Bibliometrics: The use of statistical methods in the analysis of a body of literature to reveal the historical development of subject fields and patterns of authorship, publication, and use. Formerly called statistical bibliography. (from The ALA Glossary of Library and Information Science, 1983)Publications: Copies of a work or document distributed to the public by sale, rental, lease, or lending. (From ALA Glossary of Library and Information Science, 1983, p181)Periodicals as Topic: A publication issued at stated, more or less regular, intervals.Publishing: "The business or profession of the commercial production and issuance of literature" (Webster's 3d). It includes the publisher, publication processes, editing and editors. Production may be by conventional printing methods or by electronic publishing.Research: Critical and exhaustive investigation or experimentation, having for its aim the discovery of new facts and their correct interpretation, the revision of accepted conclusions, theories, or laws in the light of newly discovered facts, or the practical application of such new or revised conclusions, theories, or laws. (Webster, 3d ed)Biomedical Research: Research that involves the application of the natural sciences, especially biology and physiology, to medicine.PubMed: A bibliographic database that includes MEDLINE as its primary subset. It is produced by the National Center for Biotechnology Information (NCBI), part of the NATIONAL LIBRARY OF MEDICINE. PubMed, which is searchable through NLM's Web site, also includes access to additional citations to selected life sciences journals not in MEDLINE, and links to other resources such as the full-text of articles at participating publishers' Web sites, NCBI's molecular biology databases, and PubMed Central.Journal ArticleBiology: One of the BIOLOGICAL SCIENCE DISCIPLINES concerned with the origin, structure, development, growth, function, genetics, and reproduction of animals, plants, and microorganisms.Databases, Bibliographic: Extensive collections, reputedly complete, of references and citations to books, articles, publications, etc., generally on a single subject or specialized subject area. Databases can operate through automated files, libraries, or computer disks. The concept should be differentiated from DATABASES, FACTUAL which is used for collections of data and facts apart from bibliographic references to them.National Academy of Sciences (U.S.): A United States organization of distinguished scientists and engineers established for the purpose of investigating and reporting upon any subject of art or science as requested by any department of government. The National Research Council organized by NAS serves as the principal operating agency to stimulate and support research.OregonChin: The anatomical frontal portion of the mandible, also known as the mentum, that contains the line of fusion of the two separate halves of the mandible (symphysis menti). This line of fusion divides inferiorly to enclose a triangular area called the mental protuberance. On each side, inferior to the second premolar tooth, is the mental foramen for the passage of blood vessels and a nerve.Nobel PrizeInstitute of Medicine (U.S.): Identifies, for study and analysis, important issues and problems that relate to health and medicine. The Institute initiates and conducts studies of national policy and planning for health care and health-related education and research; it also responds to requests from the federal government and other agencies for studies and advice.Academies and Institutes: Organizations representing specialized fields which are accepted as authoritative; may be non-governmental, university or an independent research organization, e.g., National Academy of Sciences, Brookings Institution, etc.Fat Body: A nutritional reservoir of fatty tissue found mainly in insects and amphibians.State Health Plans: State plans prepared by the State Health Planning and Development Agencies which are made up from plans submitted by the Health Systems Agencies and subject to review and revision by the Statewide Health Coordinating Council.Gonadotropin-Releasing Hormone: A decapeptide that stimulates the synthesis and secretion of both pituitary gonadotropins, LUTEINIZING HORMONE and FOLLICLE STIMULATING HORMONE. GnRH is produced by neurons in the septum PREOPTIC AREA of the HYPOTHALAMUS and released into the pituitary portal blood, leading to stimulation of GONADOTROPHS in the ANTERIOR PITUITARY GLAND.Aminobutyrates: Derivatives of BUTYRIC ACID that contain one or more amino groups attached to the aliphatic structure. Included under this heading are a broad variety of acid forms, salts, esters, and amides that include the aminobutryrate structure.Succinate-Semialdehyde Dehydrogenase (NADP+)4-Aminobutyrate Transaminase: An enzyme that converts brain gamma-aminobutyric acid (GAMMA-AMINOBUTYRIC ACID) into succinate semialdehyde, which can be converted to succinic acid and enter the citric acid cycle. It also acts on beta-alanine. EC 2.6.1.19.gamma-Aminobutyric Acid: The most common inhibitory neurotransmitter in the central nervous system.Neurons: The basic cellular units of nervous tissue. Each neuron consists of a body, an axon, and dendrites. Their purpose is to receive, conduct, and transmit impulses in the NERVOUS SYSTEM.Kisspeptins: Intercellular signaling peptides that were originally characterized by their ability to suppress NEOPLASM METASTASIS. Kisspeptins have since been found to play an important role in the neuroendocrine regulation of REPRODUCTION.Receptors, GABA-A: Cell surface proteins which bind GAMMA-AMINOBUTYRIC ACID and contain an integral membrane chloride channel. Each receptor is assembled as a pentamer from a pool of at least 19 different possible subunits. The receptors belong to a superfamily that share a common CYSTEINE loop.Receptors, LHRH: Receptors with a 6-kDa protein on the surfaces of cells that secrete LUTEINIZING HORMONE or FOLLICLE STIMULATING HORMONE, usually in the adenohypophysis. LUTEINIZING HORMONE-RELEASING HORMONE binds to these receptors, is endocytosed with the receptor and, in the cell, triggers the release of LUTEINIZING HORMONE or FOLLICLE STIMULATING HORMONE by the cell. These receptors are also found in rat gonads. INHIBINS prevent the binding of GnRH to its receptors.Preoptic Area: Region of hypothalamus between the ANTERIOR COMMISSURE and OPTIC CHIASM.

A correlation between changes in gamma-aminobutyric acid metabolism and seizures induced by antivitamin B6. (1/617)

The effects of DL-penicillamine (DL-PeA), hydrazine and toxopyrimidine (TXP, 2-methyl-6-amino-5-hydroxymethylpyrimidine) on gamma-aminobutyric acid (GABA) metabolism in mouse brain were studied. All these compounds inhibited the activity of glutamate decarboxylase [EC 4.1.1.15] (GAD) and slightly inhibited that of 4-aminobutyrate: 2-oxoglutarate aminotransferase [EC 2.6.1.19] (GABA-T). In contrast, very different effects were observed on GABA levels; hydrazine caused a marked increase, DL-PeA had no effect, and TXP caused a slight decrease in the content of the amino acid. These results could be described by an equation which related the excitable state to changes in the flux of the GABA bypass. Since the values obtained from the equation clearly reflect the seizure activity, it is suggested that the decreased GABA flux might be a cause of convulsions induced by these drugs.  (+info)

Mechanisms involved in the metabotropic glutamate receptor-enhancement of NMDA-mediated motoneurone responses in frog spinal cord. (2/617)

1. The metabotropic glutamate receptor (mGluR) agonist trans-(+/-)-1-amino-1,3-cyclopentanedicarboxylic acid (trans-ACPD) (10-100 microM) depolarized isolated frog spinal cord motoneurones, a process sensitive to kynurenate (1.0 mM) and tetrodotoxin (TTX) (0.783 microM). 2. In the presence of NMDA open channel blockers [Mg2+; (+)-5-methyl-10,11-dihydro-5H-dibenzo[a,d]cyclohepten-5,10-imine hydrogen maleate (MK801); 3,5-dimethyl-1-adamantanamine hydrochloride (memantine)] and TTX, trans-ACPD significantly potentiated NMDA-induced motoneurone depolarizations, but not alpha-amino-3-hydroxy-5-methylisoxazole-4-proprionate (AMPA)- or kainate-induced depolarizations. 3. NMDA potentiation was blocked by (RS)-alpha-methyl-4-carboxyphenylglycine (MCPG) (240 microM), but not by alpha-methyl-(2S,3S,4S)-alpha-(carboxycyclopropyl)-glycine (MCCG) (290 microM) or by alpha-methyl-(S)-2-amino-4-phosphonobutyrate (L-MAP4) (250 microM), and was mimicked by 3,5-dihydroxyphenylglycine (DHPG) (30 microM), but not by L(+)-2-amino-4-phosphonobutyrate (L-AP4) (100 microM). Therefore, trans-ACPD's facilitatory effects appear to involve group I mGluRs. 4. Potentiation was prevented by the G-protein decoupling agent pertussis toxin (3-6 ng ml(-1), 36 h preincubation). The protein kinase C inhibitors staurosporine (2.0 microM) and N-(2-aminoethyl)-5-isoquinolinesulphonamide HCI (H9) (77 microM) did not significantly reduce enhanced NMDA responses. Protein kinase C activation with phorbol-12-myristate 13-acetate (5.0 microM) had no effect. 5. Intracellular Ca2+ depletion with thapsigargin (0.1 microM) (which inhibits Ca2+/ATPase), 1,2-bis(O-aminophenoxy)ethane-N,N,N',N'-tetracetic acid acetyl methyl ester (BAPTA-AM) (50 microM) (which buffers elevations of [Ca2+]i), and bathing spinal cords in nominally Ca2+-free medium all reduced trans-ACPD's effects. 6. The calmodulin antagonists N-(6-aminohexyl)-5-chloro-1-naphthalenesulphonamide (W7) (100 microM) and chlorpromazine (100 microM) diminished the potentiation. 7. In summary, group I mGluRs selectively facilitate NMDA-depolarization of frog motoneurones via a G-protein, a rise in [Ca2+]i from the presumed generation of phosphoinositides, binding of Ca2+ to calmodulin, and lessening of the Mg2+-produced channel block of the NMDA receptor.  (+info)

An inhibitor of exported Mycobacterium tuberculosis glutamine synthetase selectively blocks the growth of pathogenic mycobacteria in axenic culture and in human monocytes: extracellular proteins as potential novel drug targets. (3/617)

Mycobacterium tuberculosis and other pathogenic mycobacteria export abundant quantities of proteins into their extracellular milieu when growing either axenically or within phagosomes of host cells. One major extracellular protein, the enzyme glutamine synthetase, is of particular interest because of its link to pathogenicity. Pathogenic mycobacteria, but not nonpathogenic mycobacteria, export large amounts of this protein. Interestingly, export of the enzyme is associated with the presence of a poly-L-glutamate/glutamine structure in the mycobacterial cell wall. In this study, we investigated the influence of glutamine synthetase inhibitors on the growth of pathogenic and nonpathogenic mycobacteria and on the poly-L-glutamate/glutamine cell wall structure. The inhibitor L-methionine-S-sulfoximine rapidly inactivated purified M. tuberculosis glutamine synthetase, which was 100-fold more sensitive to this inhibitor than a representative mammalian glutamine synthetase. Added to cultures of pathogenic mycobacteria, L-methionine- S-sulfoximine rapidly inhibited extracellular glutamine synthetase in a concentration-dependent manner but had only a minimal effect on cellular glutamine synthetase, a finding consistent with failure of the drug to cross the mycobacterial cell wall. Remarkably, the inhibitor selectively blocked the growth of pathogenic mycobacteria, all of which release glutamine synthetase extracellularly, but had no effect on nonpathogenic mycobacteria or nonmycobacterial microorganisms, none of which release glutamine synthetase extracellularly. The inhibitor was also bacteriostatic for M. tuberculosis in human mononuclear phagocytes (THP-1 cells), the pathogen's primary host cells. Paralleling and perhaps underlying its bacteriostatic effect, the inhibitor markedly reduced the amount of poly-L-glutamate/glutamine cell wall structure in M. tuberculosis. Although it is possible that glutamine synthetase inhibitors interact with additional extracellular proteins or structures, our findings support the concept that extracellular proteins of M. tuberculosis and other pathogenic mycobacteria are worthy targets for new antibiotics. Such proteins constitute readily accessible targets of these relatively impermeable organisms, which are rapidly developing resistance to conventional antibiotics.  (+info)

Retinal ganglion cell response properties in the transcorneal electrically evoked response of the visual system. (4/617)

To identify the retinal origin of a cortical evoked potential elicited by transcorneal electrical stimulation of the visual system (EER), the response properties of retinal ganglion cells (RGCs) of cats to transcorneal electrical stimuli were studied. The discharge latency of RGCs to transcorneal stimulation had two peaks with a high temporal resolution. The latency of early components of the EER is associated with the discharge latency of RGCs. Some RGCs showed prominent oscillatory discharges after transcorneal stimulation. Discharges of ON-bipolar cells responding to transcorneal stimulation were significantly inhibited by intravitreal injection of DL-2-amino-4-phosphonobutyrate (APB), which blocks the ON-pathway. These findings indicate that the EER has far-field potentials that might relate to oscillatory discharges of RGCs, and that ON bipolar cells and their related synaptic sites are involved in transcorneal electrical stimuli. The far-field potentials of the EER may have clinical applications, similar to those of somatosensoric evoked potentials and auditory brain stem potentials.  (+info)

Analysis of pharmacologically isolated components of the ERG. (5/617)

An harmonic analysis was applied to the electroretinogram (ERG) measured in intact cat eyes in control conditions and after pharmacological isolation of the components attributed to photoreceptors (PIII) and bipolar neurons (PII). The frequency response curves obtained in various conditions showed that the bandwidth of the PII component extends over a range of stimulus frequencies higher than the bandwidth of PIII. The enhancement of the PII response to stimuli of high temporal frequency suggests the presence of a frequency dependent gain control located either pre- and/or post-synaptically in the transmission line between the phototransductive cascade and bipolar neurons. A possible role of these processes is to enhance relevant visual information whilst selectively attenuating low frequency signals originating in the transductive cascade.  (+info)

NPY inhibits glutamatergic excitation in the epileptic human dentate gyrus. (6/617)

Neuropeptide Y (NPY) has been shown to depress hyperexcitable activity that has been acutely induced in the normal rat brain. To test the hypothesis that NPY can also reduce excitability in the chronically epileptic human brain, we recorded intracellularly from dentate granule cells in hippocampal slices from patients with hippocampal seizure onset. NPY had a potent and long-lasting inhibitory action on perforant path-evoked excitatory responses. In comparison, the group 3 metabotropic glutamate receptor agonist L-2-amino-4-phosphonobutyric acid (L-AP4) evoked a mild and transient decrease. NPY-containing axons were found throughout the hippocampus, and in many epileptic patients were reorganized, particularly in the dentate molecular layer. NPY may therefore play a beneficial role in reducing granule cell excitability in chronically epileptic human tissue, and subsequently limit seizure severity.  (+info)

A novel domain of the inhibitory glycine receptor determining antagonist efficacies: further evidence for partial agonism resulting from self-inhibition. (7/617)

Different amino side chains in the N-terminal extracellular region of the inhibitory glycine receptor (GlyR) have been shown to be crucial for ligand recognition. Here we describe a novel domain of the GlyRalpha1 subunit that constitutes an important determinant of antagonist activity. The antagonists strychnine, nipecotic acid, and isobutyric acid displayed reduced potencies at recombinant GlyRs formed from alpha1 subunits, in which lysine 104, phenylalanine 108, or threonine 112 were replaced by alanine. Agonist affinities, in contrast, were slightly increased at these mutant receptors. Taurine and beta-aminoisobutyric acid, which are partial agonists at the wild-type GlyR, behaved as full agonists at the mutant GlyRs and failed to inhibit glycine-induced currents. This is consistent with apolar residues at positions 104, 108, and 112 of the alpha1 subunit reducing the antagonistic, but not the agonistic, binding of beta-amino acids. Our data support a model in which the partial agonism of beta-amino acids results from their self-inhibitory activity.  (+info)

Role of Ngamma-acetyldiaminobutyrate as an enzyme stabilizer and an intermediate in the biosynthesis of hydroxyectoine. (8/617)

Strain CHR63 is a salt-sensitive mutant of the moderately halophilic wild-type strain Halomonas elongata DSM 3043 that is affected in the ectoine synthase gene (ectC). This strain accumulates large amounts of Ngamma-acetyldiaminobutyrate (NADA), the precursor of ectoine (D. Canovas, C. Vargas, F. Iglesias-Guerra, L. N. Csonka, D. Rhodes, A. Ventosa, and J. J. Nieto, J. Biol. Chem. 272:25794-25801, 1997). Hydroxyectoine, ectoine, and glucosylglycerate were also identified by nuclear magnetic resonance (NMR) as cytoplasmic organic solutes in this mutant. Accumulation of NADA, hydroxyectoine, and ectoine was osmoregulated, whereas the levels of glucosylglycerate decreased at higher salinities. The effect of the growth stage on the accumulation of solutes was also investigated. NADA was purified from strain CHR63 and was shown to protect the thermolabile enzyme rabbit muscle lactate dehydrogenase against thermal inactivation. The stabilizing effect of NADA was greater than the stabilizing effect of ectoine or potassium diaminobutyrate. A (1)H NMR analysis of the solutes accumulated by the wild-type strain and mutants CHR62 (ectA::Tn1732) and CHR63 (ectC::Tn1732) indicated that H. elongata can synthesize hydroxyectoine by two different pathways-directly from ectoine or via an alternative pathway that converts NADA into hydroxyectoine without the involvement of ectoine.  (+info)

*Journal of Experimental Psychology: Animal Learning and Cognition

The Journal of Experimental Psychology: Animal Learning and Cognition is a peer-reviewed academic journal published by the American Psychological Association. It covers research in experimental psychology, specifically pertaining to all aspects of animal behavior processes. It was established in 1975 as the Journal of Experimental Psychology: Animal Behavior Processes, an independent section of the Journal of Experimental Psychology. In 2014, the journal subtitle was changed to Animal Learning and Cognition. The editor-in-chief is Ralph R. Miller (Binghamton University). The journal is abstracted and indexed by MEDLINE/PubMed and the Social Science Citation Index. According to the Journal Citation Reports, the journal has a 2014 impact factor of 1.949, ranking it 8th out of 14 journals in the category "Psychology, Biological". Miller, R. (January 2014). "Editorial Explaining the Change in Name of This Journal to Journal of Experimental Psychology: Animal Learning and Cognition". Journal of ...

*Learning & Behavior

... is a quarterly peer-reviewed scientific journal published by Springer Science+Business Media on behalf of the Psychonomic Society. The journal was established in 1973 as Animal Learning and Behavior, obtaining its current title in 2003. The founding editor-in-chief was Abram Amsel, the current editor is Geoffrey Hall (University of York). The journal covers research into fundamental processes underlying learning and behavior in animals (including humans). The journal is abstracted and indexed in: Science Citation Index Social Science Citation Index Index medicus/MEDLINE/PubMed Scopus PsycINFO Astrophysics Data System Embase CAB International Academic OneFile Academic Search Aquatic Sciences and Fisheries Abstracts Biological Abstracts BIOSIS Previews CAB Abstracts CSA Environmental Sciences Current Contents/Social & Behavioral Sciences Current Contents/Life Sciences Elsevier BIOBASE FRANCIS Global Health The Zoological Record According to the Journal Citation Reports, the ...

*Memory & Cognition

... is a peer-reviewed academic journal covering cognitive science. It is published by Springer Science+Business Media on behalf of the Psychonomic Society and was established in 1973. The editor-in-chief is Neil Mulligan (University of North Carolina). The journal is abstracted and indexed in: CINAHL Current Contents/Social & Behavioral Sciences EBSCO databases Embase EMCare FRANCIS Index Medicus/MEDLINE/PubMed International Bibliography of Periodical Literature MLA International Bibliography PASCAL ProQuest databases PsychInfo Scopus Social Science Citation Index According to the Journal Citation Reports, the journal has a 2014 impact factor of 2.457. "CINAHL Complete Database Coverage List". CINAHL. EBSCO Information Services. Retrieved 2016-06-04. "Master Journal List". Intellectual Property & Science. Thomson Reuters. Retrieved 2016-06-04. "Embase Coverage". Embase. Elsevier. Retrieved 2016-06-04. "Memory & Cognition". NLM Catalog. National Center for Biotechnology ...

*The Lancet

... is a weekly peer-reviewed general medical journal. It is one of the world's oldest and best known general medical journals. The Lancet was founded in 1823 by Thomas Wakley, an English surgeon who named it after the surgical instrument called a lancet, as well as after the architectural term "lancet arch", a window with a sharp pointed arch, to indicate the "light of wisdom" or "to let in light". The Lancet publishes original research articles, review articles ("seminars" and "reviews"), editorials, book reviews, correspondence, as well as news features and case reports. The Lancet has been owned by Elsevier since 1991. As of 2015[update], the editor-in-chief is Richard Horton. The journal has editorial offices in London, New York, and Beijing. In the 2014 Journal Citation Reports, The Lancet was ranked second among general medical journals, (with an impact factor of 45), after The New England Journal of Medicine (impact factor of 56). The Lancet also publishes several specialty ...

*Journal of Low Temperature Physics

The Journal of Low Temperature Physics is a biweekly peer-reviewed scientific journal covering the field of low temperature physics and cryogenics, including superconductivity, superfluidity, matter waves, magnetism and electronic properties, active areas in condensed matter physics, and low temperature technology. Occasionally, special issues dedicated to a particular topic are published. According to the Journal Citation Reports, the journal has a 2015 impact factor of 0.787. The journal was established by John G. Daunt in 1969 and the current editors-in-chief are Neil S. Sullivan, Jukka Pekola and Paul Leiderer. The journal is abstracted and indexed in Chemical Abstracts Service, Science Citation Index, and Scopus. "Journal of Low Temperature Physics". 2015 Journal Citation Reports. Web of Science (Science ed.). Thomson Reuters. 2016. "CAS Source Index". Chemical Abstracts Service. American Chemical Society. Retrieved 2016-07-22. [permanent dead link] "Master Journal List". Intellectual ...

*Clinical Journal of the American Society of Nephrology

The Clinical Journal of the American Society of Nephrology is a monthly peer-reviewed medical journal covering nephrology. It was established in 2006 and is published by the American Society of Nephrology. The editor-in-chief is Gary Curhan (Harvard Medical School). According to the Journal Citation Reports, the journal has a 2014 impact factor of 4.613. The journal is abstracted and indexed in the following databases: CINAHL Current Contents/Clinical Medicine MEDLINE Science Citation Index Scopus "Clinical Journal of the American Society of Nephrology". 2014 Journal Citation Reports. Web of Science (Science ed.). Thomson Reuters. 2015. Official ...

*Future Medicinal Chemistry

... is a peer-reviewed medical journal covering all aspects of medicinal chemistry, including drug discovery, pharmacology, in silico drug design, structural characterization techniques, ADME-Tox investigations, and science policy, economic and intellectual property issues. It was established in 2009 and is published by Future Science. The editors-in-chief are Iwao Ojima (The State University of New York at Stony Brook) and Jonathan Baell (Monash University). The journal is abstracted and indexed by BIOSIS Previews, Chemical Abstracts, Chemistry Citation Index, Embase/Excerpta Medica, Index Medicus/MEDLINE/PubMed, Science Citation Index Expanded, and Scopus. According to the Journal Citation Reports, the journal has a 2016 impact factor of 3.556, ranking it 11th out of 60 journals in the category "Chemistry, Medicinal". "Journals Ranked by Impact: Chemistry, Medicinal". 2016 Journal Citation Reports. Web of Science (Science ed.). Thomson Reuters. 2017. Official ...

*Library and Information Science Abstracts

La Library and Information Science Abstracts (LISA) è una base dati di indici e abstract specifica per bibliotecari e altri professionisti della documentazione. LISA copre la letteratura in ambito archivistico, biblioteconomico e in scienza dell'informazione sin dal 1969 e attualmente indicizza oltre 440 periodici da quasi 70 paesi in più di 20 diverse lingue. Gli abstract riguardano articoli e atti di convegni, conferenze, seminari, monografie, tesi di laurea e rapporti tecnici. Meho e Spurgin (2005) hanno dimostrato che in una lista di 2.625 articoli pubblicati tra il 1982 e il 2002 da 68 ricercatori di 18 istituti di archivistica, biblioteconomia e scienza dell'informazione solo 10 database portavano una copertura significativa dell'ambito. I dati hanno dimostrato che Library Literature and Information Science (LLIS) indicizza la più alta percentuale di pubblicazioni in questo ambito disciplinare (31,2%), seguita da INSPEC (30,6%), Social Sciences Citation Index (SSCI) (29,6%), e LISA ...

*Behavioural Brain Research

Neuroscience portal Behavioural Brain Research is a peer-reviewed scientific journal published by Elsevier. The journal publishes articles in the field of behavioural neuroscience. Volume 1 appeared in 1980 and issues appeared 6 times per year; as submissions increased it switched to a higher frequency and currently 20 issues per year are published. Behavioural Brain Research is abstracted and indexed in Animal Behavior Abstracts, BIOSIS Previews, Chemical Abstracts, Current Contents/Life Sciences, EMBASE, MEDLINE, PsycINFO, Science Citation Index, and Scopus. According to the Journal Citation Reports, its 2013 impact factor is 3.391. "Indexing Information". Behavioural Brain Research. Retrieved 2009-05-10. "Behavioural Brain Research". 2013 Journal Citation Reports. Web of Science (Science ed.). Thomson Reuters. 2014. Official ...

*Journal of Aerosol Science

The Journal of Aerosol Science is a peer-reviewed academic journal covering the study of aerosols in multiple disciplines, including physics, chemistry, and engineering. It was established in 1970 and is published thirteen times per year. It is published by Elsevier in association with the European Aerosol Assembly. The editors-in-chief are Pratim Biswas (Washington University in St. Louis), Mansoo Choi (Seoul National University), and Alfred Weber (Clausthal University of Technology). According to the Journal Citation Reports, the journal has a 2016 impact factor of 2.042. "Journal of Aerosol Science". 2016 Journal Citation Reports. Web of Science (Science ed.). Clarivate Analytics. 2017. Official ...

*Classics Live!

... è il secondo album dal vivo del gruppo rock statunitense Aerosmith pubblicato nel 1986, dopo Live! Bootleg. Contiene registrazioni dal vivo comprese tra il 1978 e il 1984. In alcune registrazioni suonano anche Jimmy Crespo e Rick Dufay che avevano sostituito i due chitarristi Joe Perry e Brad Whitford. Non è però specificato dove suonano i primi due e ove suonano gli altri due. Altre versioni live di molte di queste canzoni erano anche presenti in Live! Bootleg. Tutte le tracce sono suonate all'Orpheum Theatre di Boston, il 14 febbraio del 1984 eccetto Kings and Queens (Music Hall di Boston il 28 marzo 1978), Dream On (Capital Center a Largo il 9 novembre del 1978) e Major Barbara che doveva originariamente essere compresa in Get Your Wings, ma era rimasta inedita. Un'altra versione è reperibile nel box set Pandora's Box. Nel 1998 questo album e il successivo Classics Live! Vol. 2 furono uniti in un unico cofanetto intitolato Classics Live! Complete. ...

*Rapid Communications in Mass Spectrometry

... è una rivista accademica che si occupa di spettrometria di massa. Nel 2014 il fattore d'impatto della rivista era di 2,253. ^ Journal Citation Reports, ...

*List of Carnegie libraries in Nebraska

a b At various times, Bobinski and Jones disagree on these numbers. In these cases, Jones' numbers have been used due to both a more recent publication date and a more detailed gazetteer of branch libraries, which are often where the discrepancies occur. ...
China High Quality Gamma Aminobutyric Acid, Find details about China Gamma Aminobutyric Acid from High Quality Gamma Aminobutyric Acid - Qingdao Sunrise Biotechnology Co., Ltd.
Abstract Plants treated with the nonprotein amino acid beta-aminobutyric acid (BABA) develop an enhanced capacity to resist biotic and abiotic stresses. This BABA-induced resistanc..
Pure Gamma Aminobutyric Acid (GABA) Powder at BulkSupplements.com - FREE Shipping. Read Gamma Aminobutyric Acid (GABA) Nutritional Information and Reviews.
Online Doctor Chat - Query about gamma aminobutyric acid consumption, Ask a Doctor about Gamma-aminobutyric acid, Online doctor patient chat conversation by Dr. Prasad
Shop for Gaba Gamma Aminobutyric Acid 750 Mg Tablets For Calm Mood - 90 Ea from Mood and Stress Relaxers. Browse other items form Source Naturals Stress & Mood
Buy GABA elisa kit, Mouse Gamma Aminobutyric Acid ELISA Kit-XP_001900805.1 (MBS005471) product datasheet at MyBioSource, ELISA Kits
Aminobutyric Acids: Aliphatic four carbon acids substituted in any position(s) with amino group(s). They are found in most living things. The best known is GAMMA-AMINOBUTYRIC ACID.
1. γ-Aminobutyric acid (GABA) immunoreactivity is demonstrated by the indirect immunofluorescence technique in a small population of retinal neurons cultured from human fetuses. 2. Positive staining was restricted to a few cells and could be observed as soon as the cells became attached to the substrate (within 5 hr). It is therefore concluded that the GABA-positive cells are determined prenatally. 3. The GABA-positive cells grow processes during development in culture and remain constant in numbers. These cells have a different morphology from either GFAP-positive cells or serotinin-accumulating cells. 4. It is suggested that the GABA-positive cells in culture are probably amacrine neurones. 5. Cultures of human retinal dissociates may therefore provide an alternative means of studying specific cell types should a constant supply of living human retinas be difficult to obtain. γ-Aminobutyric acid (GABA) immunoreactivity is demonstrated by the indirect immunofluorescence technique in a small
This Decision Document has been prepared to explain the regulatory decision reached under the regulatory directive Dir95-03 Guidelines for the Assessment of Novel Feeds: Plant Sources and regulatory directive Dir94-08 Assessment Criteria for Determining Environmental Safety of Plants with Novel Traits.
This decision document has been prepared to explain the regulatory decision reached under the guidelines Dir94-08 Assessment Criteria for Determining Environmental Safety of Plants with Novel Traits and its companion document Dir94-11 The Biology of Zea mays L. (Corn/Maize) and the guidelines Dir95-03 Guidelines for the Assessment of Livestock Feed from Plants with Novel Traits.
Koerner and Cotman (1981) initially described that the diacidic amino acid analog l-2-amino-4-phosphonobutyric acid (l-AP4) selectively suppressed glutamate excitations by a presynaptic mechanism in the lateral perforant pathway of the hippocampus. This inhibitory activity of l-AP4 on glutamate excitations was also observed in other preparations, including the mossy fiber synapse, lateral olfactory tract, and spinal cord (seeThomsen, 1997). Until the 1990s, presynaptic inhibition induced by l-AP4 was ascribed to a relatively nebulous "l-AP4" receptor. However, with the cloning of the group III mGlu receptors, which Nakanishi (1992) defined by their sensitivity to l-AP4, it was recognized that certain group III mGlu subtypes might be responsible forl-AP4-induced suppression of glutamate release. Current data suggest a role for mGlu7, mGlu8, and possibly mGlu4 as candidates for these presynaptic effects of l-AP4 in the brain (seeThomsen, 1997).. In general, when compared with mGlu7 or mGlu2/3 ...
Wan, H M and Cahusac, P M B (1995) L (+)-2-amino-4-phosphonobutyric acid (L-AP4) causes disinhibition of neuronal responses in primary somatosensory (SI) cortex of the urethane-anesthetized adult-rat. Journal of Physiology, 483. pp. 155-156. ISSN 0022-3751 Full text not available from this repository ...
Buy the best amino supplements from M&M Fitness Australia supplement warehouse Brisbane. Buy amino acids such as phenibut (phenyl gamma aminobutyric acid), gaba (gamma aminobutyric acid), acetyl l-carnitine, agmatine, glycine, beta alanine and more! Order online or shop at our Brisbane supplement store with our huge range of discount supplements in Loganholme.
This study is a multicenter, randomized, double-masked, placebo-controlled clinical study. All groups will receive standard intensive diabetes treatment with insulin and life style management. 60 subjects will be randomly assigned in a 1:1:1 ratio to receive placebo or different dosage of GABA.. GABA is an amino acid produced from glutamate by glutamic acid decarboxylase. It was approved for the treatment of hepatic coma, fibromyalgia, ataxia in China and is widely used as supplement for the treatment of epilepsy, insomnia, stress and tobacco dependence. It has been recently shown that GABA can prevent and reverse the development of diabetes in type 1 mice models. Participants will receive placebo or GABA for 52 weeks.. The study will consist of 4 weeks screening period, 2 weeks run-in period, 52 weeks treatment period and 4 weeks follow-up period. Enrollment is expected to occur over 2 years.. To assess the efficacy and safety of GABA for the treatment of juvenile type 1 diabetes in new onset ...
1 mCi quantities of Aminobutyric Acid (GABA), ?-[2,3-3H(N)]- , Specific Activity: 70-100Ci/mMole are available for your research. Application of [3H] GABA can be found in: effects of diazepam in pharmacology biochemistry/behavior, in vivo release in cat caudate nucleus in brain research, electrically evoked release from rat cerebral cortex in pharmacology, uptake by oligodendrocytes in autoradiographic and immunocytochemical studies, etc. ...
250 µCi quantities of Aminobutyric Acid (GABA), ?-[2,3-3H(N)]- , Specific Activity: 70-100Ci/mMole are available for your research. Application of [3H] GABA can be found in: effects of diazepam in pharmacology biochemistry/behavior, in vivo release in cat caudate nucleus in brain research, electrically evoked release from rat cerebral cortex in pharmacology, uptake by oligodendrocytes in autoradiographic and immunocytochemical studies, etc. ...
Wuxi AccoBio Biotech Inc. is a professional supplier located in China, we are specializing in R&D, production and marketing of Nutraceutical ingredients, food additives, plant extracts, cosmetic raw materials, pharmaceutical intermediates and other fine chemicals.
We show that expression of B. subtilis threonine deaminase, combined with expression of a mutated form of E. coli glutamate dehydrogenase leads to the production of 0.40 ± 0.02 mg/L of (S)-2-aminobutyric acid in shake flask-grown S. cerevisiae cells. The higher production in E. coli achieved by Zhang and co-workers [26] is perhaps due to the special properties of the E. coli strain employed, which can produce 8 g/L l-threonine from 30 g/L glucose. Nevertheless, we rationalize that yeast is indeed a superior production host for (S)-2-aminobutanol production, as it displays higher robustness and considerable tolerance against harsh fermentation conditions. Yeast is also more resistant towards exposure to (S)-2-aminobutanol (Additional file 1: Figure S4). Moreover, the fermentation of yeasts is easily implemented into existing ethanol productions plants, and there are no issues with phage contamination. S. cerevisiae is classified as GRAS ("generally regarded as safe") organism; thereby further ...
Creative Peptides offers L-2-Aminobutyric acid for your research. We also provide custom peptide synthesis, process development, GMP manufacturing.
Creative Peptides offers D-3-Aminobutyric acid for your research. We also provide custom peptide synthesis, process development, GMP manufacturing.
The substrate phosphinothricin is used as a nonselective herbicide and is a potent inhibitor of EC 6.3.1.2, glutamate-ammonia ligase, a key enzyme of nitrogen metabolism
The third gene, called bar, has a supporting role to play in DMH-11. Bar makes crops resistant to the herbicide glufosinate and is linked to barnase when the latter is inserted into mustard. This is because pollen-free parents are not just needed for making one generation of hybrids but also for making more pollen-free crops for the next generation. This army of sterile mustard crops is grown by crossing sterile barnase crops with normal mustard crops (that have no barstar gene to reverse sterility). The offspring of these crosses are sterile half the time, because only half of them receive the barnase gene. But because these sterile plants also have the bar gene, they are resistant to glufosinate. This allows a plant breeder to recover all the sterile crops by killing off the fertile ones with a glufosinate spray. The process of hybridisation can now be repeated to produce new seeds.. What we know about bar, barnase and barstar. Humans have been eating proteins encoded by bar, barnase and ...
One hundred and seventeen green tall fescue plants and 37 albino plants were regenerated from a glufosinate ammonium resistant callus clone co-transformed with the bar gene and the gusgene, both driven by the rice actin 1 ...
Glutamic acid. Molecular model of the amino acid glutamic acid. Its chemical formula is C5.H9.N.O4. Atoms are represented as spheres and are colour- coded: carbon (blue), hydrogen (gold), nitrogen (dark blue) and oxygen (red). Amino acids are the building blocks of proteins. Glutamic acid is not an essential amino acid, so it does not need to be obtained from the diet. It has an important role in nerve function and brain signalling, where it is a precursor to the molecule GABA. GABA (gamma aminobutyric acid) is an inhibitory neurotransmitter (nerve signalling chemical) that is an integral component of the central nervous system (CNS). - Stock Image A611/0047
Singular Free Form Amino Acid - Pharmaceutical Grade. GABA supplements are recommended for helping to: Calm the nervous system, reduce stress, reduce anxiety, help with sleep disturbances, as well as boosting the immune system and stimulating natural Human Growth Factor (HGH).*. GABA is an amino acid that occurs naturally in the brain. GABA is a neurotransmitter that helps induce relaxation and sleep.. In addition to the GABA supplements anxiety reducing effects, GABA supplements enhance the bodys immune system, as well as helping to improve mood and stimulate the anterior pituitary, leading to increased levels of Human Growth Hormone (HGH). Some individuals may experience a minor tingling of the skin and/or slight shortness of breath shortly after taking a GABA supplement. This is a characteristic of this amino acid and quickly subsides.. One GABA supplement Capsule Contains:. GABA (Gamma Aminobutyric Acid).......500 mg. Our GABA supplement contains no: Starch, corn, milk, wheat, yeast, ...
A composition for the inhibition of the abnormal postnatal axial growth of the eye of a maturing animal which comprises a pharmaceutically effective amount of a gamma aminobutyric acid antagonist rela
MRS exams were performed on the addicted teenagers both prior to and following behavioral therapy, while for control patients, a single MRS study was carried out in order to measure the levels of gamma aminobutyric acid (GABA), a neurotransmitter in the brain that slows and inhibits signals, and glutamate-glutamine (Glx), a neurotransmitter that causes increases electrical excitement in neurons.. Prior researches had indicated GABA to be involved in motor and vision control as well as the regulation of numerous brain functions, like anxiety.. The findings of the MRS suggested that, prior to therapy, the ratio of GABA to Glx was considerably increased in the anterior cingulate cortex of smartphone- and Internet-addicted youth, when compared with the healthy controls.. According to Dr. Seo, the ratios of GABA to creatine and GABA to glutamate correspond highly to clinical scales of internet and smartphone addictions, anxiety and depression.. High levels of GABA can lead to several side effects, ...
Glutamine is one of 20 amino acids that help form all internal proteins and perform various other jobs inside your body. Gamma aminobutyric acid, or GABA,...
Ivermectin acts directly on neurotransmitter gamma aminobutyric acid (GABA) system and exterminate the parasite with anesthetizing nervous system. It exterminates both of internal and external parasites simultaneously with only low volume dose ...
Ascending Reticular Activating System (ARAS). Jika terjadi kelainan pada kedua sistem ini, baik yang melibatkan sistem anatomi maupun fungsional akan mengakibatkan terjadinya penurunan kesadaran dengan berbagai tingkatan. Ascending Reticular Activating System merupakan suatu rangkaian atau network system yang dari kaudal berasal dari medulla spinalis menuju rostral yaitu diensefalon melalui brain stem sehingga kelainan yang mengenai lintasan ARAS tersebut berada diantara medulla, pons, mesencephalon menuju ke subthalamus, hipothalamus, thalamus dan akan menimbulkan penurunan derajat kesadaran. Neurotransmiter yang berperan pada ARAS antara lain neurotransmiter kolinergik, monoaminergik dan gamma aminobutyric acid (GABA). Kesadaran ditentukan oleh interaksi kontinu antara fungsi korteks serebri termasuk ingatan, berbahasa dan kepintaran (kualitas), dengan ascending reticular activating system (ARAS) (kuantitas) yang terletak mulai dari pertengahan bagian atas pons. ARAS menerima serabut-serabut ...
A free platform for explaining your research in plain language, and managing how you communicate around it - so you can understand how best to increase its impact.
Using the above system, an OGD dose-response curve was generated first. The culture medium was changed to an exposure medium (glucose-free 37°C Hanks balanced salt solution; Invitrogen Corp.). Culture plates were then placed in a thermoregulated chamber (37°C). The gas phase was altered to 95% N2-5% CO2flowing into the incubated chamber at 10 l/min. Pilot studies were performed which determined that this flow rate caused a reduction of the oxygen concentration to less than 5% within 8 min, after which flow was reduced to 1 l/min for the balance of the exposure interval. Oxygen concentration in the effluent gas was continuously monitored with a medical gas analyzer to assure it remained under 5% for the balance of the exposure interval. Timing of OGD duration was started after the chamber reached 5% O2concentration. OGD was terminated by exchange of the exposure medium to normal oxygenated culture medium and restitution of the ambient atmosphere to 5% CO2-room air at 37°C after return to the ...
In this study, we analyzed the gene for GABARAP which we found in our SSH screening for down-regulated genes between the breast cancer cell line CAL51 and its nontumorigenic microcell hybrid CAL/17-1. It mapped to the chromosomal region 17p13.1. GABARAP was highly expressed in the microcell hybrid but was markedly down-regulated in CAL51 and all other breast cancer cell lines tested.. GABARAP was originally identified as a putative GABAA receptor clustering protein through its interaction with the cytoskeleton and the γ2 subunit of GABAA receptor (11, 21, 22) . It was thought to promote trafficking of GABAA receptor from intracellular pools to the cell surface, finally acting as an anchor between the receptor and the cytoskeleton at synaptic membranes. Although GABARAP was found to colocalize with the receptor in cultured cortical neurons (11), further experiments revealed that no colocalization between the microtubule-binding protein gephyrin, for which an important role in GABAA receptor ...
Name: 4-Aminobutyric acid. Synonyms:Piperidic acid; Piperidinic acid; GABA; gamma-Aminobutyric acid. Molecular Formula: C4H9NO2. Molecular Weight: 103.12. CAS Registry Number: 56-12-2. EINECS: 200-258-6. Water solubility: Soluble. ...
γ‐Aminobutyric acid (GABA), the principal inhibitory neurotransmitter in the brain, signals through ionotropic (GABAA/C) and metabotropic (GABAB) receptor systems
Alzheimers disease (AD) is characterized by the transition of amyloid-β (Aβ) monomers into toxic oligomers and plaques. Given that Aβ abnormality typically precedes the development of clinical symptoms, an agent capable of disaggregating existing Aβ aggregates may be advantageous. Here we report that a small molecule, 4-(2-hydroxyethyl)-1-piperazinepropanesulphonic acid (EPPS), binds to Aβ aggregates and converts them into monomers. The oral administration of EPPS substantially reduces hippocampus-dependent behavioural deficits, brain Aβ oligomer and plaque deposits, glial γ-aminobutyric acid (GABA) release and brain inflammation in an Aβ-overexpressing, APP/PS1 transgenic mouse model when initiated after the development of severe AD-like phenotypes ...
GABA (?-aminobutyric acid) is the primary inhibitory neurotransmitter in the central nervous system and interacts with three different receptors:…
A mitomycin C (MMC) antibody was produced following immunization of rabbits with a MMC-bovine serum albumin conjugate, which was newly synthesized by coupling MMC to mercaptosuccinylated bovine serum albumin via a cross-linker, N-maleoyl aminobutyric acid. Enzyme labeling of MMC was performed using β-d-galactosidase (EC 3.2.1.23) via m-maleoyl benzoic acid. An enzyme immunoassay for MMC was developed utilizing these reagents by a double-antibody technique. The standard curve of the assay was linear on a logitlog plot, and the lower limit of detection was 12 nm (0.2 ng/tube) so the enzyme immunoassay was found to be approximately 25 times more sensitive than a microbiological assay. Further, the enzyme immunoassay is practically free from interference by any other anticancer drugs. No significant decrease in MMC immunoreactivity was observed following 24 hr of incubation of the drug in normal human serum or urine at 37°. Using this assay, serum or urine levels of MMC can be determined ...
Rapid Analysis of Drugs in Forensic Specimens Using the DPiMSTM-8060,Direct Analysis of Glyphosate, Glufosinate and AMPA in Beverages Using a Triple Quadrupole LC/MS/MS
Current therapies for Parkinsons disease are able to ameliorate the symptoms in the early stages, however as the disease progresses, they become less effective and patients often develop debilitating side effects. There is currently a significant unmet need for disease modifying or neuroprotective drugs to slow the rate of disease progression and provide long-term symptomatic relief. Novel therapeutics that can provide symptomatic relief whilst attenuating the ongoing neurodegeneration are therefore sought. The targeting of metabotropic glutamate (mGlu) receptors has become a therapeutic focus in recent years. The group III mGlu receptors are the focus of this thesis as they currently hold the most therapeutic promise, with evidence suggesting activation of these receptors not only modulates aberrant neurotransmission in the basal ganglia to provide symptom relief, but also provides neuroprotective effects in the nigrostriatal system through a variety of mechanisms. Recent advances in the ...
TY - JOUR. T1 - Activation of A-type γ-aminobutyric acid receptors excites gonadotropin-releasing hormone neurons. AU - DeFazio, R. Anthony. AU - Heger, Sabine. AU - Ojeda, Sergio. AU - Moenter, Suzanne M.. PY - 2002/12/1. Y1 - 2002/12/1. N2 - γ,-Aminobutyric acid (GABA), acting through GABAA receptors (GABAAR), is hypothesized to suppress reproduction by inhibiting GnRH secretion, but GABA actions directly on GnRH neurons are not well established. In green fluorescent protein-identified adult mouse GnRH neurons in brain slices, gramicidin-perforated-patch-clamp experiments revealed the reversal potential (EGABA) for current through GABAARs was depolarized relative to the resting potential. Furthermore, rapid GABA application elicited action potentials in GnRH neurons but not controls. The consequence of GABAAR activation depends on intracellular chloride levels, which are maintained by homeostatic mechanisms. Membrane proteins that typically extrude chloride (KCC-2 cotransporter, CLC-2 ...
Glufosinate is the active ingredient that inhibits plant growth in herbicides that LibertyLink plants are resistant to. These herbicides can come in a variety of forms, including bialaphos, a tripeptide containing two alanine residues and glufosinate. In the case of bialaphos, the peptide is cleaved to produce the active glufosinate.. Glufosinate is very similar in chemical structure to the amino acid glutamate. Because of this structural similarity, glufosinate is able to act as an inhibitor for the enzyme glutamine synthetase, for which glutamate is a substrate. The inhibition of glutamine synthase (GS) results in disruption of the glycolate pathway. Metabolic flux through the pathway is reduced and intracellular levels of pathway intermediates accumulate. One of these intermediates, glyoxylate, is a a strong inhibitor of the key photosynthetic enzyme ribulose bisphosphate carboxylase. Without the activity of this enzyme, plants are unable to fix carbon and rapidly die.. Glufosinate is an ...
Liberty herbicide (glufosinate ammonium) does not kill Pioneer Hi-Breds genetically engineered (GE) Liberty Link corn, even though it is taken up and translocated throughout the plant, because the corn inactivates the herbicide. Genes engineered into the corn produce enzymes in every cell of the corn plant that change glufosinate ammonium into N-acetyl-L-glufosinate, or NAG. When you eat the corn, though, you are also eating NAG that accumulated in the crop with each herbicide application. Some of that NAG may be transformed back into the toxic herbicide in your gut, possibly by bacteria. Two studies with rats showed conversion rates of 1% and 10% respectively, while a study with goats showed conversion of more than one-third. The revived herbicide may travel to kidneys, liver, muscle, fat and milk, where it may be toxic ...
Martin LJ, Oh GH, Orser BA. (2009) Anesthesiology. 111(5):1025-35.. Abstract. BACKGROUND: The memory-blocking properties of general anesthetics have recently received considerable attention because of concerns related to intraoperative awareness and postoperative cognitive dysfunction. The goal of this study was to identify the mechanisms by which γ-aminobutyric acid subtype A receptors that contain the α5 subunit (α5GABAARs) induce memory-blockade by etomidate and a pharmacologic strategy to reverse this impairment.. METHODS: The effects of etomidate and the α5GABAAR-preferring inverse agonist L-655,708 on the plasticity of glutamatergic excitatory transmission in hippocampal slices and behavioral memory for spatial navigational and fear-associated memory tasks were studied in wild-type and null mutant mice for the gene that encodes the α5 subunit (Gabra5-/- mice). Long-term potentiation of field excitatory postsynaptic potentials was induced in CA1 pyramidal neurons following ...
Neurotransmitter release depends on the expression and organization of various molecules, including calcium (Ca2+) channel and neurotransmitter receptor subtypes, in the presynaptic nerve terminal. Group III metabotropic glutamate receptors (mGluRs), which act as autoreceptors on glutamatergic nerve terminals, inhibit transmitter release largely through inhibiting Ca2+ influx. Millán et al. used Ca2+ imaging of rat brain synaptosomes, in combination with pharmacological and immunofluorescent analysis, to investigate the distribution of mGluRs and showed differential localization of two types of mGluRs with different Ca2+ channel subtypes. The authors used the mGluR inhibitor L(+)-2-amino-4-phosphonobutyrate (L-AP4) to implicate two populations of mGluRs in inhibiting glutamate release after depolarization with potassium chloride. Immunocytochemical analysis with antibodies against mGluRs identified the mGluRs as mGlu4 and mGluR7; and labeling for the synaptic vesicle marker synaptophysin, ...
Delirium occurs in 60-80% of ventilated Intensive Care Unit (ICU) patients and is independently associated with prolonged hospital stay, higher cost, a 3-fold increased risk of dying by six months and ongoing neuropsychological dysfunction. Hypothesis: Based on our preliminary work, we hypothesize that standard use of GABA agonist sedatives such as lorazepam and propofol may contribute to ICU delirium and its attendant untoward clinical outcomes. An alternative sedation strategy targeting alpha2 receptors and sparing GABA receptors (dexmedetomidine) might reduce delirium, provide adequate sedation, reduce analgesic requirement, and concurrently improve cognitive performance.. Long-term objective: To standardize and compare different strategies of sedation and analgesia for ventilated ICU patients in order to optimize their clinical outcomes focusing on delirium and the long-term neuropsychological dysfunction of ICU survivors.. Specific Aims:. ...
There is abundant evidence that dysfunction from the -aminobutyric acid (GABA)ergic signaling system is implicated in the pathology of schizophrenia and disposition disorders. possess led the writers to summarize Atipamezole HCl manufacture that GABAergic inhibition performing through receptors that are the 2-subunit includes a potential antidepressant-like impact.59 The gene for GABR? clusters at Xq28 (Desk 5) with genes for the 3- and -subunits.60 Atipamezole HCl manufacture mRNA for the ?-subunit continues to be identified in the septum, thalamus, hypothalamus and amygdala Atipamezole HCl manufacture in rat human brain and was coexpressed with mRNA for the -subunit often;61 however, it had been not within the cerebellum.62 GABAA receptors including GABR? have already been been shown to be insensitive to benzodiazepines63, 64 and overexpression of GABR? shows to bring about insensitivity to anesthetics.65 Our finding of elevated expression of GABR? in the lateral cerebella of topics with ...
cyclo-N(gamma)-diNH-butyryl- enkephalin-Leu: synthesized by cyclization of the COOH-terminal carboxyl group of leucine from leucine enkephalin to the gamma amino moiety of alpha,gamma-diaminobutyric acid substituted in position 2 of the peptide; structure in first source
I agree Our site saves small pieces of text information (cookies) on your device in order to deliver better content and for statistical purposes. You can disable the usage of cookies by changing the settings of your browser. By browsing our website without changing the browser settings you grant us permission to store that information on your device. ...
RESULTS: The GABA signalling system was compromised in islets from type 2 diabetic individuals, where the expression of the genes encoding the α1, α2, β2 and β3 GABA(A) channel subunits was downregulated. GABA originating within the islets evoked tonic currents in the cells. The currents were enhanced by pentobarbital and inhibited by the GABA(A) receptor antagonist, SR95531. The effects of SR95531 on hormone release revealed that activation of GABA(A) channels (GABA(A) receptors) decreased both insulin and glucagon secretion. The GABA(B) receptor antagonist, CPG55845, increased insulin release in islets (16.7 mmol/l glucose) from normoglycaemic and type 2 diabetic individuals ...
|Growth hormone isoform responses to GABA ingestion at rest and after exercise.Powers ME, Yarrow JF, McCoy SC, Borst SE.Division of Athletic Training, Shenendoah University, Winchester, VA 22601, USA. [email protected] administration of the amino acid/inhibitory neurotransmitter gamma aminobutyric acid (GABA) reportedly elevates resting serum growth hormone (GH) concentrations. PURPOSE: To test the hypothesis that GABA ingestion…
GABA is referred to as the brains natural calming agent, and as such, GABA may help promote relaxation. GABA (gamma aminobutyric acid) is a non-essential amino acid found mai...
Are you stressed? Having trouble sleeping? Suffering from anxiety? You may, like 99.32% of all other Americans, be deficient in magnesium. Not to worry! Fresh off the slow boat from Australia, GABAMAG is here to help.. Among a host of other advantages, magnesium has a calming effect on your bodys nervous system and relaxes the muscles, which in turn will help you to fall asleep easier. A deficiency of magnesium is also sometimes responsible for the nervousness that prevents sleep as well as restless legs syndrome. Magnesium may also improve the length and quality of slow wave sleep. Additionally magnesium binds to and activates GABA receptors. GABA is short for gamma aminobutyric acid, which is your most major relaxing neurotransmitter (brain chemical). Normalisation of brain GABA levels leads to a reduction in stress, anxiety, nervousness, depression and an improvement in insomnia resulting in a more restful nights sleep. ...
GABA gamma aminobutyric acid is a non-essential amino acid found mainly in the human brain and eyes. It is considered an inhibitory neurotransmitter, which means it regulates brain and nerve cell activity by inhibiting the number of neurons firing in
Low prices on Childrens Formulas! Attention issues may be helped with a nutritional approach*. Children who need to focus or concentrate better are often deficient in the amino acid L-glutamine, a precursor for gamma aminobutyric acid (GABA). GABA is a neurotransmitter that is needed for proper attentiveness.D MAE (dimethylaminoethanol), a natural amino found in the brain, has also been used to support proper attention levels.S
Low prices on Childrens Formulas! Attention issues may be helped with a nutritional approach*. Children who need to focus or concentrate better are often deficient in the amino acid L-glutamine, a precursor for gamma aminobutyric acid (GABA). GABA is a neurotransmitter that is needed for proper attentiveness.D MAE (dimethylaminoethanol), a natural amino found in the brain, has also been used to support proper attention levels.S
Thank you for your interest in spreading the word about Biochemical Society Transactions.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
Thank you for your interest in spreading the word about Biochemical Society Transactions.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
Sullivan R, Chateauneuf A, Coulombe N, Kolakowski LF, Johnson MP, Hebert TE, Ethier N, Belle M, Metters K, Abramovitz GP, ONeill GP, Ng GY. Co-expression of full length γ-aminobutyric acid B (GABAB) receptors with truncated receptors and metabotropic glutamate receptor 4 supports the GABAB heterodimer as the functional receptor. J Pharmacol Exp Ther 2000;293:460-467 ...
The synaptic receptors of ON bipolar neurons are selectively activated by 2-amino-4-phosphonobutyrate, a glutamate analogue. This agent uniquely distinguishes these receptors from other types of excitatory amino acid receptors found in the retina. Various glutamate and aspartate analogues were used to assess the structure-activity characteristics of this receptor. The results suggest that it represents one class of glutamate receptor which can be distinguished by its preferential activation by acidic amino acid analogues that match the extended conformation of glutamate.. ...
The response of Arabidopsis to the chemical defence activator ß-aminobutyric acid (BABA) has emerged as a model system to study the molecular mechanisms underpinning defence priming. BABA primes multiple defence responses that are controlled by different defence signalling pathways (1-3). BABA has long been known for its protective effects against plant disease, including devastating crop diseases such…
The binding of radioactive γ-aminobutyric acid (GABA) to receptor-like sites in mammalian brain membranes was analyzed by computer for comparison with models which might explain the observed apparent heterogeneity of ligand binding. The best fit was obtained with two independent binding sites. Binding was measured by centrifugation, using thoroughly washed, frozen, and thawed membranes without detergent treatment. Assays were carried out at 0° under sodium ion-free conditions which have previously been shown to allow detection only of those binding sites having the chemical specificity and other properties expected of receptor sites for the neurotransmitter GABA. Quantitative analysis of binding curves for several brain regions, subcellular fractions, and species revealed the general presence of two affinity classes for GABA receptors, one with KD Of 13 ± 6 nM (Bmax = 0.33 pmole/mg of protein in bovine cortex) and the other with KD of 300 ± 150 nM (Bmax 1.8 pmole/mg of protein in bovine ...
Scribner, E.A., Battaglin, W.A., Gilliom, R.J. and Meyer, M.T. (2007) Concentrations of Glyphosate, Its Degradation Product, Aminomethylphophonic Acid, and Glufosinate in Ground- and Surface-Water, Rainfall, and Soil Samples Collected in the United States, 2001-06S. Geological Survey Scientific Investigations Report 2007-5122.
The stacked maize line MON87427 x MON89034 x TC1507 x MON88017 x 59122 was obtained through the traditional cross breading of each of the parental organisms to produce a maize that expresses each of EPSPS, Cry1A.105, Cry2Ab2, Cry1F, PAT, Cry34Ab1 and Cry35Ab1 genes. The expression of these genes are expected to confer resistance to Lepidoptera and Coleoptera, and tolerant to glufosinate herbicide and glyphosate herbicide ...
Genetic factors predicting outcome after elective and emergent social, policy, and ethical from the motor cortex levitra zararlarД± can be very difficult for data collection. Buprenorphine and a metallic stent, the common complications of pregnancy, which in turn increases release of -aminobutyric acid (gaba) at the targets of 6-ht-ergic agents in patients suffering from nonpsychotic anxiety suggested that narcolepsy could be an efficient mitochondrial function, gene transcription, apoptosis, cell proliferation, while inducing apoptosis of lsc apoptosis as determined from the cvlt-sf, a copy of the antigen-presenting cell (apc). Many women experience menstrual cycle (wehr et al. Risk factors predisposing one to make that choice. Bilateral infarction in asymptomatic elderly: The rotterdam study. Autonoetic, or self-knowing awareness, and various proteins associated with chronic liver disease do not happen some magical somewhere in the lungs plays a role in the. Following their release from ...
A Japanese research team has become the first in the world to discover that 2-aminobutyric acid is closely involved in the metabolic regulation of the antioxidant glutathione, and that it can effectively raise levels of glutathione in the body when ingested.
View and buy high purity GGsTop from Tocris Bioscience, the leading worldwide supplier of high performance life science reagents.
ENGLISH ABSTRACT: Glufosinate ammonium is one of the most widely-applied broad-spectrum herbicides, controlling weeds in a huge variety of crops worldwide. Farmers rely on glufosinate ammonium because it ensures a high degree of crop safety, as it only affects the parts of the plant where it is applied. It is effective against a broad range of weeds, eliminating the need to apply several herbicides to control different weeds in a given crop. Its unique mode of action makes it ideal to be used in rotation with other herbicides to mitigate weed resistance. Despite these favourable attributes for weed control glufosinate ammonium has its shortcomings. Glufosinate ammonium is a post emergence herbicide and its efficacy is not exempt from the effect of environmental/climatic conditions and the growth stage of weeds. The possible effect of these factors on the performance of the herbicide was investigated in a glasshouse study using ryegrass (Lolium spp) as the test species. The investigation ...
http://ajessayvuqu.beeduul.com Has Your Sauerkraut Fermentation Gone Bad. Friend had it in his big toe and could hardly walk on it. Mma aminobutyric acid GABA abbreviation for gamma aminobutyric acid. Ick Go. Would swell up and he couldnt walk on it. My father had gout in his knee often? Aper need not be flat: Paper and biomaterials industries need to converge to bring about true innovation" BioRes. Three Fermentation Rules and Many Troubleshooting Tips By Holly HoweGABA Abbreviation for aminobutyric acid. Pal, L. 017). Ur browser will take you to a Web page (URL) associated with that DOI name. Nd Joyce, M. Nd questions or comments to doi. BA abbr. Type or paste a DOI name into the text box. Department of Pharmaceutics, State Key Laboratory of Natural Medicines, China Pharmaceutical University, 24 Tong Jia Xiang, Nanjing 210009, China . BA x03B3. BA aminobutyric acid. Cheese Science! Oject:aim: to compare rate of fermentation of given. Traditional. Steur was the first to demonstrate? En though ...
The events were developed to allow the use of glufosinate ammonium herbicide active as an option some weed control ingredient. These lines of transgenic soybeans containing the PAT (phosphinothricin acetyltransferase) enzyme that enables plants to survive applications of glufosinate that could be lethal. The pat gene inserted into events, was isolated from a common soil hogo, Streptomyces viridochromogenes and introduced into the plant genome by biolistics. ...
Our long-term goal is to control wheat diseases through the enhancement of host plant resistance. The constitutive expression of plant defense genes to control fungal diseases can be engineered by genetic transformation. Our experimental strategy was to biolistically transform wheat with a vector DNA containing a rice chitinase gene under the control of the CaMV 35 S promoter and the bar gene under control of the ubiquitin promoter as a selectable marker. Immature embryos of wheat cv Bobwhite were bombarded with plasmid pAHG11 containing the rice chitinase gene chi11 and the bar gene. The embryos were subcultured on MS2 medium containing the herbicide bialaphos. Calli were then transferred to a regeneration medium, also containing bialaphos. Seventeen herbicide-resistant putative transformants (T0) were selected after spraying with 0.2% Liberty, of which 16 showed bar gene expression as determined by the phosphinothricin acetyltransferase (PAT) assay. Of the 17 plants, 12 showed the expected ...
The nucleotide precursors of cell-wall mucopeptide were prepared by vancomycin inhibition of Corynebacterium insidiosum and Corynebacterium poinsettiae. The amino acid in the third position in the former peptide was shown by optical rotatory dispersion of the bisdinitrophenyl derivative to be l-diaminobutyric acid. Homoserine in the nucleotide from C. poinsettiae was catalytically oxidized to aspartic acid, which was then shown to be the l-isomer by optical rotatory dispersion of the trinitrophenyl compound. The sequence for C. insidiosum was UDP-N-acetylmuramyl-glycyl-isoglutamyl- (γ-acetyl)-diaminobutyryl-alanyl-alanine. The cell walls of C. insidiosum and Corynebacterium sepedonicum contained diaminobutyric acid that was optically inactive. It is proposed, therefore, that the primary peptide chain contains the l-isomer with its γ-amino group blocked by acetylation and that cross-linking is achieved by means of the d-isomer, analogous to d-ornithine in C. poinsettiae.. ...
Os receptores de GABA são uma classe de receptores que respondem ao neurotransmissor ácido gama-aminobutírico (GABA), o principal neurotransmissor inibitório no sistema nervoso central maduro dos vertebrados. Existem duas classes de receptores de GABA: GABAA. e GABAB. Kuffler SW, Edwards C (novembro de 1958). «Mechanism of gamma aminobutyric acid (GABA) action and its relation to synaptic inhibition». J. Neurophysiol. 21 (6): 589-610. PMID 13599049 Kravitz EA, Kuffler SW, Potter DD (setembro de 1963). «Gamma-aminobutyric acid and other blocking compounds in crustacea. III. Their relative concentrations in separated motor and inhibitory axons». J. Neurophysiol. 26: 739-51. PMID 14065325 !CS1 manut: Nomes múltiplos: lista de autores (link) Krnjević K, Schwartz S (1967). «The action of gamma-aminobutyric acid on cortical neurones». Exp Brain Res. 3 (4): 320-36. PMID 6031164. doi:10.1007/BF00237558 Takeuchi A, Takeuchi N (agosto de 1967). «Anion permeability of the inhibitory ...
The tested maize hybrids have been obtained by crossing two genetically modified parental components: one parental component has received an insert providing resistance to certain Coleopteran insects and tolerance to glufosinate ammonium herbicide (confidential information is provided in Annex 1), the other parental component has received inserts for resistance to certain Lepidopteran insects and tolerance to glufosinate-ammonium herbicide (confidential information is provided in Annex 1) and for tolerance to glyphosate herbicide (confidential information is available in notification B/ES/01/05). ...
Investigators honed in on a specific lipid transmitter, the endogenous cannabinoid 2-arachidonoylglycerol (2-AG), and found that inhibition of its enzymatic biosynthesis by diacylglycerol lipase (DAGL) restores the gamma aminobutyric acid (GABA) functionality compromised by chronic nicotine exposure.
Dear Reader,. Valerian is an herb that has actually been used as a mild tranquilizer and sleep aid for over 1,000 years, mainly in Europe. Its derived from the dried rhizome (root-like portion) and roots of the Valeriana officinalis plant, a tall perennial herb that has a distinct aroma that some people may find unpleasant. Some studies conducted indicate that valerian may help those suffering from insomnia or other sleep disorders; however, because of small sample sizes and varying amounts of valerian being used, these findings are not conclusive. Although numerous studies of the herb have been conducted, what causes valerians exact calming mechanism remains unknown. Some scientists believe that valerian increases the amount of gamma aminobutyric acid (GABA - a chemical that can have a calming effect) in the brain.. In order to prepare the dietary supplement, the rhizome (underground stem), the stolons, and roots are carefully dried. The dried materials are then used in teas, tinctures, ...
Nesterenkonia halobia strain DSM 20541 di- and tricarboxylate transporter, diaminobutyric acid acetyltransferase (ectA), diaminobutyric acid aminotransferase (ectB), and ectoine synthase (ectC) genes, complete ...
Nesterenkonia halobia strain DSM 20541 di- and tricarboxylate transporter, diaminobutyric acid acetyltransferase (ectA), diaminobutyric acid aminotransferase (ectB), and ectoine synthase (ectC) genes, complete ...
Close The Infona portal uses cookies, i.e. strings of text saved by a browser on the users device. The portal can access those files and use them to remember the users data, such as their chosen settings (screen view, interface language, etc.), or their login data. By using the Infona portal the user accepts automatic saving and using this information for portal operation purposes. More information on the subject can be found in the Privacy Policy and Terms of Service. By closing this window the user confirms that they have read the information on cookie usage, and they accept the privacy policy and the way cookies are used by the portal. You can change the cookie settings in your browser. ...
extracellular exosome, glutaminyl-peptide cyclotransferase activity, zinc ion binding, peptidyl-pyroglutamic acid biosynthetic process, using glutaminyl-peptide cyclotransferase
1FPY: The crystal structure of phosphinothricin in the active site of glutamine synthetase illuminates the mechanism of enzymatic inhibition.
It is the combination of β -(4-chlorophenyl)-γ-aminobutyric acid (β-(4-chlorophenyl)-GABA) this is available under the brand name Lioresal. this is used as the skeletal muscle relaxant and all above the baclofen is used to treat spasticity. What is baclofen? Baclofen is a medication that provides relaxation to the skeleton muscles which helps in the movement of skeleton. Baclofen is oral and injectable .... Read More » ...
Breastrup C., Nielsen E.B., Sonnewald U., Knutsen L.J., Andersen K.E., Jansen J.A., Frederiksen K., Andersen P.H., Mortensen A., Suzdak P.D. (1990) (R)-N[4,4-Bis(3-methyl-2-thienyl)but-3-en-1-yl]nipecotic acid binds with high affinity to the brain γ-aminobutyric acid uptake carrier. J. Neurochem. 54,639-647. ...
1 Answer - Posted in: sta-d, gabapentin, drug - Answer: Abbreviation for γ-aminobutyric acid. Definition: a constituent of the ...
7-hydroxy-2-(3-hydroxy-4-methoxy-phenyl)chroman-4-one 4-chloro-2,6-bis(1-piperidyl)pyrimidine 2-Butenoic acid, 4-amino-4-oxo-, N-(C16-18 and C16-18-unsatd.)alkyl derivs., sodium salts 3,6,9,12-Tetraoxatetradecan-1-ol, 14-(4-nonylphenoxy)-, branched Amines, C10-18-alkyldimethyl, N-oxides methyl 2-oxo-1H-quinoline-4-carboxylate Cyclo(L-alanyl-L-tryptophyl-L-leucylglycyl-Lthreonyl-L-prolyl-L-asparaginyl) 4-(2-chlorophenyl)-3,9-dimethyl-2,4,8,9-tetrazabicyclo[4.3.0]nona-2,7,10-trien-5-one [[(4E)-4-(4,7-dimethoxy-6-oxo-benzofuran-5-ylidene)-6-methyl-1H-pyrimidin-2-yl]amino]formonitrile (4-chlorophenyl)-(4-chlorophenyl)sulfanyl-methanone
Dichiarazioni precauzionali: P260u-P303+P361+P353-P305+P351+P338-P301+P330+P331-P405-P501a Do not breathe dusts or mists. IF ON SKIN (or hair): Remove/Take off immediately all contaminated clothing. Rinse skin with water/shower. IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses, if present and easy to do. Continue rinsing. IF SWALLOWED: Rinse mouth. Do NOT induce vomiting. Store locked up. Dispose of contents/container in accordance with local/regional/national/international regulations. ...
bakit ang western union aguinaldo st. sa iligan city basta na lang tumatangap ng pera galing sa komu kuha ng pera kahit hind iti nka pangalan sa kanila.. porket kilala nalang nila ..binibigay na lang nila..kahit ito nka pangalan sa komuha ...
In questa pagina sono elencati i comunicati che riportano ultime notizie di Varie. Basta cliccare sul titolo per leggere ogni singolo comunicato di Varie, mentre scorrendo i numeri delle e pagine, potrai leggere anche le notizie di Varie meno recenti. Abbiamo creato suddivisione ulteriore dei comunicati di Varie, per permetterti di cercare nello specifico anche i comunicati di eventuali sotto-categorie.. ...
In questa pagina sono elencati i comunicati che riportano ultime notizie di Varie. Basta cliccare sul titolo per leggere ogni singolo comunicato di Varie, mentre scorrendo i numeri delle e pagine, potrai leggere anche le notizie di Varie meno recenti. Abbiamo creato suddivisione ulteriore dei comunicati di Varie, per permetterti di cercare nello specifico anche i comunicati di eventuali sotto-categorie.. ...
The extracellular anionic polysaccharide isolated from cultures of a unicellular red alga, Porphyridium cruentum, contains a small amount of protein after extensive purification. The polysaccharide and protein are recovered in the same fraction after isopycnic CsCl-density-gradient centrifugation in 4M-guanidinium chloride, under conditions designed to separate proteins from polysaccharide. The peptide portion of the protein-polysaccharide is released from the polysaccharide by alkali under conditions for beta-elimination. The released peptide is non-diffusible, but in can be separated from the polysaccharide by precipitation of the polysaccharide as the cetylpyridinium complex. Under conditions for beta-elimination of certain O-glycosidic carbohydrate-protein linkages, selective destruction of serine and threonine occurs. The addition of a reducing agent to the alkali mixture produces a selective increase in alanine and alpha-aminobutyric acid. Addition of a tritiated reducing agent to the ...
gabT1; 4-aminobutyrate transaminase,4-aminobutyrate aminotransferase PuuE,4-aminobutyrate transaminase,4-aminobutyrate aminotransferase and related aminotransferases,4-aminobutyrate transaminase,Aminotransferase class-III; K00823 4-aminobutyrate aminotransferase [EC:2.6.1.19] ...
tr:Q7UCQ0_SHIFL] gabT1; 4-aminobutyrate transaminase,4-aminobutyrate aminotransferase PuuE,4-aminobutyrate transaminase,4-aminobutyrate aminotransferase and related aminotransferases,4-aminobutyrate transaminase,Aminotransferase class-III; K00823 4-aminobutyrate aminotransferase [EC:2.6.1.19] ...
Gamma aminobutyric acid (GABA) is the most abundant inhibitory neurotransmitter in the mammalian central nervous system (CNS). When released in the synaptic cleft, GABA binds to three major classes of receptors: GABAA, GABAB, and GABAC receptors. GABAA and GABAC receptors are ionotropic and mediate fast GABA responses by triggering chloride channel openings, while GABAB receptors are metabotropic and mediate slower GABA responses by activating G-proteins and influencing second messenger systems. GABAA receptors, the major sites for fast inhibitory neurotransmission in the CNS, are regulated by phosphorylation mechanisms, affecting both their functional properties and their cell surface mobility and trafficking. GABA release by the presynaptic terminal is negatively regulated by GABAB autoreceptors, and is cleared from the extracellular space by GABA transporters (GATs) located either on the presynaptic terminal or neighboring glial cells ...
Neural Plasticity is a peer-reviewed, Open Access journal that publishes articles related to all aspects of neural plasticity, with special emphasis on its functional significance as reflected in behavior and in psychopathology. Neural Plasticity publishes research and review articles from the entire range of relevant disciplines, including basic neuroscience, behavioral neuroscience, cognitive neuroscience, biological psychology, and biological psychiatry.
Serving Size: 1 Heaping ScoopServings Per Container: 20Amount Per ServingServing% DVProprietary Blend14 g Proprietary Blend: 4-amino-3-phenylbutyric acid, Gamma aminobutyric acid, Mucuna pruriens extract (standardized to 50% L-Dopa), L-arginine HCI,
cqu:CpipJ_CPIJ008729 K13524 4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22] , (RefSeq) 4-aminobutyrate aminotransferase, mitochondrial (A) MIDGLRNLLSALVNRPALGVFPGEDWPAKLQNVLMSVAPTGLDHVTTMMCGSCSNENAFK NIFIWYQSQLRGKAPFSEKEIASSMVNQAPGAPKLSILSFHGAFHGRTLGCLSTTHSKYI HKIDIPSFDWPIASFPKYRYPLEENVRENAQEDARCLAEVEGLIEAYAKKGIPVAGIIVE PIQSEGGDNEASPEFFQNLQKIAKRHGSALLIDEVQTGGGPTGKLWCHEHFNLDSPPDVV TFSKKMQLGGYYHAAHMKPAQPYRVFNTWMGDPGKLLLLESILKVIKQESLLKNVEKTGA KLKAGLLQAQNEFPTLLNSARGRGTFLAINCASTKLRDDIVAALKQKGVLSGGCGEISIR FRPALIFQERHVDIFLDKFRQVLKELK ...
The first report that several neurotransmitters, including γ-aminobutyric acid (GABA), decreased neuronal action potential duration in dorsal root ganglia (DRG) neurons appeared more than 35 years ago (Dunlap and Fischbach, 1978). Dunlap and Fischbach (1978) realized that the effects of GABA could not occur via the ionotropic GABA receptor-at that time the only known GABA receptor-and that the target ion channel was most likely a voltage-gated calcium (CaV) channel, rather than a NaV or KV channel. They correctly concluded that another type of GABA receptor must exist, which we now know is the G protein-coupled GABA type B (GABAB) receptor. The modulated channel was later identified as the chick homologue of the N-type Ca2+ channel CaV2.2 (α1B) (Cox and Dunlap, 1992), one of three members of the CaV2 family. GABAB receptors in human and rodent sensory neurons and in various expression systems were shown subsequently to inhibit native N-current and recombinant CaV2.2 current, respectively ...
1OHV: Structures of {Gamma}-Aminobutyric Acid (Gaba) Aminotransferase, a Pyridoxal 5-Phosphate, and [2Fe-2S] Cluster-Containing Enzyme, Complexed with {Gamma}-Ethynyl-Gaba and with the Antiepilepsy Drug Vigabatrin
The development of crops resistant to 2,4-D, dicamba, and glufosinate may provide new options for the management of glyphosate-resistant (GR) giant ragweed and other herbicide-resistant weeds. A fallow field study was conducted in 2011 and 2012 to determine the control of GR giant ragweed with 2,4-D and dicamba applied alone and in combination with glufosinate or fomesafen. Dicamba and 2,4-D tank-mixed with glufosinate or fomesafen provided the highest level of control at 10 or 20 days after application (DAA). At 30 DAA, all herbicide treatments provided ,88% control of giant ragweed except glyphosate, glufosinate, and 2,4-D alone at 0.56 kg ae ha-1. Glyphosate, glufosinate, and 2,4-D alone at 0.56 kg ae ha-1 also had the highest number of giant ragweed plants (,5.8 plants m-2) and highest biomass (,19.2 g m-2). Contrast statements between 2,4-D and dicamba indicated no differences among treatments containing these herbicides. However, contrast analysis indicated that herbicides applied alone ...
The mGlu5 receptor is the only metabotropic glutamate receptor subtype expressed by mouse embryonic stem (ES) cells grown under non-differentiating conditions [Cappuccio, L, Spinanti, P. Porcellini, A., Desiderati, F., De Vita, T., Storto, M., Capobianco, L., Battaglia, G., Nicoletti, F., Melchiorri, D., 2005. Endogenous activation of mGlu5 metabotropic glutamate receptors supports self-renewal of cultured mouse embryonic stem cells. Neuropharmacology 1, 196-205]. We now report that ES cells differentiating into embryoid bodies (EBs) progressively lose mGlu5 receptors and begin to express mGlu4 receptors at both mRNA and proteinc level. A 4-day treatment of EBs with the mGlu4 receptor agonist, L-2-amino-4-phosphonobutanoate (L-AP4), increased mRNA levels of the mesoderm marker, brachyury and the endoderm marker, H19, and decreased the expression of the transcript for the primitive ectoderm marker, fibroblast-growth factor-5 (FGF-5). These effects were prevented by the mGlu4 receptor antagonists, ...
Abstract: The neutral amino acid [gamma]-aminobutyric acid (GABA) produced membrane hyperpolarization and increased membrane chloride ion conductance of spinal cord (SC) and cortical (CTX) neurons in cell culture. GABA dose-response curves were obtained for SC neurons by pressure applying known concentrations of GABA from micropipettes with large tips (miniperfusion pipettes). GABA response threshold was about 2 [mu]M and large responses were elicited at GABA concentrations greater than 10 [mu]M. Bicuculline (BICUC) (0.1-10 [mu]M) reversibly antagonized GABA responses on both SC and CTX neurons with a half maximal inhibitory concentration of about 1 [mu]M. BICUC antagonism of GABA responses was competitive (Lineweaver-Burke analysis). These results are compared with data on GABA and BICUC displacement of [3H]GABA binding to membranes of SC and CTX neurons in cell culture. It is suggested that high affinity GABA receptors are likely to be relevant for postsynaptic GABA responses while low ...
WSSA scientists say a significant contributing factor in the evolution of herbicide resistance is the repeated use of a single chemical in the absence of other control methods. To stress the vital importance of a more varied, integrated approach, the society adopted a comprehensive, multiyear initiative focused on education. The first training materials were launched in 2011, beginning with a module on herbicide resistance in agronomic crops. The newest additions to WSSAs online training resources address other environments where herbicide resistance management is imperative. Aquatic: WSSA partnered with the Aquatic Plant Management Society (APMS) to develop educational materials on herbicide resistance in lakes, waterways and other aquatic environments. Three online lessons describe aquatic plant control, herbicide selection and effective ways to manage specific scenarios. A free white paper developed by APMS on herbicide resistance stewardship is also available for download. "All of the ...
Background:: The neural mechanisms of anesthetic vapors have not been studied in depth. However, modeling and experimental studies on the intravenous anesthetic propofol indicate that potentiation of γ-aminobutyric acid receptors leads to a state of thalamocortical synchrony, observed as coherent frontal alpha oscillations, associated with unconsciousness. Sevoflurane, an ether derivative, also potentiates γ-aminobutyric acid receptors. However, in humans, sevoflurane-induced coherent frontal alpha oscillations have not been well detailed. Methods:: To study the electroencephalogram dynamics induced by sevoflurane, the authors identified age- and sex-matched patients in which sevoflurane (n = 30) or propofol (n = 30) was used as the sole agent for maintenance of general anesthesia during routine surgery. The authors compared the electroencephalogram signatures of sevoflurane with that of propofol using time-varying spectral and coherence methods. Results:: Sevoflurane general anesthesia is ...
Field studies were conducted to evaluate weed control in herbicide-resistant rape (Brassica napus [Brassica napus var. oleifera]) in Georgia, USA. The resistant rape cultivars and respective herbicides were Pioneer 45A76 and imazamox, Hyola 357RR and glyphosate, and 2573 Invigor and glufosinate. Weed seed of Italian ryegrass (Lolium multiflorum) and wild radish (Raphanus raphanistrum) were sown simultaneously in October with rape and control of these species was evaluated along with other naturally occurring weeds. Herbicide treatments for the respective herbicide-resistant rape cultivar were imazamox at 0.035 and 0.071 kg/ha, glyphosate at 0.84 and 1.64 kg/ha, and glufosinate at 0.5 and 1.0 kg/ha. Herbicides were applied at one- to two-leaf and three- to four-leaf rape stages. There was no significant injury to any rape cultivar as a result of herbicide rate or timing of application. By midseason (February), imazamox effectively controlled wild radish, henbit (Lamium amplexicaule), and ...

US9029598B2 - Methods for production of arginine biocarbonate at low pressure 
        - Google PatentsUS9029598B2 - Methods for production of arginine biocarbonate at low pressure - Google Patents

Halogenated aminohexanoates and aminobutyrates antimicrobial agents US5370865A (en) 1992-05-15. 1994-12-06. Kao Corporation. ... Halogenated aminohexanoates and aminobutyrates antimicrobial agents US5286480A (en) 1992-06-29. 1994-02-15. The Procter & ...
more infohttps://patents.google.com/patent/US9029598

Find Scholarly Works
             - Arizona State UniversityFind Scholarly Works - Arizona State University

Adamescu, G. S., Plumptre, A. J., Abernethy, K. A., Polansky, L., Bush, E. R., Chapman, C. A., Shoo, L. P., Fayolle, A., Janmaat, K. R. L., Robbins, M. M., Ndangalasi, H. J., Cordeiro, N. J., Gilby, I., Wittig, R. M., Breuer, T., Hockemba, M. B. N., Sanz, C. M., Morgan, D. B., Pusey, A. E., Mugerwa, B. & 19 othersGilagiza, B., Tutin, C., Ewango, C. E. N., Sheil, D., Dimoto, E., Baya, F., Bujo, F., Ssali, F., Dikangadissi, J. T., Jeffery, K., Valenta, K., White, L., Masozera, M., Wilson, M. L., Bitariho, R., Ndolo Ebika, S. T., Gourlet-Fleury, S., Mulindahabi, F. & Beale, C. M., May 1 2018, In : Biotropica. 50, 3, p. 418-430 13 p.. Research output: Contribution to journal › Article ...
more infohttps://asu.pure.elsevier.com/en/publications/?format=&page=6

Sedlak, T. W.<...Sedlak, T. W.<...

Vasavda, C., Kothari, R., Malla, A. P., Tokhunts, R., Lin, A., Ji, M., Ricco, C., Xu, R., Saavedra, H. G., Sbodio, J. I., Snowman, A. M., Albacarys, L., Hester, L. D., Sedlak, T. W., Paul, B. & Snyder, S. H., Oct 17 2019, In : Cell Chemical Biology. 26, 10, p. 1450-1460.e7. Research output: Contribution to journal › Article ...
more infohttps://jhu.pure.elsevier.com/en/persons/thomas-w-sedlak

Find Research Outputs
             - Johns Hopkins UniversityFind Research Outputs - Johns Hopkins University

Travis, R. C., Perez-Cornago, A., Appleby, P. N., Albanes, D., Joshu, C. E., Lutsey, P. L., Mondul, A. M., Platz, E. A., Weinstein, S. J., Layne, T. M., Helzlsouer, K. J., Visvanathan, K., Palli, D., Peeters, P. H., Bueno-de-Mesquita, B., Trichopoulou, A., Gunter, M. J., Tsilidis, K. K., Sanchez, M. J., Olsen, A. & 46 othersBrenner, H., Schottker, B., Perna, L., Holleczek, B., Knekt, P., Rissanen, H., Yeap, B. B., Flicker, L., Almeida, O. P., Wong, Y. Y. E., Chan, J. M., Giovannucci, E. L., Stampfer, M. J., Ursin, G., Gislefoss, R. E., Bjørge, T., Meyer, H. E., Blomhoff, R., Tsugane, S., Sawada, N., English, D. R., Eyles, D. W., Heath, A. K., Williamson, E. J., Manjer, J., Malm, J., Almquist, M., Le Marchand, L., Haiman, C. A., Wilkens, L. R., Schenk, J. M., Tangen, C. M., Black, A., Cook, M. B., Huang, W. Y., Ziegler, R. G., Martin, R. M., Hamdy, F. C., Donovan, J. L., Neal, D. E., Touvier, M., Hercberg, S., Galan, P., Deschasaux, M., Key, T. J. & Allen, N. E., Jan 1 2019, In : Cancer ...
more infohttps://jhu.pure.elsevier.com/en/publications/?format=

Structure of PTT and the reaction catalyzed by HEPDThe  | Open-iStructure of PTT and the reaction catalyzed by HEPDThe | Open-i

Structure of PTT and the reaction catalyzed by HEPDThe biosyntheses of the commercial herbicide phosphinothricin (boxed in the PTT structure) and the clinically
more infohttps://openi.nlm.nih.gov/detailedresult.php?img=PMC2874955_nihms103023f1&req=4

Department of Physical Medicine and Rehabilitation - Research Output
     - Penn StateDepartment of Physical Medicine and Rehabilitation - Research Output - Penn State

Wu, X., Shi, W. & Cao, X., Jan 1 2007, Skeletal Biology and Medicine, Part A: Aspects of Bone Morphogenesis and Remodeling. Blackwell Publishing Inc., p. 29-49 21 p. (Annals of the New York Academy of Sciences; vol. 1116).. Research output: Chapter in Book/Report/Conference proceeding › Conference contribution ...
more infohttps://pennstate.pure.elsevier.com/en/organisations/department-of-physical-medicine-and-rehabilitation-2/publications/?page=7

L-serine enhances light-induced circadian phase resetting in mice and humans<...L-serine enhances light-induced circadian phase resetting in mice and humans<...

TY - JOUR. T1 - L-serine enhances light-induced circadian phase resetting in mice and humans. AU - Yasuo, Shinobu. AU - Iwamoto, Ayaka. AU - Lee, Sang Il. AU - Ochiai, Shotaro. AU - Hitachi, Rina. AU - Shibata, Satomi. AU - Uotsu, Nobuo. AU - Tarumizu, Chie. AU - Matsuoka, Sayuri. AU - Furuse, Mitsuhiro. AU - Higuchi, Shigekazu. PY - 2017/12/1. Y1 - 2017/12/1. N2 - Background: The circadian clock is modulated by the timing of ingestion or food composition, but the effects of specific nutrients are poorly understood. Objective: We aimed to identify the amino acids that modulate the circadian clock and reset the light-induced circadian phase in mice and humans. Methods: Male CBA/N mice were orally administered 1 of 20 L-amino acids, and the circadian and light-induced phase shifts of wheel-running activity were analyzed. Antagonists of several neurotransmitter pathways were injected before L-serine administration, and light-induced phase shifts were analyzed. In addition, the effect of L-serine on ...
more infohttps://kyushu-u.pure.elsevier.com/en/publications/l-serine-enhances-light-induced-circadian-phase-resetting-in-mice

Stephen Smith - Publications
     - Oregon Health & Science UniversityStephen Smith - Publications - Oregon Health & Science University

Jun, K., Piedras-Rentería, E. S., Smith, S., Wheeler, D. B., Lee, S. B., Lee, T. G., Chin, H., Adams, M. E., Scheller, R. H., Tsien, R. W. & Shin, H. S., Dec 21 1999, In : Proceedings of the National Academy of Sciences of the United States of America. 96, 26, p. 15245-15250 6 p.. Research output: Contribution to journal › Article ...
more infohttps://ohsu.pure.elsevier.com/en/persons/stephen-smith/publications/?type=%2Fdk%2Fatira%2Fpure%2Fresearchoutput%2Fresearchoutputtypes%2Fcontributiontojournal%2Farticle&ordering=publicationYearThenTitle&descending=false

Department of Bioresource Sciences - Research Output
     - Kyushu UniversityDepartment of Bioresource Sciences - Research Output - Kyushu University

Birukawa, N. K., Murase, K., Sato, Y., Kosaka, A., Yoneda, A., Nishita, H., Fujita, R., Nishimura, M., Ninomiya, T., Kajiwara, K., Miyazaki, M., Nakashima, Y., Ota, S., Murakami, Y., Tanaka, Y., Minomi, K., Tamura, Y. & Niitsu, Y., Jan 1 2014, In : Journal of Biological Chemistry. 289, 29, p. 20209-20221 13 p.. Research output: Contribution to journal › Article ...
more infohttps://kyushu-u.pure.elsevier.com/en/organisations/department-of-bioresource-sciences/publications/?ordering=type&descending=false

Activation of A-type γ-aminobutyric acid receptors excites gonadotropin-releasing hormone neurons<...Activation of A-type γ-aminobutyric acid receptors excites gonadotropin-releasing hormone neurons<...

TY - JOUR. T1 - Activation of A-type γ-aminobutyric acid receptors excites gonadotropin-releasing hormone neurons. AU - DeFazio, R. Anthony. AU - Heger, Sabine. AU - Ojeda, Sergio. AU - Moenter, Suzanne M.. PY - 2002/12/1. Y1 - 2002/12/1. N2 - γ,-Aminobutyric acid (GABA), acting through GABAA receptors (GABAAR), is hypothesized to suppress reproduction by inhibiting GnRH secretion, but GABA actions directly on GnRH neurons are not well established. In green fluorescent protein-identified adult mouse GnRH neurons in brain slices, gramicidin-perforated-patch-clamp experiments revealed the reversal potential (EGABA) for current through GABAARs was depolarized relative to the resting potential. Furthermore, rapid GABA application elicited action potentials in GnRH neurons but not controls. The consequence of GABAAR activation depends on intracellular chloride levels, which are maintained by homeostatic mechanisms. Membrane proteins that typically extrude chloride (KCC-2 cotransporter, CLC-2 ...
more infohttps://ohsu.pure.elsevier.com/en/publications/activation-of-a-type-%CE%B3-aminobutyric-acid-receptors-excites-gonado-2

Actions of excitatory amino acids on brisk ganglion cells in the cat retina. [Muscimol.xyz]Actions of excitatory amino acids on brisk ganglion cells in the cat retina. [Muscimol.xyz]

Amino Acids, Quisqualic Acid, Ibotenic Acid, Glutamates, Aminobutyrates, N-Methylaspartate, alpha-Amino-3-hydroxy-5-methyl-4- ... Substances mentioned in the article: Amino Acids; Aminobutyrates; Glutamates; Ibotenic Acid; Aspartic Acid; Glutamic Acid; N- ... Mesh terms: Amino Acids/pharmacology; Aminobutyrates/pharmacology; Anesthesia; Animals; Aspartic Acid/pharmacology; Cats; ...
more infohttps://muscimol.xyz/1980925

Involvement of neurotransmitters in the action of growth hormone-releasing hormone antagonist on passive avoidance learning<...Involvement of neurotransmitters in the action of growth hormone-releasing hormone antagonist on passive avoidance learning<...

TY - JOUR. T1 - Involvement of neurotransmitters in the action of growth hormone-releasing hormone antagonist on passive avoidance learning. AU - Telegdy, Gyula. AU - Schally, Andrew V. PY - 2012/8/1. Y1 - 2012/8/1. N2 - The antagonist MZ-4-71 of growth hormone-releasing hormone (GH-RH) has been shown to suppress the secretion of GH and insulin-like growth factor-1 (IGF-1), suggesting that this class of analogs could be used for the therapy of disorders characterized by excessive GH secretion. Numerous GH-RH antagonists has been synthetized and shown to suppress the growth of various tumors. MZ-4-71 facilitates the consolidation of passive avoidance learning. Beta-amyloid 25-35 impairs the consolidation of passive avoidance learning and MZ-4-71 fully blocks this impairment. However, little is known about the possible mechanism of action of GR-RH antagonists on these actions. In the present work, the possible effects of different neurotransmitters on the action of MZ-4-71 were studied in the ...
more infohttps://miami.pure.elsevier.com/en/publications/involvement-of-neurotransmitters-in-the-action-of-growth-hormone-

Zebrafish larvae exposed to ginkgotoxin exhibit seizure like behavior that is relieved by pyridoxal-5′-phosphate, GABA and anti...Zebrafish larvae exposed to ginkgotoxin exhibit seizure like behavior that is relieved by pyridoxal-5′-phosphate, GABA and anti...

TY - JOUR. T1 - Zebrafish larvae exposed to ginkgotoxin exhibit seizure like behavior that is relieved by pyridoxal-5′-phosphate, GABA and anti-epileptic drugs. AU - Lee, Gang Hui. AU - Sung, Shian Ying. AU - Chang, Wen Ni. AU - Kao, Tseng Ting. AU - Du, Hung Chi. AU - Hsiao, Tsun Hsien. AU - Safo, Martin K.. AU - Fu, Tzu Fun. PY - 2012/11. Y1 - 2012/11. N2 - The etiology of epilepsy is a very complicated, multifactorial process that is not completely understood. Therefore, the availability of epilepsy animal models induced by different mechanisms is crucial in advancing our knowledge and developing new therapeutic regimens for this disorder. Considering the advantages of zebrafish, we have developed a seizure model in zebrafish larvae using ginkgotoxin, a neurotoxin naturally occurring in Ginkgo biloba and hypothesized to inhibit the formation of the neurotransmitter γ-aminobutyric acid (GABA). We found that a 2-hour exposure to ginkgotoxin induced a seizure-like behavior in zebrafish ...
more infohttps://tmu.pure.elsevier.com/zh/publications/zebrafish-larvae-exposed-to-ginkgotoxin-exhibit-seizure-like-beha

Serotonin1A Receptors at the Axon Initial Segment of Prefrontal Pyramidal Neurons in Schizophrenia<...Serotonin1A Receptors at the Axon Initial Segment of Prefrontal Pyramidal Neurons in Schizophrenia<...

TY - JOUR. T1 - Serotonin1A Receptors at the Axon Initial Segment of Prefrontal Pyramidal Neurons in Schizophrenia. AU - Cruz, Dianne A.. AU - Eggan, Stephen M.. AU - Azmitia, Efrain C.. AU - Lewis, David A.. PY - 2004/4. Y1 - 2004/4. N2 - Objective: Inhibition mediated by γ-aminobutyric acid at the axon initial segment of pyramidal neurons appears to be altered in the prefrontal cortex in schizophrenia. This study examined the densities and laminar distribution of axon initial segments labeled with an antibody against the serotonin1A (5-HT1A) receptor, which also mediates inhibitory regulation of pyramidal neurons, in subjects with schizophrenia. Method: The densities and laminar distribution of axon initial segments with 5-HT1A-like immunoreactivity were assessed in postmortem tissue from the prefrontal cortex (Brodmanns area 46) of 14 matched triads of subjects with schizophrenia, subjects with major depressive disorder, and comparison subjects with no psychiatric disorder. Results: The ...
more infohttps://nyu-staging.pure.elsevier.com/en/publications/serotonin1a-receptors-at-the-axon-initial-segment-of-prefrontal-p

Susan S Girdler - Publications
     - University of North Carolina at Chapel HillSusan S Girdler - Publications - University of North Carolina at Chapel Hill

Gordon, J. L., Girdler, S. S., Meltzer-Brody, S. E., Stika, C. S., Thurston, R. C., Clark, C. T., Prairie, B. A., Moses-Kolko, E., Joffe, H. & Wisner, K. L. Mar 1 2015 In : American Journal of Psychiatry. 172, 3, p. 227-236 10 p.. Research output: Contribution to journal › Review article ...
more infohttps://uncch.pure.elsevier.com/en/persons/susan-s-girdler/publications/?type=%2Fdk%2Fatira%2Fpure%2Fresearchoutput%2Fresearchoutputtypes%2Fcontributiontojournal%2Fsystematicreview

張 虹書 - 研究成果
     - 臺北醫學大學張 虹書 - 研究成果 - 臺北醫學大學

Wang, J., Zhang, K., Wang, J., Wu, X., Liu, X., Li, B., Zhu, Y., Yu, Y., Cheng, Q., Hu, Z., Guo, C., Hu, S., Mu, B., Tsai, C. H., Li, J., Smith, L., Yang, L., Liu, Q., Chu, P., Chang, V. 及其他4, Zhang, B., Wu, M., Jiang, X. & Yen, Y., 2015, 於 : Oncotarget. 6, 22, p. 18905-18920 16 p.. 研究成果: 雜誌貢獻 › 文章 ...
more infohttps://tmu.pure.elsevier.com/zh/persons/hung-shu-chang-2/publications/

Treatment of painful diabetic neuropathy<...Treatment of painful diabetic neuropathy<...

TY - JOUR. T1 - Treatment of painful diabetic neuropathy. AU - Javed, Saad. AU - Petropoulos, Ioannis N.. AU - Alam, Uazman. AU - Malik, Rayaz. PY - 2015. Y1 - 2015. N2 - Painful diabetic neuropathy (PDN) is a debilitating consequence of diabetes that may be present in as many as one in five patients with diabetes. The objective assessment of PDN is difficult, making it challenging to diagnose and assess in both clinical practice and clinical trials. No single treatment exists to prevent or reverse neuropathic changes or to provide total pain relief. Treatment of PDN is based on three major approaches: intensive glycaemic control and risk factor management, treatments based on pathogenetic mechanisms, and symptomatic pain management. Clinical guidelines recommend pain relief in PDN through the use of antidepressants such as amitriptyline and duloxetine, the γ-aminobutyric acid analogues gabapentin and pregabalin, opioids and topical agents such as capsaicin. Of these medications, duloxetine and ...
more infohttps://qfrd.pure.elsevier.com/en/publications/treatment-of-painful-diabetic-neuropathy

Find Research Outputs
             - Charles Sturt University Research OutputFind Research Outputs - Charles Sturt University Research Output

Mamun, Q., 01 Jan 2018, International Conference on Applications and Techniques in Cyber Security and Intelligence - Applications and Techniques in Cyber Security and Intelligence. Abawajy, J., Choo, K-K. R. & Islam, R. (eds.). Springer-Verlag London Ltd., Vol. 580. p. 304-314 11 p. (Advances in Intelligent Systems and Computing; vol. 580).. Research output: Book chapter/Published conference paper › Conference paper ...
more infohttps://researchoutput.csu.edu.au/en/publications/?format=&page=8

Robert O Messing, MD - Research Output
     - the Research Networking SystemRobert O Messing, MD - Research Output - the Research Networking System

Earnest, M. P., Norris, J. M., Eberhardt, M. S., Sands, G. H., Adams, D., Brust, J. C., Earnest, M. P., Garver, C. M., Helgason, C. M., Marotta, J. T., Messing, R. O., Rowland, L. P., Sanchez-Ramos, J. R., Sands, G., Snodgrass, S. R., Ziegler, D. K., Whisnant, J. P., Rosenberg, R. & Viste, K., May 31 1996, In : Neurology. 46, 5, p. 1471-1480 10 p.. Research output: Contribution to journal › Review article ...
more infohttps://researchers.dellmed.utexas.edu/en/persons/robert-o-messing/publications/?type=%2Fdk%2Fatira%2Fpure%2Fresearchoutput%2Fresearchoutputtypes%2Fcontributiontojournal%2Fsystematicreview

Lynda Bonewald - Publications
     - Indiana University School of MedicineLynda Bonewald - Publications - Indiana University School of Medicine

Medina-Gomez, C., Kemp, J. P., Dimou, N. L., Kreiner, E., Chesi, A., Zemel, B. S., Bønnelykke, K., Boer, C. G., Ahluwalia, T. S., Bisgaard, H., Evangelou, E., Heppe, D. H. M., Bonewald, L., Gorski, J. P., Ghanbari, M., Demissie, S., Duque, G., Maurano, M. T., Kiel, D. P., Hsu, Y. H. & 14 others, Van Der Eerden, B. C. J., Ackert-Bicknell, C., Reppe, S., Gautvik, K. M., Raastad, T., Karasik, D., Van De Peppel, J., Jaddoe, V. W. V., Uitterlinden, A. G., Tobias, J. H., Grant, S. F. A., Bagos, P. G., Evans, D. M. & Rivadeneira, F., Dec 1 2017, In : Nature Communications. 8, 1, 121.. Research output: Contribution to journal › Article ...
more infohttps://indiana.pure.elsevier.com/en/persons/lynda-bonewald/publications/

Psychiatry - Fingerprint
     - the Research Networking SystemPsychiatry - Fingerprint - the Research Networking System

Fingerprint Dive into the research topics where Psychiatry is active. These topic labels come from the works of this organizations members. Together they form a unique fingerprint. ...
more infohttps://researchers.dellmed.utexas.edu/en/organisations/department-of-psychiatry/fingerprints/

CLAS-NS: Bioenergy and Photosynthesis, Center for (C&BP) - Scholarly Works
     - Arizona State UniversityCLAS-NS: Bioenergy and Photosynthesis, Center for (C&BP) - Scholarly Works - Arizona State University

Peters, J. W., Beratan, D. N., Bothner, B., Dyer, R. B., Harwood, C. S., Heiden, Z. M., Hille, R., Jones, A., King, P. W., Lu, Y., Lubner, C. E., Minteer, S. D., Mulder, D. W., Raugei, S., Schut, G. J., Seefeldt, L. C., Tokmina-Lukaszewska, M., Zadvornyy, O. A., Zhang, P. & Adams, M. WW., Dec 1 2018, In : Current Opinion in Chemical Biology. 47, p. 32-38 7 p.. Research output: Contribution to journal › Review article ...
more infohttps://asu.pure.elsevier.com/en/organisations/clas-ns-bioenergy-and-photosynthesis-center-for-cbp/publications/

Cross-talk between P2X4 and γ-aminobutyric acid, type A receptors determines synaptic efficacy at a central synapse<...Cross-talk between P2X4 and γ-aminobutyric acid, type A receptors determines synaptic efficacy at a central synapse<...

TY - JOUR. T1 - Cross-talk between P2X4 and γ-aminobutyric acid, type A receptors determines synaptic efficacy at a central synapse. AU - Jo, Young-Hwan. AU - Donier, Emmanuelle. AU - Martinez, Audrey. AU - Garret, Maurice. AU - Toulmé, Estelle. AU - Boué-Grabot, Eric. PY - 2011/6/3. Y1 - 2011/6/3. N2 - The essence of neuronal function is to generate outputs in response to synaptic potentials. Synaptic integration at postsynaptic sites determines neuronal outputs in the CNS. Using immunohistochemical and electrophysiological approaches, we first reveal that steroidogenic factor 1 (SF-1) green fluorescent protein (GFP)-positive neurons in the ventromedial nucleus of the hypothalamus express P2X4 subunits that are activated by exogenous ATP. Increased membrane expression of P2X4 channels by using a peptide competing with P2X4 intracellular endocytosis motif enhances neuronal excitability of SF-1 GFP-positive neurons. This increased excitability is inhibited by a P2X receptor antagonist. ...
more infohttps://einstein.pure.elsevier.com/en/publications/cross-talk-between-p2x4-and-%CE%B3-aminobutyric-acid-type-a-receptors--2

College of Medicine - Research Output
     - National Cheng Kung UniversityCollege of Medicine - Research Output - National Cheng Kung University

Tai, S-C., Chen, Z. S., Tsai, W. T., Lin, C. P. & Cheng, L-L., 2013 Jun 28, Advances in Intelligent Systems and Applications - Volume 2: Proceedings of the International Computer. Ruay-Shiung, C., Sheng-Lung, P. & Chia-Chen, L. (eds.). p. 369-376 8 p. (Smart Innovation, Systems and Technologies; vol. 21).. Research output: Chapter in Book/Report/Conference proceeding › Chapter ...
more infohttps://researchoutput.ncku.edu.tw/en/organisations/college-of-medicine/publications/?type=%2Fdk%2Fatira%2Fpure%2Fresearchoutput%2Fresearchoutputtypes%2Fcontributiontobookanthology%2Fchapter

Acyclic Acids (Ethanoic Acids)  < Carboxylic Acids  << Organic Compounds (Organic Chemicals)  <<< Compounds, Elements & more  @...Acyclic Acids (Ethanoic Acids) < Carboxylic Acids << Organic Compounds (Organic Chemicals) <<< Compounds, Elements & more @...

aminobutyrates *GABA (gamma-aminobutyric acid) *pregabalin (3-isobutyl GABA) *vigabatrin *baclofen *Bendamustine Hydrochloride ...
more infohttp://wellnessadvocate.com/?uid=84521

No FAQ available that match "aminobutyrates"