Xanthomonas campestris pv malvacearum (Xcm) race 18. SA was detected in petioles of cotyledons 6 h after infection and 24 h post inoculation in cotyledons and untreated leaves. The first peak of SA occurred 3 h after generation of superoxide (O(2)(.-)), and was inhibited by infiltration of catalase. Peroxidase activity and accumulation of SA increased in petioles of cotyledons and leaves following H(2)O(2) infiltration of cotyledons from 0.85 to 1 mM. Infiltration of 2 mM SA increased peroxidase activity in treated cotyledons and in the first leaves, but most of the infiltrated SA was rapidly conjugated within the cotyledons. When increasing concentrations of SA were infiltrated 2. 5 h post inoculation at the beginning of the oxidative burst, the activity of the apoplastic cationic O(2)(.-)-generating peroxidase decreased in a dose-dependent manner. We have shown that during the cotton hypersensitive response to Xcm, H(2)O(2) is required for local and systemic accumulation of SA, which may locally control the generation of O(2)(.-). Detaching cotyledons at intervals after inoculation demonstrated that the signal leading to systemic accumulation of SA was emitted around 3 h post inoculation, and was associated with the oxidative burst. SA produced 6 h post infection at HR sites was not the primary mobile signal diffusing systemically from infected cotyledons.  (+info)

*3-Amino-1,2,4-triazole

As an herbicide, it is known as aminotriazole, amitrole or amitrol. Amitrol was included in a biocide ban proposed by the ... EXTOXNET - Herbicide fact sheet for amitrole "NIOSH Pocket Guide to Chemical Hazards #0027". National Institute for ...

*Hunter Valley cannabis infestation

... amitrole and bromacil to control the outbreak. Officers using knapsack sprayers were deployed to deal with smaller infestations ...

*List of MeSH codes (D03)

... amitrole MeSH D03.383.129.799.450 --- fluconazole MeSH D03.383.129.799.500 --- guanazole MeSH D03.383.129.799.550 --- ...

*List of IARC Group 3 carcinogens

2-Amino-4-nitrophenol 2-Amino-5-nitrophenol 4-Amino-2-nitrophenol 2-Amino-5-nitrothiazole 11-Aminoundecanoic acid Amitrole ...
Toxicological studies Acute toxicity studies The acute toxicity of amitrole to several animal species is given in Table 1. No signs of toxicity were observed in one beagle-type female dog when given amitrole (96.1%) by gavage at a dosage of 2150 mg/kg bw. Another dog receiving 4640 mg/kg bw vomited within 1 hour, and no signs of toxicity were observed thereafter (Fogleman, 1954). When a commercial product (water soluble powder with 50% active ingredient) was administered to mice, the LD50 was reduced to 4.0 g/kg bw amitrole. By determining the mean lethal dose for amitrole in different preparations, it was established that sodium carbonate, sodium bicarbonate and wetting agents as admixtures in various quantities considerably increase the toxicity of amitrole (Hapke, 1967). WHO has classified amitrole as unlikely to present acute hazard in normal use (WHO, 1992). Table 1. Acute toxicity of amitrole in animals Species Sex Route LD50 LC50 Purity Reference (mg/kg bw) (mg/m3) Mouse M oral 14 700 7 9 ...
Codina M.C.; Morales P.C., 1983: Effect of amitrole on chloroplast pigment levels in Nicotiana rustica and Triticum vulgare plants
The aim of this study was to determine the effect of endogenous vascular hydrogen peroxide on the vasomotor tone of resistance vessels in vivo. Our new finding is that a reduction of steady-state concentrations of vascular hydrogen peroxide induced by a vascular specific overexpression of human catalase resulted in a marked reduction of sBP in mice. This hypotension was completely reversed by treatment with the catalase inhibitor aminotriazole but was independent of vascular eNOS protein content, eNOS activity, and the efficiency of the NO/cGMP pathway as evidenced by Western blot analysis, chronic treatment with the NOS inhibitor L-NAME, and organ bath experiments, respectively. These data suggest that endogenous hydrogen peroxide is a vasoconstrictor in resistance vessels in vivo. We assume that the vasoconstrictor effects of hydrogen peroxide in resistance vessels might contribute to the development of essential hypertension.. Our data obtained in transgenic mice overexpressing catalase ...
Kailash C. Bhuyan.; Durga K. Bhuyan. Regulation of hydrogen peroxide in eye humors effect of 3-amino-1H-1,2,4-triazole on catalase and glutathione peroxidase of rabbit eye. Biochimica et Biophysica Acta (BBA) - General Subjects. 1977, 497, (3), 641-651.. Grant R. Krow .; James T. Carey .; David E. Zacharias .; Edward E. Knaus. Reexamination of stereochemical issues concerning 2-phenyl-1,2-dihydropyridine-maleimide cycloadditions. J. Org. Chem. 1982, 47, (11), 1989-1993.. ...
actinole adrigole aerosoul agricole air-hole ale-pole altivole amitrole anethole annopole anticoal antigoal antihole antipole antiroll antitoll arm-hole arsehole arvicole asystole attomole autoroll autotoll backroll baggbole balokole bandrole bankroll barnsole basshole beadroll beanhole beanpole bed-roll belepole benapole bendroll betazole bettolle blogroll blowhole bocicoel boerboel bolthole bootsole borazole borecole borehole braciole bradpole brewpole briciole brignole britbowl bromvoel bunghole butthole buttsole c-scroll cabriole cakehole camisole capitoll capreole capriole caracole carneole carriole cat-hole ceresole chandole charcoal chetnole chrisole chughole claypole clodpole clypeole coalhole coloroll conazole copstole corehole corneole cornhole crabhole craphole cum-hole day-coal decimole delabole denehole deyrolle diacoele diarsole diastole dib-hole dickhole diindole dimazole disenrol ditazole dithiole dog-hole downhole drumroll drupeole duckhole duckmole dunghole dustbowl dyastole ...
I dont know if its best, but I use synthetic media, e.g. complete synthetic minus hisitidine etc. I autoclave the media first, then let it cool some before adding the appropriate amound of 3AT. I make up the 3AT in H2O as a 1 M stock and store it at -20. I have found that adding 35 glucose to the media instead of my usual 2% increases plating efficiency on this media, but this is somewhat anecdotal. It is crucial to leave the histidine out of the media; thus, I would not expect rich media such as YEPD to work. Megan Brown mbrown at fred.fhcrc.org ROSENKRANTZ at Gems.VCU.EDU wrote: : Can someone tell me the best plate to use 3 aminotriazole on and : directions or a citation? Thanks ...
0.375, 0.500 and 0.625 kg imazapyr/ha and combinations of 5.0 kg atrazine + 1.9 kg amitrole or 8.0 kg diuron + 1.9 kg amitrole/ha were evaluated for roadside control of Cruciferae, Umbelliferae, Compositae, Papilionaceae [Leguminosae] and grasses (mostly Brachypodium distachyon and Lophochloa phleoides). Treatments were applied post-em. to weeds 40-50 cm tall. Imazapyr acted very slowly with the first symptoms visible only 4 weeks after application and complete control evident 4 months later. The highest application rate achieved complete control of all annual weeds and inhibition of growth of the perennial Andropogon distachyos. Atrazine + amitrole and diuron + amitrole provided good control of annual weeds. In further trials on a roadside verge in the Ayalon Valley 0.375, 0.500 and 0.625 kg imazapyr, 4.0 kg diuron + 2.5 kg atrazine and 3.2 kg diuron + 0.8 kg bromacil/ha were applied post-em. to weeds 15-40 cm tall. 6 months after application 0.625 kg imazapyr provided excellent weed control, ...
Yeast two-hybrid testing and RT-PCR analyses. Interactions between A2 and different glycoprotein hormone subunits were assessed in the yeast two-hybrid system using pGBT9 GAL4-binding domain (BD) and pGADGH GAL4-activation domain (AD) vectors (12). Specific binding of different protein pairs was evaluated based on the activation of GAL1-HIS3 and GAL4-lacZ reporter genes (Clontech Laboratories Inc., Palo Alto, California, USA). The mature region of human A2 cDNA was fused to the GAL4-AD in a yeast shuttle vector, pGADGH. Similarly, cDNAs encoding other glycoprotein hormone subunits without the signal peptides were fused to the GAL-4-BD of the pGBT9 vector. Specific interactions of different protein pairs were evaluated based on the activation of the GAL1-HIS3 reporter gene in medium lacking leucine, tryptophan, and histidine but in the presence of 5 mM 3-aminotriazole (13). At least 10 different colonies expressing each pair of fusion proteins were tested.. For RT-PCR analysis of A2 and B5 mRNA ...
Learn more about 1-4-bromobenzyl-1h-1-2-4-triazole. We enable science by offering product choice, services, process excellence and our people make it happen.
Learn more about 5-bromo-1-3-dimethyl-1h-1-2-4-triazole. We enable science by offering product choice, services, process excellence and our people make it happen.
Hello all I ordered the Activate Xtreme + Triazole stack today and had a few qs Ive been on nolva for about a month or so at 40mg ED to reduce/remove
BEIJING - The Chinese Ministry of Commerce said Thursday that it had started an anti-dumping investigation into acrylonitrile-butadiene rubber (NBR) from the Republic of Korea and Japan. The investigation should be concluded by Nov 9 next year, according to an official statement, but may extend to May 9, 2019. NBR is widely used in oil and petrol resistant industrial rubber products. It is essential to production of aircraft fuel tank seals, fuel hoses, bag fuel tanks and aircraft window seals. ...
The poly(A) tail of an mRNA is believed to influence the initiation of translation, and the rate at which the poly(A) tail is removed is thought to determine how fast an mRNA is degraded. One key factor associated with this 3-end structure is the poly(A)-binding protein (Pab1p) encoded by the PAB1 gene in Saccharomyces cerevisiae. In an effort to learn more about the functional role of this protein, we used a two-hybrid screen to determine the factor(s) with which it interacts. We identified five genes encoding factors that specifically interact with the carboxy terminus of Pab1p. Of a total of 44 specific clones identified, PBP1 (for Pab1p-binding protein) was isolated 38 times. Of the putative interacting genes examined, PBP1 promoted the highest level of resistance to 3-aminotriazole (|100 mM) in constructs in which HIS3 was used as a reporter. We determined that a fraction of Pbp1p cosediments with polysomes in sucrose gradients and that its distribution is very similar to that of Pab1p. Disruption
Sigma-Aldrich offers abstracts and full-text articles by [Meng Zhang, Da-Nian Qin, Yu-Ping Suo, Qing Su, Hong-Bao Li, Yu-Wang Miao, Jing Guo, Zhi-Peng Feng, Jie Qi, Hong-Li Gao, Jian-Jun Mu, Guo-Qing Zhu, Yu-Ming Kang].
Anything in DS Triazoles ingredients I should be concerned about? Anything a little shady or possibly detrimental for long term use? Triazole Also - in the FAQ they state triazole can actually reduce the amount of estrogen receptors in the body (in addition to displacing estrogen) - is this possible - especially for an over the counter product like this?
The highly controversial force-induced cycloreversion of 1,2,3-triazole, its well-known retro-click reaction, is shown to be possible only for 1,5-substituted triazoles, but competes with rupture of an adjacent single-bond. We draw this conclusion from both static and dynamic calculations under external mech
The present work deals with the pharmacological screening of some newly synthesized triazoles. A series of 1,2,4-triazoles have been synthesized using benzoic acid or 4-chloro benzoic acid as the...
Sigma-Aldrich offers Aldrich-290750, 1-(8-Quinolinesulfonyl)-3-nitro-1H-1,2,4-triazole for your research needs. Find product specific information including CAS, MSDS, protocols and references.
I have been using triazole for the last 3 weeks and noticed at 3 pills, it lowered libido so I reduced it to two and now feel great. Libido is through
Some 3-thioxo/alkylthio-1,2,4-triazoles with a substituted thiourea moiety as possible antimycobacterials.: A series of novel N-alkyl/aryl-N-[4-(4-alkyl/aryl-2
0019] The synergistic mixture of the present invention can be applied in conjunction with one or more other herbicides to control a wider variety of undesirable vegetation. When used in conjunction with other herbicides, the composition can be formulated with the other herbicide or herbicides, tank mixed with the other herbicide or herbicides or applied sequentially with the other herbicide or herbicides. Some of the herbicides that can be employed in conjunction with the synergistic composition of the present invention include: 2,4-D, acetochlor, acifluorfen, aclonifen, AE0172747, alachlor, amidosulfuron, aminotriazole, ammonium thiocyanate, anilifos, atrazine, AVH 301, azimsulfuron, benfuresate, bensulfuron-methyl, bentazone, benthiocarb, benzobicyclon, bifenox, bispyribac-sodium, bromacil, bromoxynil, butachlor, butafenacil, butralin, cafenstrole, carbetamide, carfentrazone-ethyl, chlorflurenol, chlorimuron, chlorpropham, cinosulfuron, clethodim, clomazone, clopyralid, cloransulam-methyl, ...
We provided evidence in the present report suggesting that treatment of the BEAS-2B cells with continuous low concentration of As3+ induces cell transformation and that the capacity of ROS generation in the transformed cells was severely compromised. Such a reduction in ROS generation seems to be responsible for fast proliferation, anchorage-independent growth, and resistance to As3+ toxicity of the transformed cells. A sustained alternative activation of NF-κB might contribute to the fast and anchorage-independent growth of these cells due to reduced ROS generation. The fast growth of the transformed cells could be reversed by either resuming the ROS production through SOD2/catalase inhibition or gene silencing of NF-κB p105/50.. ROS have long been viewed as major contributors to oxidative injury and DNA damage of tissues or cells (22). A sustained oxidative injury and unrepaired damage on DNA will be carcinogenic due to accumulation of genetic mutations that either activate oncogenes or ...
Why does the relative amount of catalase activity vary in tissues of different types, in particular liver, apple, potato and kidney. Why is that when hydrogen peroxide is added to liver tissue, a greater volume of oxygen is produced than when the same experiment is carried out using apple, potato or kidney tissue ...
Catalase小鼠单克隆抗体[1A1](ab16771)可与小鼠, 大鼠, 人样本反应并经IP, ELISA, Flow Cyt, ICC/IF实验严格验证,被3篇文献引用并得到1个独立的用户反馈。
Effects of Temperature and pH on Catalase Activity INTRODUCTION Enzymes are organic catalysts that spur metabolic reactions. The presence of an enzyme within...
Serving Size: 1 CapsuleServings Per Container: 90Amount Per ServingServing% DVZinc (from Zinc Aspartate)5 mg33.000%Triazole Proprietary Blend750 mg Proprietary Blend: Triazole Proprietary Blend: LetroDex: pZole (Proprietary Extract of Brassaiopsis Gl
there is probably an INIT STRING type variable in /etc/ppp or /etc/pppd/ somewhere. Change it to start off with that string instead of the usual ATZ0 (I think that is normal). Try `grep ATZ /etc/* -r` that might tell you a file that has it contained within ...
Alzheimers disease, Familial British dementia, Familial Danish dementia, Type 2 diabetes mellitus, plus Creutzfeldt-Jakob disease are associated with amyloid fibril deposition and oxidative stress. The antioxidant enzyme catalase is a neuroprotective amyloid binding protein. Herein the effects of catalase overexpression in SH-SY5Y neuronal cells on the toxicity of amyloid-β (Aβ), amyloid-Bri (ABri), amyloid-Dan (ADan), amylin (IAPP), and prion protein (PrP) peptides were determined. Results showed catalase overexpression was neuroprotective against Aβ, ABri, ADan, IAPP, and PrP peptides. The catalase inhibitor 3-amino-1,2,4-triazole (3-AT) and catalase-amyloid interaction inhibitor benzothiazole aniline tetra(ethylene glycol) (BTA-EG4) significantly enhanced neurotoxicity of amyloid peptides in catalase overexpressing neuronal cells. This suggests catalase neuroprotection involves breakdown of hydrogen peroxide (H2O2) plus a direct binding interaction between catalase and the Aβ, ABri, ...
The Delaney Clause applied to pesticides in processed foods, but only when the concentration of a residue of a cancer-causing pesticide increased during processing; for example when more of a pesticide was present in ketchup than in the raw tomatoes used to make it. (It never applied to pesticides in raw foods.) When the law was passed, "neither advocates nor opponents of the policy, including FDA officials, believed it would have broad application, for only a handful of chemicals had then been shown to be animal carcinogens."[2]. The Delaney Clause was invoked in 1959 when Arthur Sherwood Flemming, the Secretary of the Department of Health, Education and Welfare issued a statement advising the public about the possible contamination of substantial quantities of cranberries in Oregon and Washington with the herbicide aminotriazole, which the FDA had recently determined was a carcinogen (see Cranberry scare of 1959). Taking place the week of Thanksgiving, the announcement was referred to by many ...
Catalase兔单克隆抗体[EPR1928Y](ab76110)可与小鼠, 大鼠, 人样本反应并经WB, IHC实验严格验证。中国75%以上现货,所有产品均提供质保服务,可通过电话、电邮或微信获得本地专属技术支持。
BIO-I #6B: In this Preliminary Activity, you will use catalase in yeast to catalytically decompose hydrogen peroxide. You will use an O2 Gas Sensor to determine the rate of catalase activity by measuring oxygen gas produced as H2O2 is decomposed. Before data collection begins, there is no product, and the pressure is the same as atmospheric pressure. Shortly after data collection begins, oxygen accumulates at a rather constant rate. The slope of the curve at this initial time is constant and is called the initial rate. In this investigation, we will refer to this as the rate of catalase activity. As the peroxide is decomposed, less of it is available to react and the O2 is produced at lower rates. When no more peroxide is left, O2 is no longer produced. When data collection is complete, you will perform a linear fit on the resultant graph to determine catalase activity. After completing the Preliminary Activity, you will first use reference sources to find out more about catalase, enzymes
1H-1,2,4-Triazole, 1,3,5-triphenyl- | C20H15N3 | CID 563249 - structure, chemical names, physical and chemical properties, classification, patents, literature, biological activities, safety/hazards/toxicity information, supplier lists, and more.
There is a patchy uptake of contrast. The ATZ extends variably above and below the dentate line for about 1в2 centimeters vertically, in fingerlike projections that vary in length both between subjects and within the same individual 3.
16. A compound according to claim 1, which is: 3-(2-chloro-6-fluorobenzylthio)-5-phenylthiazolo[2,3-c][1,2,4]triazole; 3-(benzo[d][1,3]dioxol-5-ylmethylthio)-5-phenylthiazolo[2,3-c][1,2,4]tria- zole; 3-(3,5-dimethoxybenzylthio)-5-phenylthiazolo[2,3-c][1,2,4]triazole; 3-(4-fluorobenzylthio)-5-phenylthiazolo[2,3-c][1,2,4]triazole; 5-phenyl-3-(4-(trifluoromethyl)benzylthio)thiazolo[2,3-c][1,2,4]triazole; 3-(benzo[d][1,3]dioxol-5-ylmethylthio)-5-(4-chlorophenyl)thiazolo[2,3-c][- 1,2,4]triazole; 3-(benzo[d][1,3]dioxol-5-ylmethylthio)-5-(4-fluorophenyl)thiazolo[2,3-c][- 1,2,4]triazole; 3-((5-phenylthiazolo[2,3-c][1,2,4]triazol-3-ylthio)methyl)phenol; 3-(4-chlorobenzylthio)-5-phenylthiazolo[2,3-c][1,2,4]triazole; 3-(3-chloro-4-methoxybenzylthio)-5-phenylthiazolo[2,3-c][1,2,4]triazole; 3-(2,4-difluorobenzylthio)-5-phenylthiazolo[2,3-c][1,2,4]triazole; 5-phenyl-3-(2-(trifluoromethyl)benzylthio)thiazolo[2,3-c][1,2,4]triazole; 3-(phenethylthio)-5-phenylthiazolo[2,3-c][1,2,4]triazole; ...
Tractor CLAAS ARES 697ATZ Second Marca CLAAS Model ARES 697ATZ An 2007 Ore 8522 h SPECIFICATII TEHNICE Tip tractor Tractor pentru ferme
Get this from a library! Contribution à létude de lutilisation des triazoles dans la lutte contre la pourriture noire des racines (Chalara elegans) du tabac.. [Mfwidi-Nitu Pululu; Université de Bordeaux II.]
1,3-Dimethyl-5,1-bi(1,2,4-triazole) | C6H8N6 | CID 596049 - structure, chemical names, physical and chemical properties, classification, patents, literature, biological activities, safety/hazards/toxicity information, supplier lists, and more.
Best Catalase Enzyme from Catalase Enzyme suppliers, quality Catalase Enzyme manufacturer from China alpha-amylaseenzyme of page 2.
Add 1.0 ml of 3% H 2 O 2 directly onto an 18- to 24-hour heavily inoculated pure culture grown on a nutrient agar ... Catalase test as an aid to the identification of ...
Introduction. How Temperature Affects Catalase Activity. Aim: In this experiment I aim to investigate how altering the temperature exposed to the yeast catalase and the hydrogen peroxide, will affect the reaction and the gas product produced. Scientific background knowledge lets us know that there are 6 variables that usually affect the rate of a reaction, and they are as follows: * Concentration of enzymes * Concentration of hydrogen peroxide * Temperature condition of reaction * Pressure condition of reaction * Physical state of solid substrate (e.g. surface area of particles) [Some material reproduced from Biology 1 endorsed by OCR] In order to ensure fairness and accuracy, I will see to it that all the necessary and vital measurements are taken precise to the mark, and Ill aim to maintain all other latent variables constant. Hypothesis: Via my observation, I intend to prove that as the temperature of both the yeast catalase and the hydrogen peroxide id equally increased, the rate of which ...
An electrical device in provided having two electrodes separated from one another, wherein one temperature controlled electronic spin-state transition particle is in direct contact with each of the t
ਦੰਡਾਣੁ ਛੜੀ ਦੇ ਸਰੂਪ ਦਾ ਬੀਟਾ ਹੀਮੋਲਿਟਿਕ ਗਰਾਮ ਪਾਜਿਟਿਵ ਜੀਵਾਣੁ ਜੀਨਸ ਹੈ, ਫਰਮੀਕਿਊਟਸ ਉਪਜਾਤੀ ਦਾ ਨਾਲ ਹੀ ਇੱਕ ਮੈਂਬਰ ਹੈ। ਦੰਡਾਣੁ ਜਾਂ ਤਾਂ ਬਾਧਯ ਪ੍ਰਜਾਤੀ ਦੇ ਹਨ ਜਾਂ ਐੱਛਿਕ aerobe s, ਅਤੇ ਪ੍ਰੀਖਿਆ ਲਈ ਸਕਾਰਾਤਮਕ ਏੰਜਾਇਮ catalase।. ...
In science, it often happens that finding the answer to a particular mystery only leads to further questions. Thats certainly the case with the non-heme/manganese-based catalases in bacteria (which I talked about in a previous post). Regardless of origin, catalases faclitate the breakdown of hydrogen peroxide to water and oxygen. The nearly universal heme-based catalase (found in almost every living thing) comes in large-subunit and small-subunit varieties but is always fairly big (726 amino acids, in E. coli). Manganese catalases, by contrast, are always fairly small: around 276 amino acids. But theres one group of manganese catalases that comes in at 416 to 431 amino acids, more than 50% larger than the "typical" manganese catalase. I wanted to know why. Why are these catalases bigger? ...
5 easy ways to reduce stress We need to remind ourselves that its about sensible principles, not inflexible rules. (Unless you are positive for Gluten sensitivity/Intolerance test…at which point you need to be 100% with a No-Gluten rule). Anyway…Just eat real food (JERF), shop the outside perimeter of the grocery store (no processed foods from…
98532-72-0 - KFXMFRPCEMAZEC-WIYYLYMNSA-N - 1H-1,2,4-Triazole, 1-((2-(2-benzofuranyl)-4-(phenoxymethyl)-1,3-dioxolan-2-yl)methyl)-, cis- - Similar structures search, synonyms, formulas, resource links, and other chemical information.
visit http://www.iizukakei.com for free bogusmail.fake mail and book reviews and more! An Investigation Into The Effect Of Enzyme Concentration On The Rate Of Catalase Activity Equation: 2H2O 2 2H2O + O 2 Catalase is used to catalyse this reaction as h...
Building on previous work (Shi et al., 2013), we have used MicroED to determine the structure of catalase at 3.2 Å resolution from a single crystal.
dhd:Dhaf_1029 K03781 catalase [EC:1.11.1.6] , (GenBank) Catalase (A) MKDNKPNKKREQLEPFIHESEGKKMTSNEGITISDDENTLTAGERGPTLIEDFLSREKLA HFDRERIPERVVHARGYGAHGEFQPYESLADLTMADFLQDPNKKTPLFVRFSQVVGSKGC NETNRDVRGFSIKFYTDEGNFDLIAINMPVFFIQDAIKFPDLIHAVKPEPDNEYPQGQTD HNTFWDFMANNKETAHMSLWIASNRAFPKSFRTMEGFGVHTFRLVNKDGKSHFVKFHIKP LLGVHSLIWDEAQRLGSDADFHRRDLWENIEIGNYPEYEMAIQVIKEEDEFAYDFDLLDP TKLWPEEEIPLRRIGKIILNRNVENAFAETEQSAFHPGNIVRGIDFSNDPLLQGRLFSYT DAQQARLGPNHQQLPINRPVCPFANNQRDGASRLVIDRGKVAYHRNGLANNSPYTVPGTQ GGFVTYPSTVEGHKVRSTAPSFKDHYSQAKMFWNSMSEVEKRQIIGAYCFELGKCGPFVR QEWVDVLAHISTELAKSVSKELGTTVPADVEESPVTKSSPALSLHNTIFVPDTLRVAVFL AQGFDGPGVSKVLETLAEAKLRVVIVHDTLGKVSGTEGVTYEVHDSFLTGSPLVYDGILI VGSGNITPYFTYTAQKFTTDIYNHFKPIGIIQKGDAVLEPLGLLADEGIVTDSGPDFAGR FIKAMAKQRFWNRPSFLYPAMV ...

856. Amitrole (Pesticide residues in food: 1993 evaluations Part II Toxicology)856. Amitrole (Pesticide residues in food: 1993 evaluations Part II Toxicology)

See Also: Toxicological Abbreviations Amitrole (EHC 158, 1994) Amitrole (HSG 85, 1994) Amitrole (ICSC) Amitrole (WHO Pesticide ... Amitrole (IARC Summary & Evaluation, Volume 7, 1974) Amitrole (IARC Summary & Evaluation, Volume 41, 1986) Amitrole (IARC ... Amitrole has a low acute toxicity when tested in several species by various routes of administration. In old studies, amitrole ... The formation of amitrole metabolites as percentage of dose decreased with increasing dose. The rate of elimination of amitrole ...
more infohttp://www.inchem.org/documents/jmpr/jmpmono/v93pr02.htm

Amitrole | OEHHAAmitrole | OEHHA

3-Amino-s-triazole; 3-Amino-1,2,4-triazole; Amerol; Aminotriazole; Amitol; Amitril; Amitrol; Amizol; Azaplant; Azolan; Azole; Cytrol; Cytrole; Diurol; Domatol; Elmasil; Emisol; Herbidal total; Herbizole; Ramizole; Vorox; Weedazin; Weedazol; Weedex granulat; EPA Pesticide Code: 004401. ...
more infohttps://oehha.ca.gov/chemicals/amitrole

280. Amitrole (WHO Pesticide Residues Series 4)280. Amitrole (WHO Pesticide Residues Series 4)

See Also: Toxicological Abbreviations Amitrole (EHC 158, 1994) Amitrole (HSG 85, 1994) Amitrole (ICSC) Amitrole (Pesticide ... Amitrole (IARC Summary & Evaluation, Volume 7, 1974) Amitrole (IARC Summary & Evaluation, Volume 41, 1986) Amitrole (IARC ... Amitrole forms neutral aqueous solutions but acts as a weak base. When exposed to UV light, amitrole breaks down to form CO2, ... When amitrole was applied at 2.5-4.2 times the officially recognized dosage (6 kg/ha), no amitrole was detected in the apples ( ...
more infohttp://inchem.org/documents/jmpr/jmpmono/v074pr03.htm

Buy Online CAS Number 61-82-5 - Dr. Ehrenstorfer - Amitrole | LGC StandardsBuy Online CAS Number 61-82-5 - Dr. Ehrenstorfer - Amitrole | LGC Standards

Purchase online Amitrole DRE-C10240000 - CAS Number 61-82-5. High Quality CRMs, Reference Materials, Proficiency Testing & More ...
more infohttps://www.lgcstandards.com/DE/en/Amitrole/p/DRE-C10240000

Amitrole-13C2,15N2 biochemical product blogAmitrole-13C2,15N2 biochemical product blog

The Amitrole-13C2,15N2 n/a (Catalog #MBS6069674) is a Biochemical and is intended for research purposes o... ... The Amitrole-13C2,15N2 n/a (Catalog #MBS6069674) is a Biochemical and is intended for research purposes only. The product is ... Labeled Amitrole. Herbicide; plant regulator.. CAS Number: 1346603-92-6. Molecular Formula: 13C2H4N215N2. Melting Point: 152- ... Blog on Amitrole-13C2,15N2 biochemical product: ... Tags: Biochemical; Amitrole-13C2,15N2; Amitrole-13C2,15N2 ...
more infohttp://biochem.mybiosource.com/amitrole-13c2-15n2-biochemical_6069674

CDC - Occupational Cancer - Carcinogen List - NIOSH Safety and Health TopicCDC - Occupational Cancer - Carcinogen List - NIOSH Safety and Health Topic

Amitrole. Aniline and homologs. o-Anisidine. Arsenic and inorganic arsenic compounds. Arsine. Asbestos. Asphalt fumes ...
more infohttps://www.cdc.gov/niosh/topics/cancer/npotocca.html

CDC - NIOSH Pocket Guide to Chemical Hazards - Index of CAS NumbersCDC - NIOSH Pocket Guide to Chemical Hazards - Index of CAS Numbers

Amitrole. 624-83-9. Methyl isocyanate. 62-53-3. Aniline (and homologs). ...
more infohttps://www.cdc.gov/niosh/npg/npgdcas.html

Known and Probable Human CarcinogensKnown and Probable Human Carcinogens

Amitrole. *o-Anisidine and its hydrochloride. *Azacitidine (5-Azacytidine, 5-AzaC). *Basic Red 9 Monohydrochloride ...
more infohttp://www.cancer.org/cancer/cancer-causes/general-info/known-and-probable-human-carcinogens.html

EUR-Lex - 32017L0164 - EN - EUR-LexEUR-Lex - 32017L0164 - EN - EUR-Lex

HAS ADOPTED THIS DIRECTIVE:. Article 1. A fourth list of Union indicative occupational exposure limit values is hereby established for the chemical agents listed in the Annex.. Article 2. Member States shall establish national occupational exposure limit values for the chemical agents listed in the Annex, taking into account the Union limit values.. Article 3. In the Annex to Directive 91/322/EEC, the references to acetic acid, calcium dihydroxide, lithium hydride and nitrogen monoxide are deleted with effect from 21 August 2018, subject to Article 6(2)(a).. Article 4. In the Annex to Directive 2000/39/EC, the reference to 1,4-dichlorobenzene is deleted with effect from 21 August 2018.. Article 5. In the Annex to Directive 2009/161/EU, the reference to bisphenol A is deleted with effect from 21 August 2018.. Article 6. 1. In underground mining and tunnelling, Member States may benefit from a transitional period ending at the latest on 21 August 2023, as regards the limit values for nitrogen ...
more infohttps://eur-lex.europa.eu/legal-content/EN/TXT/?qid=1486477134008&uri=CELEX:32017L0164

Herbicides Used to Control Woody Stem PlantsHerbicides Used to Control Woody Stem Plants

Amitrole is a nonselective systemic triazole herbicide and taken in by the target plant as a foliar spray. Not intended for ... Amitrole is classified as a Restricted Use Pesticide and may be purchased and used only by certified applicators. Products ... Because Amitrole has been determined potentially unsafe when applied to edible plants, berries, and fruits, the chemical is ... Commercial names for products containing Amitrole include but are not limited to Amerol, Amino Triazole, Amitrol, Amizine, ...
more infohttps://www.thoughtco.com/herbicides-to-control-woody-stem-plants-1342625

Indian Health Manual (IHM) - HomeIndian Health Manual (IHM) - Home

AMITROLE AMMONIA BORATES, TETRA, SODIUM PENTAHYDRATE. AMMONIUM CHLORIDE FUME BORON OXIDE. AMMONIUM SULFAMATE BORON TRIBROMIDE ...
more infohttps://www.ihs.gov/IHM/index.cfm?module=dsp_ihm_circ_main&circ=ihm_circ_9402_apx_942e

Polygonum aviculare (prostrate knotweed)Polygonum aviculare (prostrate knotweed)

Tolerance to amitrole in weeds in long-term experiments in fruit plantations. VIIIe Colloque International sur la Biologie, ... However, true herbicide resistance has been rarely demonstrated (triazine: van Oorschot and Straathof, 1988; amitrole: Bulcke ... and amitrole (Bulcke et al., 1988). As a rule, it is much more resistant when mature than at the seedling stage.. Pre-emergence ...
more infohttps://www.cabi.org/isc/datasheet/42685

CISDOC databaseCISDOC database

CIS 95-428 Amitrole International chemical safety card. Synonym: aminotriazole. Long-term exposure effects: may affect the ...
more infohttp://www.ilo.org/dyn/cisdoc2/cismain.listDocs?p_lang=en&p_bsubject=1062&p_page=4&p_pagesize=50&p_template=NORMALPAGE

Periodic Table of Elements: Common Compounds of Hydrogen - H (EnvironmentalChemistry.com)Periodic Table of Elements: Common Compounds of Hydrogen - H (EnvironmentalChemistry.com)

Amitrole. Formula: C2H4N4. *Ammonia. Formula: NH3. *Ammonium acetate. Formula: NH4C2H3O2. *Ammonium Bichromate and Dichromate. ...
more infohttps://environmentalchemistry.com/yogi/periodic/Pt-compounds.html

Periodic Table of Elements: Common Compounds of Hydrogen - H (EnvironmentalChemistry.com)Periodic Table of Elements: Common Compounds of Hydrogen - H (EnvironmentalChemistry.com)

Amitrole. Formula: C2H4N4. *Ammonia. Formula: NH3. *Ammonium acetate. Formula: NH4C2H3O2. *Ammonium Bichromate and Dichromate. ...
more infohttps://environmentalchemistry.com/yogi/periodic/Al-compounds.html

Historical pesticide monitoring of Victorian waterways - a jigsaw with many missing pieces  | Friends of the Earth AustraliaHistorical pesticide monitoring of Victorian waterways - a jigsaw with many missing pieces | Friends of the Earth Australia

Amitrole. Pesticide Action Network lists amitrole as a carcinogen and suspected endocrine disruptor. It also affects thyroid ... Amitrole was and is used widely across irrigation areas of Victoria as a control to aquatic weeds such as couch grass in drains ... Amitroles Health Guideline in the 2011 Australian Drinking Water Guidelines (ADWG) is 0.9 parts per billion (ppb). This was ... By 1971 about 2000 pounds of amitrole had been used to control couch grass in drains in Victoria, the same year that the US ...
more infohttps://www.foe.org.au/historical-pesticide-monitoring-victorian-waterways-%E2%80%93-jigsaw-many-missing-pieces

Herbicide Resistant Weeds by Herbicide Site of Action Summary TableHerbicide Resistant Weeds by Herbicide Site of Action Summary Table

... and chlorophyll biosynthetic pathways probably are not the primary sites of amitrole action. Instead, amitrole may have a ... Precursors of carotenoid synthesis, including phytoene, phytofluene, carotenes, and lycopene accumulate in amitrole-treated ... Clomazone does not inhibit geranylgeranyl pyrophosphate biosynthesis (Croteau 1992; Weimer 1992). Amitrole inhibits ...
more infohttp://weedscience.org/summary/soasummary.aspx

Group C1/5 resistant Poa annua from GermanyGroup C1/5 resistant Poa annua from Germany

amitrole 3. Carotenoid biosynthesis (unknown target) (F3/11). 130. Poa annua. Annual Bluegrass. 38. ...
more infohttp://www.weedscience.org/Details/case.aspx?ResistID=449

Multiple resistant Lolium rigidum from Australia, VictoriaMultiple resistant Lolium rigidum from Australia, Victoria

amitrole, and glyphosate 1. Multiple Resistance: 2 Sites of Action Carotenoid biosynthesis (unknown target) (F3/11). EPSP ... amitrole 1. Carotenoid biosynthesis (unknown target) (F3/11). 112. Lolium rigidum. Rigid Ryegrass. 316. ...
more infohttp://weedscience.org/Details/Case.aspx?ResistID=5042

Multiple resistant Lolium rigidum from Australia, South AustraliaMultiple resistant Lolium rigidum from Australia, South Australia

amitrole, and glyphosate 1. Multiple Resistance: 2 Sites of Action Carotenoid biosynthesis (unknown target) (F3/11). EPSP ... amitrole 1. Carotenoid biosynthesis (unknown target) (F3/11). 112. Lolium rigidum. Rigid Ryegrass. 316. ...
more infohttp://www.weedscience.org/Details/Case.aspx?ResistID=389
  • Amitrole is classified as a Restricted Use Pesticide and may be purchased and used only by certified applicators. (thoughtco.com)
  • Pesticide Action Network lists amitrole as a carcinogen and suspected endocrine disruptor. (foe.org.au)
  • Other information on identity and properties Amitrole is a white, crystalline solid with a molecular weight of 84 and a melting point of 150-153 C. It is soluble in water to the extent of 28 g/100 g and in ethanol and methanol to an extent of 26 g/100 g. (inchem.org)
  • Because Amitrole has been determined potentially unsafe when applied to edible plants, berries, and fruits, the chemical is controlled. (thoughtco.com)
  • Excessively high levels of 2,4-D, glyphosate and amitrole were detected in Goulburn-Murray Water drains in 2006. (foe.org.au)
  • It also means that levels of amitrole under 10 ppb, would not have been regarded as "dangerous" as recently as 2011 before the new Guidelines were published. (foe.org.au)
  • In June 1963 the Commission adopted a maximum concentration of amitrole in streams of 2 ppb. (foe.org.au)