Alanine Racemase: A pyridoxal-phosphate protein that reversibly catalyzes the conversion of L-alanine to D-alanine. EC 5.1.1.1.ArchivesBiological Science Disciplines: All of the divisions of the natural sciences dealing with the various aspects of the phenomena of life and vital processes. The concept includes anatomy and physiology, biochemistry and biophysics, and the biology of animals, plants, and microorganisms. It should be differentiated from BIOLOGY, one of its subdivisions, concerned specifically with the origin and life processes of living organisms.Periodicals as Topic: A publication issued at stated, more or less regular, intervals.PubMed: A bibliographic database that includes MEDLINE as its primary subset. It is produced by the National Center for Biotechnology Information (NCBI), part of the NATIONAL LIBRARY OF MEDICINE. PubMed, which is searchable through NLM's Web site, also includes access to additional citations to selected life sciences journals not in MEDLINE, and links to other resources such as the full-text of articles at participating publishers' Web sites, NCBI's molecular biology databases, and PubMed Central.Directories as Topic: Lists of persons or organizations, systematically arranged, usually in alphabetic or classed order, giving address, affiliations, etc., for individuals, and giving address, officers, functions, and similar data for organizations. (ALA Glossary of Library and Information Science, 1983)Publishing: "The business or profession of the commercial production and issuance of literature" (Webster's 3d). It includes the publisher, publication processes, editing and editors. Production may be by conventional printing methods or by electronic publishing.Serial Publications: Publications in any medium issued in successive parts bearing numerical or chronological designations and intended to be continued indefinitely. (ALA Glossary of Library and Information Science, 1983, p203)Publications: Copies of a work or document distributed to the public by sale, rental, lease, or lending. (From ALA Glossary of Library and Information Science, 1983, p181)Racemases and Epimerases: Enzymes that catalyze inversion of the configuration around an asymmetric carbon in a substrate having one (racemase) or more (epimerase) center(s) of asymmetry. (Dorland, 28th ed) EC 5.1.Policy: A course or method of action selected to guide and determine present and future decisions.Program Development: The process of formulating, improving, and expanding educational, managerial, or service-oriented work plans (excluding computer program development).Calcium Oxalate: The calcium salt of oxalic acid, occurring in the urine as crystals and in certain calculi.IndiaQualitative Research: Any type of research that employs nonnumeric information to explore individual or group characteristics, producing findings not arrived at by statistical procedures or other quantitative means. (Qualitative Inquiry: A Dictionary of Terms Thousand Oaks, CA: Sage Publications, 1997)Software: Sequential operating programs and data which instruct the functioning of a digital computer.Interviews as Topic: Conversations with an individual or individuals held in order to obtain information about their background and other personal biographical data, their attitudes and opinions, etc. It includes school admission or job interviews.Gap Junctions: Connections between cells which allow passage of small molecules and electric current. Gap junctions were first described anatomically as regions of close apposition between cells with a narrow (1-2 nm) gap between cell membranes. The variety in the properties of gap junctions is reflected in the number of CONNEXINS, the family of proteins which form the junctions.Internet: A loose confederation of computer communication networks around the world. The networks that make up the Internet are connected through several backbone networks. The Internet grew out of the US Government ARPAnet project and was designed to facilitate information exchange.Algorithms: A procedure consisting of a sequence of algebraic formulas and/or logical steps to calculate or determine a given task.Blood Buffy Coat: The fraction of a blood sample, following CENTRIFUGATION, that is distinguished as a thin light-colored layer between the RED BLOOD CELLS, underneath it, and the PLASMA, above it. It is composed mostly of WHITE BLOOD CELLS and PLATELETS.Enterobacter: Gram-negative gas-producing rods found in feces of humans and other animals, sewage, soil, water, and dairy products.Sequence Analysis, DNA: A multistage process that includes cloning, physical mapping, subcloning, determination of the DNA SEQUENCE, and information analysis.Enterobacter cloacae: A species of gram-negative, facultatively anaerobic, rod-shaped bacteria that occurs in water, sewage, soil, meat, hospital environments, and on the skin and in the intestinal tract of man and animals as a commensal.Chromosomes, Artificial, Bacterial: DNA constructs that are composed of, at least, a REPLICATION ORIGIN, for successful replication, propagation to and maintenance as an extra chromosome in bacteria. In addition, they can carry large amounts (about 200 kilobases) of other sequence for a variety of bioengineering purposes.Genome, Bacterial: The genetic complement of a BACTERIA as represented in its DNA.Gene Library: A large collection of DNA fragments cloned (CLONING, MOLECULAR) from a given organism, tissue, organ, or cell type. It may contain complete genomic sequences (GENOMIC LIBRARY) or complementary DNA sequences, the latter being formed from messenger RNA and lacking intron sequences.Titanium: A dark-gray, metallic element of widespread distribution but occurring in small amounts; atomic number, 22; atomic weight, 47.90; symbol, Ti; specific gravity, 4.5; used for fixation of fractures. (Dorland, 28th ed)Genome: The genetic complement of an organism, including all of its GENES, as represented in its DNA, or in some cases, its RNA.Genome, Viral: The complete genetic complement contained in a DNA or RNA molecule in a virus.Patents as Topic: Exclusive legal rights or privileges applied to inventions, plants, etc.Copper: A heavy metal trace element with the atomic symbol Cu, atomic number 29, and atomic weight 63.55.Superoxide Dismutase: An oxidoreductase that catalyzes the reaction between superoxide anions and hydrogen to yield molecular oxygen and hydrogen peroxide. The enzyme protects the cell against dangerous levels of superoxide. EC 1.15.1.1.Foramen Ovale, Patent: A condition in which the FORAMEN OVALE in the ATRIAL SEPTUM fails to close shortly after birth. This results in abnormal communications between the two upper chambers of the heart. An isolated patent ovale foramen without other structural heart defects is usually of no hemodynamic significance.Reproducibility of Results: The statistical reproducibility of measurements (often in a clinical context), including the testing of instrumentation or techniques to obtain reproducible results. The concept includes reproducibility of physiological measurements, which may be used to develop rules to assess probability or prognosis, or response to a stimulus; reproducibility of occurrence of a condition; and reproducibility of experimental results.Search Engine: Software used to locate data or information stored in machine-readable form locally or at a distance such as an INTERNET site.Silica Gel: A non-crystalline form of silicon oxide that has absorptive properties. It is commonly used as a desiccating agent and as a stationary phase for CHROMATOGRAPHY. The fully hydrated form of silica gel has distinct properties and is referred to as SILICIC ACID.Sensitivity and Specificity: Binary classification measures to assess test results. Sensitivity or recall rate is the proportion of true positives. Specificity is the probability of correctly determining the absence of a condition. (From Last, Dictionary of Epidemiology, 2d ed)Drug Evaluation, Preclinical: Preclinical testing of drugs in experimental animals or in vitro for their biological and toxic effects and potential clinical applications.

A new bile acid conjugate, ciliatocholic acid, from bovine gall bladder bile. (1/26)

This study was carried out to investigate the occurrence of ciliatocholic acid in bovine gall bladder bile. Ciliatocholic acid was synthesized according to the method described by Bergstrom and Norman for the synthesis of taurocholic acid. Elemental analysis, melting point, and the infrared spectrum of this substance were determined. An isolation procedure for ciliatocholic acid was established by stepwise elution with an HCl-ethanol solvent system using a Dowex-1 anion exchange resin column chromatographic technique. Ciliatocholic acid amounting to 158 mug (as ciliatine) per 100 ml of gall bladder bile was found in the fraction eluted with 0.01 N HCl in 50% ethanol. This coumpound was purified by preparative thin-layer chromatography and confirmed to be ciliatocholic acid from the hydrolytic stability, phosphorus determination, and chromatographic behavior. Thus, bovine gall bladder bile contains a small amount of ciliatocholic acid.  (+info)

Aromatic L-amino acid decarboxylase: conformational change in the flexible region around Arg334 is required during the transaldimination process. (2/26)

Aromatic L-amino acid decarboxylase (AADC) catalytic mechanism has been proposed to proceed through two consecutive intermediates (i.e., Michaelis complex and the external aldimine). Limited proteolysis of AADC that preferentially digested at the C-terminal side of Arg334 was slightly retarded in the presence of dihydroxyphenyl acetate that formed a stable Michaelis complex. On the contrary, AADC was scarcely digested in the presence of L-dopa methyl ester that formed a stable external aldimine. Similar protection by the substrate analogs was observed in the chemical modification experiment. From these results, we concluded that the region around Arg334 must be exposed and flexible in the unliganded state, and forming the Michaelis complex generated a subtle conformational change, then underwent marked conformational change during the subsequent transaldimination process prerequisite to forming the external aldimine. For further analyses, we constructed a mutant gene encoding in tandem the two peptides of AADC cleaved at the Asn327-Met328 bond inside the putative flexible region. The gene product, fragmentary AADC, was still active with L-dopa as substrate, but its k(cat) value was decreased 57-fold, and the Km value was increased 9-fold compared with those of the wild-type AADC. The absorption spectra of the fragmentary AADC in the presence of L-dopa methyl ester showed shift in the equilibrium of the transaldimination from the external aldimine to the Michaelis complex. Tryptic digestion of the fragmentary AADC removed seven amino acid residues, Met328-Arg334, and resulted in complete inactivation. Susceptibility of the fragmentary enzyme to trypsin was not changed by L-dopa methyl ester revealing the loss of appropriate conformational change in the flexible region induced by substrate binding. From these results we propose that the conformational change in the flexible region is required during the transaldimination process.  (+info)

Structural determinants for ligand binding and catalysis of triosephosphate isomerase. (3/26)

The crystal structure of leishmania triosephosphate isomerase (TIM) complexed with 2-(N-formyl-N-hydroxy)-aminoethyl phosphonate (IPP) highlights the importance of Asn11 for binding and catalysis. IPP is an analogue of the substrate D-glyceraldehyde-3-phosphate, and it is observed to bind with its aldehyde oxygen in an oxyanion hole formed by ND2 of Asn11 and NE2 of His95. Comparison of the mode of binding of IPP and the transition state analogue phosphoglycolohydroxamate (PGH) suggests that the Glu167 side chain, as well as the triose part of the substrate, adopt different conformations as the catalysed reaction proceeds. Comparison of the TIM-IPP and the TIM-PGH structures with other liganded and unliganded structures also highlights the conformational flexibility of the ligand and the active site, as well as the conserved mode of ligand binding.  (+info)

The 2-aminoethylphosphonate-specific transaminase of the 2-aminoethylphosphonate degradation pathway. (4/26)

The 2-aminoethylphosphonate transaminase (AEPT; the phnW gene product) of the Salmonella enterica serovar Typhimurium 2-aminoethylphosphonate (AEP) degradation pathway catalyzes the reversible reaction of AEP and pyruvate to form phosphonoacetaldehyde (P-Ald) and L-alanine (L-Ala). Here, we describe the purification and characterization of recombinant AEPT. pH rate profiles (log V(m) and log V(m)/K(m) versus pH) revealed a pH optimum of 8.5. At pH 8.5, K(eq) is equal to 0.5 and the k(cat) values of the forward and reverse reactions are 7 and 9 s(-1), respectively. The K(m) for AEP is 1.11 +/- 0.03 mM; for pyruvate it is 0.15 +/- 0.02 mM, for P-Ald it is 0.09 +/- 0.01 mM, and for L-Ala it is 1.4 +/- 0.03 mM. Substrate specificity tests revealed a high degree of discrimination, indicating a singular physiological role for the transaminase in AEP degradation. The 40-kDa subunit of the homodimeric enzyme is homologous to other members of the pyridoxalphosphate-dependent amino acid transaminase superfamily. Catalytic residues conserved within well-characterized members are also conserved within the seven known AEPT sequences. Site-directed mutagenesis demonstrated the importance of three selected residues (Asp168, Lys194, and Arg340) in AEPT catalysis.  (+info)

Properties of phosphoenolpyruvate mutase, the first enzyme in the aminoethylphosphonate biosynthetic pathway in Trypanosoma cruzi. (5/26)

Phosphoenolpyruvate (PEP) mutase catalyzes the conversion of phosphoenolpyruvate to phosphonopyruvate, the initial step in the formation of many naturally occurring phosphonate compounds. The phosphonate compound 2-aminoethylphosphonate is present as a component of complex carbohydrates on the surface membrane of many trypanosomatids including glycosylinositolphospholipids of Trypanosoma cruzi. Using partial sequence information from the T. cruzi genome project we have isolated a full-length gene with significant homology to PEP mutase from the free-living protozoan Tetrahymena pyriformis and the edible mussel Mytilus edulis. Recombinant expression in Escherichia coli confirms that it encodes a functional PEP mutase with a Km apparent of 8 microM for phosphonopyruvate and a kcat of 12 s-1. The native enzyme is a homotetramer with an absolute requirement for divalent metal ions and displays negative cooperativity for Mg2+ (S0.5 0.4 microM; n = 0.46). Immunofluorescence and sub-cellular fractionation indicates that PEP mutase has a dual localization in the cell. Further evidence to support this was obtained by Western analysis of a partial sub-cellular fractionation of T. cruzi cells. Southern and Western analysis suggests that PEP mutase is unique to T. cruzi and is not present in the other medically important parasites, Trypanosoma brucei and Leishmania spp.  (+info)

Phosphorus limitation enhances biofilm formation of the plant pathogen Agrobacterium tumefaciens through the PhoR-PhoB regulatory system. (6/26)

The plant pathogen Agrobacterium tumefaciens forms architecturally complex biofilms on inert surfaces. Adherence of A. tumefaciens C58 was significantly enhanced under phosphate limitation compared to phosphate-replete conditions, despite slower overall growth under low-phosphate conditions. Replacement of Pi with sn-glycerol-3-phosphate and 2-aminoethylphosphonate yielded similar results. The increase in surface interactions under phosphate limitation was observed in both static culture and continuous-culture flow cells. Statistical analysis of confocal micrographs obtained from the flow cell biofilms revealed that phosphate limitation increased both the overall attached biomass and the surface coverage, whereas the maximum thickness of the biofilm was not affected. Functions encoded on the two large plasmids of A. tumefaciens C58, pTiC58 and pAtC58, were not required for the observed phosphate effect. The phosphate concentration at which increased attachment was observed triggered the phosphate limitation response, controlled in many bacteria by the two-component regulatory system PhoR-PhoB. The A. tumefaciens phoB and phoR orthologues could only be disrupted in the presence of plasmid-borne copies of the genes, suggesting that this regulatory system might be essential. Expression of the A. tumefaciens phoB gene from a tightly regulated inducible promoter, however, correlated with the amount of biofilm under both phosphate-limiting and nonlimiting conditions, demonstrating that components of the Pho regulon influence A. tumefaciens surface interactions.  (+info)

Utilization of 2-aminoethylarsonic acid in Pseudomonas aeruginosa. (7/26)

This paper describes the metabolism, transport and growth inhibition effects of 2-aminoethylarsonic acid (AEA) and 3-aminopropylarsonic acid (APrA). The former compound supported growth of Pseudomonas aeruginosa, as sole nitrogen source. The two arsonates inhibited the growth of this bacterium when 2-aminoethylphosphonic acid (AEP) but not alanine or NH4Cl, was supplied as the only other nitrogen source. The analogy between AEA and the natural compound AEP led us to examine the in vitro and in vivo interaction of AEA with the enzymes of AEP metabolism. The uptake system for AEP (Km 6 microM) was found to be competitively inhibited by AEA and APrA (Ki 18 microM for each). AEP-aminotransferase was found to act on AEA with a Km of 4 mM (3.85 mM for AEP). Alanine and 2-arsonoacetaldehyde was generated concomitantly, in a stoichiometric reaction. In vivo, AEA was catabolized by the AEP-aminotransferase since it was able to first induce this enzyme, then to be an efficient substrate. The lower growth observed may have been due to the slowness with which the permease and the aminotransferase were induced, and hence to a poor supply of alanine by transamination.  (+info)

Reversible phase variation in the phnE gene, which is required for phosphonate metabolism in Escherichia coli K-12. (8/26)

It is known that Escherichia coli K-12 is cryptic (Phn-) for utilization of methyl phosphonate (MePn) and that Phn+ variants can be selected for growth on MePn as the sole P source. Variants arise from deletion via a possible slip strand mechanism of one of three direct 8-bp repeat sequences in phnE, which restores function to a component of a putative ABC type transporter. Here we show that Phn+ variants are present at the surprisingly high frequency of >10(-2) in K-12 strains. Amplified-fragment length polymorphism analysis was used to monitor instability in phnE in various strains growing under different conditions. This revealed that, once selection for growth on MePn is removed, Phn+ revertants reappear and accumulate at high levels through reinsertion of the 8-bp repeat element sequence. It appears that, in K-12, phnE contains a high-frequency reversible gene switch, producing phase variation which either allows ("on" form) or blocks ("off" form) MePn utilization. The switch can also block usage of other metabolizable alkyl phosphonates, including the naturally occurring 2-aminoethylphosphonate. All K-12 strains, obtained from collections, appear in the "off" form even when bearing mutations in mutS, mutD, or dnaQ which are known to enhance slip strand events between repetitive sequences. The ability to inactivate the phnE gene appears to be unique to K-12 strains since the B strain is naturally Phn+ and lacks the inactivating 8-bp insertion in phnE, as do important pathogenic strains for which genome sequences are known and also strains isolated recently from environmental sources.  (+info)

*Phosphonate

The naturally occurring phosphonate 2-aminoethylphosphonic acid was first identified in 1959 in plants and many animals, where ... Most processes begin with phosphorous acid (aka phosphonic acid, H3PO3), exploiting its reactive P−H bond. Phosphonic acid can ... 3 H2O Phosphonic acid also can be alkylated with acrylic acid derivatives to afford carboxyl functionalized phosphonic acids. ... 2-carboxyethyl phosphonic acid HPAA: 2-Hydroxyphosphonocarboxylic acid AMP: Aminotris(methylenephosphonic acid) BPMG: N,N-Bis( ...

*Alafosfalin

1-aminoethyl)phosphonic acid and (aminomethyl)phosphonic acid". Journal of Medicinal Chemistry. 29 (1): 29-40. doi:10.1021/ ...

*2-aminoethylphosphonate-pyruvate transaminase

2-aminoethyl)phosphonic acid aminotransferase, 2-aminoethylphosphonate-pyruvate aminotransferase, 2-aminoethylphosphonate ... Lacoste AM, Dumora C, Ali BR, Neuzil E, Dixon HB (1992). "Utilization of 2-aminoethylarsonic acid in Pseudomonas aeruginosa". J ...
The Golm Metabolome Database (GMD) facilitates the search for and dissemination of mass spectra from biologically active metabolites quantified using GC-MS.
Close The Infona portal uses cookies, i.e. strings of text saved by a browser on the users device. The portal can access those files and use them to remember the users data, such as their chosen settings (screen view, interface language, etc.), or their login data. By using the Infona portal the user accepts automatic saving and using this information for portal operation purposes. More information on the subject can be found in the Privacy Policy and Terms of Service. By closing this window the user confirms that they have read the information on cookie usage, and they accept the privacy policy and the way cookies are used by the portal. You can change the cookie settings in your browser. ...
Phosphonic and phosphinic acid are similar to phosphate ester and anhydrides with instead of carbon oxygen bond have the C-P-C bond. They are stable and can stand against harsh chemical treatments. In many cases, phosphorus is a limiting reagent so the discover of about 20-30% of phosphorus in the ocean was an important discovery.. The first naturally produced "phosphonate" compound was 2-aminoethylphosphonate (AEP). AEP was found in phosphonolipids. Phosphonolipids are present in many protozoa, plants, bacteria and even humans. It was found they are formed through ingestion and not made by the body. These phosphonolipids have a fatty acid chain and different phosphonate headgroups. Observation show that phosphonates affect the metabolism. More studies need to be performed on the function of the macromolecules of phosphonate containing molecules because it is still not understood every well. The synthesis of AEP from phosphonoenolpyruvate PEP, is the shortest known pathway to produce natural ...
Natural products containing carbon-phosphorous bonds, so-called C-P compounds, are derivatives of phosphonate and phosphinate with substitution of alkyl group for hydrogen of phosphorus-hydrogen bonds. C-P compounds have been found in many organisms, but only protists and bacteria, mostly Actinobacteria, have biosynthetic capacity. A common reaction in the biosynthetic pathway is C-P bond forming reaction from phosphoenolpyruvate (PEP) to phosphonopyruvate (PnPy) catalyzed by PEP phosphomutase. 2-Aminoethylphosphonate (AEP) is the most abundant C-P compound in the natural world. AEP derivatives include phosphonoprotein, phosphonoglycan, and phosphonolipid. Other known C-P compounds are bioactive substances used in medicine (antibiotics) and agriculture (herbicide) such as fosfomycin, FR-33289, rhizocticin, and bialaphos ...
Natural products containing carbon-phosphorous bonds, so-called C-P compounds, are derivatives of phosphonate and phosphinate with substitution of alkyl group for hydrogen of phosphorus-hydrogen bonds. C-P compounds have been found in many organisms, but only protists and bacteria, mostly Actinobacteria, have biosynthetic capacity. A common reaction in the biosynthetic pathway is C-P bond forming reaction from phosphoenolpyruvate (PEP) to phosphonopyruvate (PnPy) catalyzed by PEP phosphomutase. 2-Aminoethylphosphonate (AEP) is the most abundant C-P compound in the natural world. AEP derivatives include phosphonoprotein, phosphonoglycan, and phosphonolipid. Other known C-P compounds are bioactive substances used in medicine (antibiotics) and agriculture (herbicide) such as fosfomycin, FR-33289, rhizocticin, and bialaphos ...
Natural products containing carbon-phosphorous bonds, so-called C-P compounds, are derivatives of phosphonate and phosphinate with substitution of alkyl group for hydrogen of phosphorus-hydrogen bonds. C-P compounds have been found in many organisms, but only protists and bacteria, mostly Actinobacteria, have biosynthetic capacity. A common reaction in the biosynthetic pathway is C-P bond forming reaction from phosphoenolpyruvate (PEP) to phosphonopyruvate (PnPy) catalyzed by PEP phosphomutase. 2-Aminoethylphosphonate (AEP) is the most abundant C-P compound in the natural world. AEP derivatives include phosphonoprotein, phosphonoglycan, and phosphonolipid. Other known C-P compounds are bioactive substances used in medicine (antibiotics) and agriculture (herbicide) such as fosfomycin, FR-33289, rhizocticin, and bialaphos ...
MetabolismTransport and binding proteinsAmino acids, peptides and aminesputative 2-aminoethylphosphonate ABC transporter, periplasmic 2-aminoethylphosphonate-binding protein (TIGR03261; HMM-score: 23.2) ...
MetabolismTransport and binding proteinsAmino acids, peptides and aminesputative 2-aminoethylphosphonate ABC transporter, periplasmic 2-aminoethylphosphonate-binding protein (TIGR03261; HMM-score: 23) ...
Saturday we canvassed in a neighborhood west of Bethlehem, not far from Lehigh University. Canvassing is basically going door-to-door with clipboards, culling information on who is and who isnt a strong Kerry supporter and likely voter; urging people to go to the polls on Election Day; making sure they know where their polling place is, have a ride if they need one, etc. Although we are briefly trained in the arts of brief "persuasion," you actually meet relatively few undecided voters on the canvassing route, since this phase of the GOTV campaign is aimed at making sure "the base" gets to the polls. The neighborhood was almost entirely Spanish-speaking. This might have been a problem, since neither I nor my canvassing partner spoke Spanish; but aside from a woman in her thirties who mumbled something about "killing babies...and lesbians..." and an elderly woman who told us (through a "translator"--a teenage kid in a do-rag who happened to be around) that she was waiting for her Pentecostal, ...
1. A method is presented for identifying and estimating the aminoethylphosphonate (ciliatine)-containing phospholipids in a complex mixture. 2. Evidence was obtained that the phospholipids of a pure culture of Entodinium caudatum and a mixed rumen protozoa sample contain diglyceride ciliatine, and a plasmalogen ciliatine was detected in the latter. 3. A ninhydrin-positive sphingolipid was isolated from rumen protozoa. Although chromatographically homogeneous on silica gel it contains two components, which were provisionally identified as ceramide ciliatine and ceramide phosphorylethanolamine. 4. A detailed phospholipid analysis of E. caudatum and rumen protozoa is presented. They contain no phosphatidylserine or cardiolipin, but an unidentified phosphoglyceride containing a zwitterionic amino acid is present.. ...
Choose your favorite ciliate protozoan greeting cards from thousands of available designs. All ciliate protozoan greeting cards ship within 48 hours and include a 30-day money-back guarantee.
Spirostomum is a large Ciliate Protozoan, up to 3 mm long and visible even without a microscope. Note that the cilia are arranged in spiral bands, with one thicker band near the center of the protist. SEM X335. - Stock Image C005/7915
View Stock Photo of The Ciliate Protozoan Oxytrichia Reproducing By Fission Sem. Find premium, high-resolution photos at Getty Images.
Dileptus. Light microscope footage of the ciliate protozoan Dileptus sp. hunting for food. Ciliate protozoa are tiny single-celled aquatic organisms which move by the rhythmic beating of many hair-like cilia. Species of the genus Dileptus occur in fresh and salt water, and are aggressive predators of smaller organisms. Filmed with brightfield illumination. - Stock Video Clip K005/6652
A flexible inner member for rotation within an angled outer tubular member of a rotary tissue cutting instrument to cut anatomical tissue includes a flexible region for conforming to the configuration of an angled region of the outer tubular member. The flexible region comprises a cut having convoluted path areas formed through a cylindrical wall of a tubular body of the inner member. The convoluted path areas are rotationally spaced on the tubular body in alternating sequence with connecting path segments of the cut. The cut follows a convoluted path in the convoluted path areas forming the wall of the tubular body into a pair of complementary, mating hook formations of opposed curvature. The connecting path segments extend rotationally along the tubular body between the convoluted path areas.
The ciliate Diploplastron affine is known as a common species of the rumen fauna in cattle and sheep. This protozoon is able to digest cellulose, whereas its amylolytic activity is not well known. The objective of the reported studies was to examine
Plays a role in the regulation of phosphate uptake. In this role, it may bind, possibly as a chaperone, to PhoR, PhoB or a PhoR-PhoB complex to promote dephosphorylation of phospho-PhoB, or inhibit formation of the PhoR-PhoB transitory complex (Probable).
All rumen ciliates whether grown in vivo or in vitro contain bacteria in vesicles in their endoplasm and attached to the outside of the pellicle. However studies in the electron microscope show that...
trichostome: Any ciliate protozoan of the holotrichous order Trichostomatida. Free-living forms are found in freshwater (e.g., Tillina), salt water (e.g., Woodruffia), and decaying vegetation;...
Alfa Aesar™ 3-(2-Aminoethyl)-5-bromoindole, 97% 1g Alfa Aesar™ 3-(2-Aminoethyl)-5-bromoindole, 97% Aminod to Aminoe -Organics
Buy Cytomaxes - a mixture of peptides isolated from cattle. Each cytomax has its own composition and indication for use. Fast worldwide shipping included!
Buy high quality (±)-1-(2-Aminoethyl)-3,4-dihydro-7-methoxy-spiro[cyclopentane-1,2(1H)-naphthalen]-1-ol 51491-10-2 from toronto research chemicals Inc.
As a microbiologist and cell biologist, Dr. Heindls research focuses on the prokaryotic development and bacterial interactions within the environment. He uses the plant pathogen Agrobacterium tumefaciensand related bacteria to understand regulatory principles and molecular mechanisms governing bacterial developmental stages from growth and remodeling, to the morphogenesis, division, and biofilm formation. His work has been published in several renowned scientific journals, such as Journal of Bacteriology, Infection and Immunity, and PLOS ONE-a peer-reviewed open access scientific journal published by the Public Library of Science. In his new role, Dr. Heindls responsibilities include teaching a variety of undergraduate microbiology courses and developing new courses for the program. He is also charged with establishing an active research program with undergraduate and graduate students in the Department of Biological Sciences. Dr. Heindl, a native of Indian Harbour Beach, Florida, received his ...
The anterior aorta of Aplysia is innervated by nerves arising from the abdominal ganglion (Sawada et al., 1981a). The vulvar nerve is one of the nerves innervating the anterior aorta, in which axons of some identifiable motoneurons or modulatory neurons for the anterior aorta are contained (Sawada et al., 1981a, 1984c). The phasic contraction evoked by the vulvar nerve stimulation was inhibited by the enterins. At least, one of the mechanisms for the inhibition seems to be activation of K+ conductance of the muscle membrane. We found that the enterins hyperpolarize the membrane potential of the muscle fibers via the activation of 4-AP-sensitive K+ channels. Sensitivity of the K+ channels to 4-AP is quite high, and EC50 of 4-AP was,10-6 mol l-1. The value is comparable to another highly 4-AP-sensitive K+ channel described in the accessory radula closer muscle of Aplysia (Brezina et al., 1994). The enterin-induced hyperpolarization of the muscle membrane should, in principle, reduce the ...
Find quality suppliers and manufacturers of 13598-36-2(Phosphonic acid) for price inquiry. where to buy 13598-36-2(Phosphonic acid).Also offer free database of 13598-36-2(Phosphonic acid) including MSDS sheet(poisoning, toxicity, hazards and safety),chemical properties,Formula, density and structure, solution etc.
The ciliate protozoa, Stentor and Paramecium, have been reported to escape from the bottom end of narrow capillary tubes into a larger volume of medium with increasing rapidity over the course of trials. This change in behavior has been considered an apparent example of associative learning. This decrease in escape time is not due to a change in the protozoas environment, their swimming speed, frequency of ciliary reversals, or the proportion of time spent forward or backward swimming. Instead, most of the decrease results from a decrease in the proportion of time spent in upward swimming. However, a similar decrease in upward swimming occurs when the task is altered to require escape from the upper end of the capillary tubes. Because the protozoa exhibit the same change in behavior regardless of the reinforcing stimulus, tube-escape learning is not associative learning ...
Looking for SPECTRUM Bromopropyl Phosphonic Acid,1g (26YW33)? Graingers got your back. Price:$349.00. Easy ordering & convenient delivery. Log-in or register for your pricing.
Buy Synthesis And Biological Activities Of Substituted Isoquinolone-1-Phosphonates by Amulrao Uttamrao Borse (Paperback) online at Lulu. Visit the Lulu Marketplace for product details, ratings, and reviews.
Buy ARES L85A2 from RedWolf Airsoft. Browse different Electric Guns(AEG/AEP) by ARES online. Buy ARES L85A2 and other airsoft Electric Guns(AEG/AEP) for cheap prices now. Wholesale is also available at RedWolf Airsoft
Phosphonates and phosphonic acids are organophosphorus compounds containing C−PO(OH)2 or C−PO(OR)2 groups (where R = alkyl, aryl). Phosphonic acids, typically handled as salts, are generally nonvolatile solids that are poorly soluble in organic solvents, but soluble in water and common alcohols. Many commercially important compounds are phosphonates, including glyphosate, the herbicide "Roundup", and ethephon, a widely used plant growth regulator. Bisphosphonates are popular drugs for treatment of osteoporosis. In biology and medicinal chemistry, phosphonate groups are used as stable bioisoteres for phosphate, such as in the antiviral nucleotide analogue, Tenofovir, one of the cornerstones of anti-HIV therapy. Phosphonates feature tetrahedral phosphorus centers. They are structurally closely related to (and often prepared from) phosphorous acid. Phosphonate salts are the result of deprotonation of phosphonic acids, which are diprotic acids: RPO(OH)2 + NaOH → H2O + RPO(OH)(ONa) (monosodium ...
Sigma-Aldrich offers abstracts and full-text articles by [E V Efimtseva, S N Mikhaĭlov, M V Fomicheva, S V Meshkov, M S Rodionov, A R Khomutov, E De Clercq].
Improves the LUNG function by having a regulatory effect on the bronchial mucosa so normalising their metabolism and enhancing their functional performance.
Details AEP.626 Its a harmless memory resident parasitic virus. It hooks INT 21h and writes itself at the beginning of .COM-files that are executed. It contains the internal text string: (C) 1993 American Eagle Publications, Inc., All rights reserved! ...
You are viewing an interactive 3D depiction of the molecule [[[[(2R,3S,4R,5R)-5-(6-amino-2-propylsulfanyl-purine-1,3,7-triium-9-yl)-3,4-dihydroxy-tetrahydrofuran-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]-dichloro-methyl]phosphonic acid (C14H22Cl2N5O12P3S) from the PQR.
Paul has been around a while and from my understanding he has been in contact with one of the few doctors doing real research into BCFS/BFS/PNHE. I dont think he ever said that anxiety never cause and twitch or cramp. It is just that once you go through the level of medical testing BCFS/BFS/PHNE patients do then most of the time it is not stress related since a medication like Klonopin will take all your worries away even if you are under anesthesia. But that is not the case for many here. I am sure there are many here who could attribute their twitching to stress. I also fall into that camp in a small way. But I am not naturally a big reactor to stress. I also want to make sure that I do not come across as dismissing your views by any means since we really dont know what causes this illness. Everything is still a theory. Just look at CFS and how it has evolved from a virus to being triggered by all sorts of things from stress to the flu. Technically anything that is an assult on the body is a ...
Phosphonates represent an important class of organophosphorus compounds. Their use as reagents in organic synthesis is prevalent, and there is a plethora of examples of biologically active compounds possessing the phosphonate moiety. To further our exploration of phosphonates as both reagents and biologically active compounds we have developed a one-flask protocol for the direct synthesis of phosphonates from benzylic and allylic alcohols. This transformation is unprecedented and is applicable to a range of substrates. Both electron rich and electron deficient benzylic alcohols react under the conditions developed. Furthermore, good yields are achieved when converting allylic alcohols to the corresponding allylic phosphonates. In at least one case, the one-flask protocol allows for phosphonate formation that was not achievable under the standard conditions. Bisphosphonates represent a significant subclass of phosphonates. Several nitrogenous bisphosphonates have found use in the clinic as treatments for
Find quality suppliers and manufacturers of 1445-75-6(Phosphonic acid,P-methyl-, bis(1-methylethyl) ester) for price inquiry. where to buy 1445-75-6(Phosphonic acid,P-methyl-, bis(1-methylethyl) ester).Also offer free database of 1445-75-6(Phosphonic acid,P-methyl-, bis(1-methylethyl) ester) including MSDS sheet(poisoning, toxicity, hazards and safety),chemical properties,Formula, density and structure, solution etc.
CHEMVON BIOTECHNOLOGY: We are leading Manufacturer,Supplier & Exporter of [5-(3-fluorophenyl)-pyridin-2-ylMethyl]-phosphonic acid diethyl ester,
Denville, NJ, USA, April 21, 2017 - TRI-K Industries, unveiled new product innovation at in-cosmetics Global in April. Launched at the show, TRI-K introduced NaturePep™ Sacha Inchi, a new botanical based, natural peptide, the next of their NaturePep™ platform, which significantly reduces facial sagginess and restructures skin to create a more sculpted jawline.. TRI-K developed NaturePep™ Sacha Inchi in response to growing consumer demands in the market. This multi-functional anti-aging peptide is clinically proven to decrease facial sagginess for a more contoured jawline, restructure skin by increasing dermis density, smooth skin and reduce wrinkles. In clinical studies, NaturePep™ Sacha Inchi was shown to reduce skin sagging by 45% after only 28 days and decrease skin roughness by more than 20% in three different parameters after 21 days.. Anti-aging is still the leading skin care need, yet consumer focus is less on traditional anti-wrinkle benefits and more on all encompassing beauty ...
68133-57-3 - XANFTJNZNYVTRE-UHFFFAOYSA-N - 1,2-Ethanediamine, N1-(2-aminoethyl)-, 4-methylbenzenesulfonate (1:?) - Similar structures search, synonyms, formulas, resource links, and other chemical information.
Search Indian Amino Trimethylene Phosphonic Acid Manufacturers and Suppliers Details - Contact to Amino Trimethylene Phosphonic Acid Exporters in India, Amino Trimethylene Phosphonic Acid Wholesalers, Amino Trimethylene Phosphonic Acid Distributors and Traders from India.
Crown gall is a widespread disease of cultivated culture all over the world. The bacterial pathogen Agrobacterium tumefacience colonize the xylem vessels of the plants.The tumors form in stems and roots of fruits culture. Large tumoursmay death of new plants in the nursery and in the plantation. Tumouregenesis causing root decay may be factor involved in the complex syndrome. Development of measures to controle crown-gall is carried out in direction for obtaining tumorless plants at the expens of preventive treatment of woundings so as to deteriorate the interaction of pathogen with the cell of host plant. Utilization the strain of soil inhibiting Pseudomonas fluorescens CR- 330 D which synthesize the substances (bacteriocins) with preventing activity to nopaline and octopine strains of pathogenic agrobacteria. Liquid concentrate suspension of this bacteria - biological preparat , Paurin, -were applicated for preplanting treatment of rooted saplings. Using to treat apple MM-106 wilding prior to ...
Shop Alanine racemase ELISA Kit, Recombinant Protein and Alanine racemase Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
Oligonucleotides can be synthesized by condensing a protected nucleoside H‐phosphonate monoester with a second nucleoside in the presence of a coupling agent to produce a dinucleoside H‐phosphonate diester
Compounds and compositions are provided for treatment, prevention, or amelioration of a variety of medical disorders associated with viral infections, cell proliferation and bone metabolism. The compounds provided herein are alkyl esters of phosphonates.
Choi, S.-h.; Mansoorabadi, S. O.; Liu, Y.-n.; Chien, T.-C.; Liu, H.-w. "Analysis of UDP-D-Apiose/UDP-D-Xylose Synthase Catalzyed Conversion of UDP-D-Apiose Phosphonate to UDP-D-Xylose Phosphonate: Implications for a Retroaldol-Aldol Mechanism." J. Am. Chem. Soc. 2012, 134, 13946-13949 ...
Relative changes in the abundance of ruminal Archaea and cellululolytic Bacteria in mono-, di- and tri-faunated sheep in comparison with defaunated ...
prw:PsycPRwf_0782 K01775 alanine racemase [EC:5.1.1.1] , (GenBank) alanine racemase (A) MRSASIILDSKALTHNLNCVIDTVPDTTKVLAMVKADAYGHGIAHCLPALKDADGLGVAC FTEAQHIRELGWDKILVLIEGVFSETEWQQSIEAQCQSIIHHQDQVQWALNHLPPENSPC RTVWLKLNTGMNRLGFESDELGDVAQSLVDAGYELILTSHFANADAPNHPSNAKQIDTFT QALQQLREQVDPSIKASLCNSAGILNFKACHFDWVRPGIMLYGSSPVEGVSAQMLKLKPV MSFKASLMAIHNIAAGTSVGYGSRFVANRPIVKGIVSIGYGDGYPRVVDGSAWVSVQLAG EHSSYKCPVIGRVAMDMIAIDLTDVPNPKVGSQVMLWGDPELGAPSVDEIAESAHTLGYE LLCRVTQRPLREVL ...
Quinton, L., Girard, E., Maiga, A., Rekik, M., Lluel, P., Masuyer, G., Larregola, M., Marquer, C., Ciolek, J., Magnin, T., Wagner, R., Molgo, J., Thai, R., Fruchart-Gaillard, C., Mourier, G., Chamot-Rooke, J., Menez, A., Palea, S., Servent, D. and Gilles, N., 2010. Isolation and pharmacological characterization of AdTx1, a natural peptide displaying specific insurmountable antagonism of the alpha(1A)-adrenoceptor. British Journal of Pharmacology ...
Compare dopa decarboxylase (aromatic L-amino acid decarboxylase) ELISA Kits from leading suppliers on Biocompare. View specifications, prices, citations, reviews, and more.
By indirect immunohistochemistry, the present study examined the distribution of neuronal structures in the cat medulla oblongata, pons, and midbrain, showing immunoreactivity to aromatic L-amino acid decarboxylase (AADC), which catalyzes the convers
Amino Trimethylene Phosphonic Acid ATMP 50% 98% From China, Find details about China Amino Trimethylene Phosphonic Acid, ATMP from Amino Trimethylene Phosphonic Acid ATMP 50% 98% From China - Hefei TNJ Chemical Industry Co., Ltd.
A genus of marine gastropods, including many species of limpets. The shell has the form of a flattened cone. The common European limpet (Patella vulgata) is largely used for food.
The worlds first wiki where authorship really matters. Due credit and reputation for authors. Imagine a global collaborative knowledge base for original thoughts.
Learn more about N-(2-Aminoethyl)-N-(4-methylbenzyl)amine. We enable science by offering product choice, services, process excellence and our people make it happen.
Penang 7 day weather forecast - Met Office mobile weather including weather type, warnings, temperature, feels like temperature, precipitation probability, wind speed, wind direction, wind gust and UV index.
April 2017 - As we mark the 60th anniversary of Daffodil Month, at the Canadian Cancer Society we reflect on the progress weve made to date and acknowledge the need for Canada to innovate to meet this and other health challenges in a resource constrained environment.. ...
OBJECTIVE: To describe the current treatment; clinical, biochemical, and molecular findings; and clinical follow-up of patients with aromatic l-amino acid decarboxylase (AADC) deficiency. METHOD: Clinical and biochemical data of 78 patients with AADC deficiency were tabulated in a database of pediatric neurotransmitter disorders (JAKE). A total of 46 patients have been previously reported; 32 patients are described for the first time. RESULTS: In 96% of AADC-deficient patients, symptoms (hypotonia 95%, oculogyric crises 86%, and developmental retardation 63%) became clinically evident during infancy or childhood. Laboratory diagnosis is based on typical CSF markers (low homovanillic acid, 5-hydroxyindoleacidic acid, and 3-methoxy-4-hydroxyphenolglycole, and elevated 3-O-methyl-l-dopa, l-dopa, and 5-hydroxytryptophan), absent plasma AADC activity, or elevated urinary vanillactic acid. A total of 24 mutations in the DDC gene were detected in 49 patients (8 reported for the first time: p.L38P, ...
Phosphonic acid, (3-hydroxy-1-phenylbutyl)-, diethyl ester | C14H23O4P | CID 71385097 - structure, chemical names, physical and chemical properties, classification, patents, literature, biological activities, safety/hazards/toxicity information, supplier lists, and more.
China ATMP 50%, Chelation, Corrosion Inhibitor, Find details about China ATMP, Amino Trmethylene Phosphonic Acid from ATMP 50%, Chelation, Corrosion Inhibitor - Hebei Jinhong Chemicals Co., Ltd.
View Notes - AEP110_notes_pt1 from A&EP 110 at Cornell. 1 AEP 110 Lecture Notes Alex Gaeta 10/ 18 /0 7 What is a laser? Its an acronym. L ight A mplification by S timulated E mission of R adiation
A photoconductor that includes, for example, a substrate; a first layer like a ground plane layer; an undercoat layer thereover wherein the undercoat layer contains an aminosilane and a phosphonate; a photogenerating layer; and at least one charge transport layer.
Aromatic l-amino acid decarboxylase (AADC) is required for the synthesis of the neurotransmitters dopamine and serotonin. Children with defects in the AADC gene show compromised development, particularly in motor function. Drug therapy has only marginal effects on some of the symptoms and does not change early childhood mortality. Here, we performed adeno-associated viral vector-mediated gene transfer of the human AADC gene bilaterally into the putamen of four patients 4 to 6 years of age. All of the patients showed improvements in motor performance: One patient was able to stand 16 months after gene transfer, and the other three patients achieved supported sitting 6 to 15 months after gene transfer. Choreic dyskinesia was observed in all patients, but this resolved after several months. Positron emission tomography revealed increased uptake by the putamen of 6-[18F]fluorodopa, a tracer for AADC. Cerebrospinal fluid analysis showed increased dopamine and serotonin levels after gene transfer. ...
Rostellariella delicatula , common name the delicate tibia , is a species of sea snail , a marine gastropod mollusk in the family Rostellariidae , the true conchs. Description The size of the shell varies between 45 mm and 110 mm. Distribution This marine species occurs from the Gulf of Aden and East Africa to Sumatra , Indonesia. References Bouchet, P. (2015). Rostellariella delicatula. In: MolluscaBase (2015). Accessed through: World Register of Marine Species at http://www.marinespecies.org/aphia.php?p=taxdetails&id=532191 on 2016-01-30 Liverani V. (2014) The superfamily Stromboidea. Addenda and corrigenda. In: G.T. Poppe, K. Groh & C. Renker (eds), A conchological iconography. pp. 1-54, pls 131-164. Harxheim: Conchbooks. External links Gastropods.com: Rostellariella delicatula Wikimedia Commons has media related to Rostellariella delicatula . Rostellariella delicatula , common name the delicate tibia , is a species of sea snail , a marine gastropod mollusk in the family Rostellariidae , the true
China ATMP 50% Water Treatment Chemical, Find details about China ATMP, Amino Trmethylene Phosphonic Acid from ATMP 50% Water Treatment Chemical - Hebei Jinhong Chemicals Co., Ltd.
Phosphonic acid, (phenylmethyl)-, bis(2-hydroxyethyl) ester | C11H17O5P | CID 71354263 - structure, chemical names, physical and chemical properties, classification, patents, literature, biological activities, safety/hazards/toxicity information, supplier lists, and more.
Abstract: The flotation, adsorption and bonding mechanisms of styrene phosphonic acid (SPA) to cassiterite were studied using microflotation tests, zeta potential measurements, solution chemistry analysis and density functional theory (DFT) calculations in this paper. Flotation results demonstrated SPA was an excellent collector for cassiterite which could recover over 85% cassiterite particles with the pH range 4.3-6.06 and 40 mg/L SPA. Zeta potential measurements and solution chemistry analysis revealed the adsorption of SPA was mainly contributed by the chemisorption of the monoanions on cassiterite surfaces. Frontier molecular orbital theory analysis and adsorption energy calculation results proved the monoanion of SPA was able to replace the OH− on cassiterite surfaces. The adsorption structure optimization results confirmed the binuclear complex was the most favorable adsorption configuration of SPA on cassiterite (110) surface. Mulliken population calculations and density of states analysis
Phosphonic acid derivatives are suitable compounds for controlling the surface properties of materials and nanomaterials. Here, we present for the first time the use of alkyl phosphonic acid ligands to transfer into water zero-valent iron nanoparticles (FeNP) synthesized by an organometallic approach. The tr
Evolution and physiology of functional kleptoplasty in SacoglossaGregor ChristaDepartment of Biology, Centre for Environmental and Marine Studies (CESAM), University of Aveiro, Portugal and Zoological Research Museum Alexander KoenigSome species of the marine gastropod taxa Sacoglossa are able to retain the chloroplasts of their algae food source and keep them functional
American Electric Powers (NYSE: AEP) transmission subsidiary AEP Transmission Holding Co. is partnering with AltaLink LP to participate in the Alberta Electric System Operators (AESO) competitive pr. . .
GT:ID BAD56666.1 GT:GENE bioD GT:PRODUCT putative dethiobiotin synthetase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1987153..1987884 GB:FROM 1987153 GB:TO 1987884 GB:DIRECTION + GB:GENE bioD GB:PRODUCT putative dethiobiotin synthetase GB:PROTEIN_ID BAD56666.1 LENGTH 243 SQ:AASEQ MNTLLVTGTSTDVGKTVVTAALTALARAEALPVAVCKPAQTGVAPGEPGDLAEVRRLAGPVPTLELARYPEPLAPDTAARRCGAPLLTLDETATAVRGLDAELTVVEGAGGLLVRIGEFTLLDLARELDAPVLVVAAAGLGTLNHTELTIRALDAAGVRCAGVVIGAWPAEPDLASVCNREDLPRLTGVPIVGAVPAGVGAWDHDRFTAAVPGWFAPGWSPRLPFNSDSPPSTWGFDTSQSGT GT:EXON 1,1-243:0, SW:ID BIOD_NOCFA SW:DE RecName: Full=Dethiobiotin synthetase; EC=6.3.3.3;AltName: Full=Dethiobiotin synthase;AltName: Full=DTB synthetase; Short=DTBS; SW:GN Name=bioD; OrderedLocusNames=NFA_18200; SW:KW ATP-binding; Biotin biosynthesis; Complete proteome; Ligase;Magnesium; Nucleotide-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1-,243,BIOD_NOCFA,e-114,100.0,243/243, GO:SWS:NREP 4 GO:SWS GO:0005524,GO:ATP ...
The present invention provides for pyridoxine phosphonate analogues, pharmaceutical compositions, and methods for treatment of cardiovascular and related diseases.
A pyridoxal-phosphate protein. The enzyme also acts on some other aromatic L-amino acids, including L-tryptophan, L-tyrosine and L-phenylalanine.
Tytuł projektu: Rozbudowa i przekształcenie bibliograficznej bazy danych AGRO w bazę bibliograficzno-abstraktową z wykorzystaniem oprogramowania YADDA. Nr umowy: POIG 02.03.02-00-031/09 (okres realizacji 2009-2013 ...
Stearic acid 2-((2-aminoethyl)amino)ethanol urea complex/ACM68412146 can be provided in Alfa Chemistry. We are dedicated to provide our customers the best products and services.
Botulinum toxin type A (BTA) is being increasingly used for a range of therapeutic purposes and also for cosmetic reasons. For many years, the potency of BTA has been measured by using an LD50 assay in mice. This assay is a cause for concern due to its unpleasant nature and extreme severity, and the requirement for high numbers of mice to be used. Alternatives to this potency assay are presently reviewed with particular reference to the work at the National Institute for Biological Standards and Control (NIBSC), and to recent work by the UK manufacturer of the substance. An in vivo local paralysis assay with considerably less severity has been developed and is in use at the NIBSC. Alternative, ex vivo functional assays in use include the measurement of BTA-induced paralysis of neurally-stimulated rodent diaphragm or rat intercostal muscle. The latter method has the advantage of allowing more preparations to be derived from one animal. However, these ex vivo methods have not yet been fully ...

T 01 at Thomas ScientificT 01 at Thomas Scientific

L-Alanyl-L-1-aminoethylphosphonic acid, >=98.0% (T) MilliporeSigma. … ( S )-Alanyl-( R )-1-aminoethylphosphonic acid; ... ALDRICH trans-Cyclobutane-1,2-dicarboxylic acid, >=97.0% (T) MilliporeSigma. Empirical Formula: C6H8O4 Linear Formula: C6H8O4 ... ALDRICH trans-Cyclobutane-1,2-dicarboxylic acid, >=97.0% (T) MilliporeSigma. Empirical Formula: C6H8O4 Linear Formula: C6H8O4 ... ALDRICH cis-Cyclobutane-1,2-dicarboxylic acid, >=97.0% (T) MilliporeSigma. Empirical Formula: C6H8O4 Linear Formula: C6H8O4 ...
more infohttps://www.thomassci.com/scientific-supplies/T-01

Frontiers | The genes and enzymes of phosphonate metabolism by bacteria, and their distribution in the marine environment |...Frontiers | The genes and enzymes of phosphonate metabolism by bacteria, and their distribution in the marine environment |...

Natural-product phosphonates such as 2-aminoethylphosphonic acid (2-AEP; ciliatine) or 2-amino-3-phosphonopropionic acid ( ... Ternan, N. G., and Quinn, J. P. (1998a). Phosphate starvation-independent 2-aminoethylphosphonic acid biodegradation in a newly ... it is encoded within a degradative operon for the mineralization of 2-aminoethylphosphonic acid (2-AEP, ciliatine). 2-AEP ... 2-amino-3-phosphonopropionic acid) as sole C, N, and P source. Phosphonoalanine, the phosphonate analog of aspartic acid, is ...
more infohttps://www.frontiersin.org/articles/10.3389/fmicb.2012.00019/full

Volume 36, Issue 2 | The American Journal of Tropical Medicine and HygieneVolume 36, Issue 2 | The American Journal of Tropical Medicine and Hygiene

At least 87% of the total phosphorus originally present was comprised of 2-aminoethylphosphonic acid. During 11 days of ... in the accumulation and metabolic fate of the released amino acids, or in the toxicity of the amino acid or alcohol released ... The Basis of Antimalarial Action: Non-Weak Base Effects of Chloroquine on Acid Vesicle pH Donald J. Krogstad and Paul H. ... Leishmania mexicana: Destruction of Isolated Amastigotes by Amino Acid Esters Michel Rabinovitch, Vladimir Zilberfarb and ...
more infohttp://www.ajtmh.org/content/journals/14761645/36/2

phosphonic acid|J&K Scientificphosphonic acid|J&K Scientific

J&K Chemicals Ltd. providesphosphonic acidregents.To searchphosphonic acidPrice Info,Beijing, Shanghai and other major cities offer prompt goods, online order, bulk package.custom synthesis service and MSDS/COA/SPEC information.phosphonic acidJ&K is professional manufacturer of high-end reagents.
more infohttp://jkchemical.com/EN/products/index/functional_group/phosphonic%20acid.html

Phosphoethanolamine | definition of phosphoethanolamine by Medical dictionaryPhosphoethanolamine | definition of phosphoethanolamine by Medical dictionary

C] Glycosphingolipids contain phosphorus and amine as 2-aminoethylphosphonic acid or phosphoethanolamine and are zwitterionic. ... except for the following amino acids: phosphoethanolamine (PTEN), aspartic acid (Asp), hydroxyproline (Hyp), citrulline (Cit ... All amino acids detected in the urine control were also quantified in urine samples from patients to establish adequate ... Effects of anticoagulants in amino acid analysis: comparisons of heparin, EDTA, and sodium citrate in vacutainer tubes for ...
more infohttps://medical-dictionary.thefreedictionary.com/phosphoethanolamine

Schwerpunkt 4: Publikationen - IOWSchwerpunkt 4: Publikationen - IOW

... aminomethylphosphonic acid, and 2-aminoethylphosphonic acid on three typical Baltic Sea sediments. Mar. Chem. 198: 1-9, doi: ... aminomethylphosphonic acid and 2-aminoethylphosphonic acid in water. J . Chromatogr. 1475: 64-73, doi: 10.1016/j.chroma.2016.11 ... Bacteriogenically induced sulfuric acid attack on concrete in a sewer system. In: Proceedings : XIII International Conference ... Concrete deterioration by bacteriogenically induced sulfuric acid attack. keine Angaben ...
more infohttps://www.io-warnemuende.de/forschungsschwerpunkt-4-publikationen.html

Industrial organophosphorus compound | Article about industrial organophosphorus compound by The Free DictionaryIndustrial organophosphorus compound | Article about industrial organophosphorus compound by The Free Dictionary

Organophosphorus compounds containing a phosphorus-carbon bond, for example, β-aminoethylphosphonic acid (ciliatin), were ... such as phosphonous acid (RPO2H2), phosphinous acid (R2POH), phosphonic acid (RPO3H2), and phosphinic acid (R2PO2H) and their ... of hypophosphorous acid (H3PO2), phosphorous acid (H3PO3), phosphoric acid (H3PO4) and other acids. In addition, there are ... Esters and other acid derivatives of phosphorus are usually obtained by the action of chloranhydrides of these acids on ...
more infohttp://encyclopedia2.thefreedictionary.com/industrial+organophosphorus+compound

New Classes of Alanine Racemase Inhibitors Identified by High-Throughput Screening Show Antimicrobial Activity against...New Classes of Alanine Racemase Inhibitors Identified by High-Throughput Screening Show Antimicrobial Activity against...

Stamper GF, Morollo AA, Ringe D. Reaction of alanine racemase with 1-aminoethylphosphonic acid forms a stable external aldimine ... formic acid. Samples were then de-salted using C4 ZipTip, eluted into 15 µl 60% acetonitrile/0.1% formic acid, and directly ... These belong to different chemical classes, including hydrazide, hydroxamic acid, thiopyridine, pyrimidine carboxamide, ... one each of hydroxamic acid (L2-3), thiopyridine (L2-4), pyridine ester (L2-10), oxadiazole N-oxide (L2-18), carbamodithioate ( ...
more infohttp://pubmedcentralcanada.ca/pmcc/articles/PMC3102704/?lang=en-ca

Xiaolin Li - PubMed - NCBIXiaolin Li - PubMed - NCBI

High-performance liquid chromatographic determination of 2-aminoethylphosphonic acid and 2-amino-3-phosphonopropionic acid in ...
more infohttps://www.ncbi.nlm.nih.gov/pubmed/?cmd=Search&term=Xiaolin%20Li

Phosphonoacetate biosynthesis: in vitro detection of a novel NADP(+)-dependent phosphonoacetaldehyde-oxidizing activity in cell...Phosphonoacetate biosynthesis: in vitro detection of a novel NADP(+)-dependent phosphonoacetaldehyde-oxidizing activity in cell...

... activity was detected in cell-extracts of the marine bacterium Roseovarius nubinhibens ISM grown on 2-aminoethylphosphonic acid ...
more infohttps://www.sigmaaldrich.com/catalog/papers/21861368

Recent questions in Organophosphonates - lookformedical.comRecent questions in Organophosphonates - lookformedical.com

Carbon-containing phosphonic acid compounds. Included under this heading are compounds that have carbon bound to either OXYGEN ... Aminoethylphosphonic Acid (0) * Armin (0) * Diphosphonates (2) * Fosfomycin (0) * Organofluorophosphonates (0) * ...
more infohttps://lookformedical.com/answers/en/questions/chemicals-and-drugs/organic-chemicals/organophosphorus-compounds/organophosphonates

Recent questions in Diphosphonates - lookformedical.comRecent questions in Diphosphonates - lookformedical.com

... where P stands for phosphonates or phosphonic acids. These compounds affect calcium metabolism. They inhibit ectopic ... Aminoethylphosphonic Acid (0) * Armin (0) * Diphosphonates (2) * Alendronate (0) * Clodronic Acid (0) ...
more infohttps://lookformedical.com/answers/en/questions/chemicals-and-drugs/organic-chemicals/organophosphorus-compounds/organophosphonates/diphosphonates

BT-AEP-PEG-COOH nanoparticlesBT-AEP-PEG-COOH nanoparticles

2-aminoethyl phosphonic acid 2-aminoethylphosphonic acid See all names (2) Type Single Compound ...
more infohttps://nano.nature.com/nano/GR-M763924?error=cookies_not_supported&code=75c5855e-e7b9-4a86-8f50-29df20806503

Publication List for  for Peter KonradssonPublication List for for Peter Konradsson

2-aminoethylphosphonic acid)-GlcNp(α1→6)-myo-Ins-1-PO4. Journal of Organic Chemistry, 2005, 70(18), 7196-7207. Web of Science® ... Resin-acid derivatives as potent electrostatic openers of voltage-gated K channels and suppressors of neuronal excitability. ... Synthesis and Monolayer Characterization of Phosphorylated Amino Acid Analogs. Journal of Colloid and Interface Science, 2002, ... Electrochemical Evaluation of the Interfacial Capacitance upon Phosphorylation of Amino Acid Analogue Molecular Films. ...
more infohttp://www.ep.liu.se/PubList/Default.aspx?userid=petko14

Forex t comForex t com

2-Aminoethylphosphonic acid is the main phosphorus compound in locust hemolymph. Springer-Verlag, Santa Barbara, CA, 208221. ...
more infohttp://retzepti.ru/forex-t-com.html

Photographic elements containing vesicles of rhodopsin and lipids - Patent # 4084967 - PatentGeniusPhotographic elements containing vesicles of rhodopsin and lipids - Patent # 4084967 - PatentGenius

... phosphonolipids such as ceramide-2-aminoethylphosphonic acid, phosphonoglycerides and the like and sterols such as cholesterol ... Examples of such materials are chloranilic acid, 2-methyl-8-quinolinol and oxalic acid for calcium; 5-amino-1,3,4-thiadiazole-2 ... 1 mM ethylenediaminetetraacetic acid, and 10 mM N-2-hydroxyethylpiperazine-N-2-ethanesulfonic acid (HEPES) pH 6.8, which had ... nitrilotriacetic acid (NTA), 1,2-diaminocyclohexanetetraacetic acid (CyDTA) and ethylene glycol bis(2-aminoethyl) ...
more infohttp://www.patentgenius.com/patent/4084967.html

Dr Robert M Esnouf - Nuffield Department of MedicineDr Robert M Esnouf - Nuffield Department of Medicine

1-aminoethylphosphonic acid (L-Ala-P). Acta Crystallogr Sect F Struct Biol Cryst Commun, 64 (Pt 5), pp. 327-333. , Show ... Therefore, amino acid position 229 may be regarded as an excellent amino acid target within the NNRTI pocket for rational drug ... The structure of the hexitol nucleic acid (HNA) h(GCGCTTTTGCGC) was determined by NMR spectroscopy. This unnatural nucleic acid ... 1-aminoethylphosphonic acid (L-Ala-P) have determined by X-ray crystallography to resolutions of 2.1 and 1.47 A, respectively. ...
more infohttps://www.ndm.ox.ac.uk/principal-investigators/researcher/robert-esnouf

SWISS-MODEL Template Library | 5knvSWISS-MODEL Template Library | 5knv

2-[2-(6-oxidanylidene-1~{H}-purin-9-yl)ethyl-(4-phosphonobutyl)amino]ethylphosphonic acid; MAGNESIUM ION. Polypeptides. ... 2-[2-(6-oxidanylidene-1~{H}-purin-9-yl)ethyl-(4-phosphonobutyl)amino]ethylphosphonic acid; MAGNESIUM ION. Polypeptides. ...
more infohttps://swissmodel.expasy.org/templates/5knv

phosphonopeptide - oiphosphonopeptide - oi

... aminoethylphosphonic acid (a phosphorus‐containing analogue of l‐alanine). ...
more infohttp://oxfordindex.oup.com/view/10.1093/oi/authority.20110803100324176

Complete genome sequence of Enterobacter lignolyticus SCF1Complete genome sequence of "Enterobacter lignolyticus" SCF1

Nucleic Acids Res. 2010; 38:D396-D400 View ArticlePubMed. * Ciccarelli FD, Doerks T, von Mering C, Creevey CJ, Snel B and Bork ... Nucleic Acids Res. 2007; 35:3100-3108 View ArticlePubMed. * Gardner PP, Daub J, Tate J, Moore BL, Osuch IH, Griffiths-Jones S, ... Nucleic Acids Res. 2009; 37:D233-D238 View ArticlePubMed. * Levasseur A, Plumi F, Coutinho PM, Rancurel C, Asther M, Delattre M ... Nucleic Acids Res. 1997; 25:955-964 View ArticlePubMed. * Lagesen K, Hallin P, Rodland EA, Staerfeldt HH, Rognes T and Ussery ...
more infohttp://standardsingenomics.org/content/5/1/69/

Publikationen - Wissenschaftscampus Phosphorforschung RostockPublikationen - Wissenschaftscampus Phosphorforschung Rostock

... aminomethylphosphonic acid and 2-aminoethylphosphonic acid in water. Journal of Chromatography A, DOI: 10.1016/j.chroma.2016.11 ... aminomethylphosphonic acid, and 2-aminoethylphosphonic acid on three typical Baltic Sea sediments. Marine Chemistry 198: 1-9, ... Hinz, A.; Labbow, R.; Rennick, C.; Schulz, A.; Goicoechea, J.M. (2017): HPCO-A Phosphorus-Containing Analogue of Isocyanic Acid ... Wacker, A., Piepho, M., Spijkermana, E. (2015): Photosynthetic and fatty acid acclimation of four phytoplankton species in ...
more infohttps://sciencecampus-rostock.de/Publikationen.html

Patent US6569636 - Assay for modulators of metallo-enzyme activity - Google PatentsPatent US6569636 - Assay for modulators of metallo-enzyme activity - Google Patents

... followed by a residue which is 1-amino-ethylphosphonic acid (the phosphonic acid analog of alanine) followed by an additional ... Lactam-containing hydroxamic acids. US5677282. Jun 7, 1995. Oct 14, 1997. Proscript, Inc.. Amino acid amides of 1,3,4- ... In the compounds of the library, X and Z represent any of 16 different amino acids and Y represents any of five α-hydroxy acids ... followed by an amino acid residue (X) which can represent any of 16 different amino acids, ...
more infohttp://www.google.com/patents/US6569636?dq=7,003,515

Subject: algae / Journal: Harmful algae - PubAg Search ResultsSubject: 'algae' / Journal: Harmful algae - PubAg Search Results

cultured in media containing β-glycerol phosphate (β-gly, containing COP bonds), 2-aminoethylphosphonic acid (2-amin, ... The Gulf of the Farallones is one of several "hotspots" for the neurotoxin domoic acid, .... DOI:. 10.1016/j.hal.2019.05.010. ... Production of domoic acid from large-scale cultures of Pseudo-nitzschia multiseries: A feasibility study ... 9. Growth dynamics and domoic acid production of Pseudo-nitzschia sp. in response to oil and dispersant exposure ...
more infohttps://pubag.nal.usda.gov/?f%5Bjournal_name%5D%5B%5D=Harmful+algae&per_page=50&q=%22algae%22&search_field=subject
  • Most processes begin with phosphorous acid (aka phosphonic acid, H3PO3), exploiting its reactive P−H bond. (wikipedia.org)
  • Phosphonic acid can be alkylated under Mannich conditions to give aminomethylated phosphonates, which are useful as complexants. (wikipedia.org)
  • One example is the industrial preparation of nitrilotris(methylenephosphonic acid): NH3 + 3 H3PO3 + 3 CH2O → N(CH2PO3H2)3 + 3 H2O Phosphonic acid also can be alkylated with acrylic acid derivatives to afford carboxyl functionalized phosphonic acids. (wikipedia.org)
  • This led to the discovery of the first compound in animals of a substance with a C-P bond (aminoethyl phosphonic acid), and the phosphodiester of L-serine and ethanolamine, both substances being found sub-sequentially in primordial living creature as well as a number of the interesting substances of interest. (legacy.com)
  • All amino acids detected in the urine control were also quantified in urine samples from patients to establish adequate reference intervals, regardless of the fact that some of them either were not useful for diagnosis or required special sampling for clinical management (1methylhistidine, carnosine, tryptophan, phosphoethanolamine , ethanolamine). (thefreedictionary.com)
  • High-performance liquid chromatographic determination of 2-aminoethylphosphonic acid and 2-amino-3-phosphonopropionic acid in seawater matrix using precolumn fluorescence derivatization with o-phthalaldehyde-ethanethiol. (nih.gov)
  • Particularly, unique epigenetic and genetic roles of amino acid, glutamine, are receiving much attention. (legacy.com)
  • With the exception of aminoethanoic acid (glycine), the industrially produced amino acids are chiral and the two isomers (D and L) have different properties in biologically induced reactions. (hyeyunpark.com)
  • However, biotechnological routes have the great advantage of producing pure optically active amino acids. (hyeyunpark.com)
  • They are structurally closely related to (and often prepared from) phosphorous acid. (wikipedia.org)
  • An example of such a bisphosphonate is HEDP (etidronic acid or Didronel), that is 1-hydroxyethane-1,1-diphosphonic acid, which is prepared from phosphorous acid and acetic anhydride: 2 H3PO3 + (CH3CO)2O → CH3C(OH)(PO3H2)2 + CH3CO2H Phosphonates are one of the three sources of phosphate intake in biological cells. (wikipedia.org)
  • Any of a series of oligopeptide derivatives, designed as inhibitors of bacterial cell‐wall biosynthesis, that have a C‐terminal residue of l‐1‐aminoethylphosphonic acid (a phosphorus‐containing analogue of l‐alanine). (oup.com)
  • Lactic acid (2-hydroxypropanoic acid) is produced by fermentation of sugars from maize (corn syrup) and cane sugar (molasses) using a lactobacillus bacterium. (hyeyunpark.com)
  • 4. The method of claim 3 wherein said visible dye is gallocyanine, ethyl red, or carminic acid. (google.com)
  • Flavouring agentEthyl lactate, also known as lactic acid ethyl ester, is a monobasic ester formed from lactic acid and ethanol, commonly used as a solvent. (hyeyunpark.com)
  • Lactic acid can be esterified with ethanol to form ethyl 2-hydroxypropanoate (ethyl lactate) which is a non-toxic and biodegradable solvent. (hyeyunpark.com)
  • In chloroquine-susceptible parasites, but not resistant parasites or mammalian cells, chloroquine increases the pH of acid vesicles 700- to 800-fold more than can be accounted for by its properties as a weak base. (ajtmh.org)
  • The increase in acid vesicle pH caused by these non-weak base effects of nanomolar chloroquine in susceptible parasites suggests that chloroquine acts by interfering with acid vesicle functions in the parasite such as the endocytosis and proteolysis of hemoglobin, and the intracellular targeting of lysosomal enzymes. (ajtmh.org)