AnatomyDiseasesChemicals and DrugsAnalytical, Diagnostic and Therapeutic Techniques and EquipmentPsychiatry and PsychologyPhenomena and ProcessesTechnology, Industry, AgricultureInformation ScienceGeographicals
Amino AlcoholsEthanolamine Ammonia-LyaseAlcohol DrinkingAmmonia-Lyases1-PropanolStereoisomerismAminationEthanolaminesHydrogenationAlcoholsAminesBoranesAcetaldehydeAldehydesPalladiumCatalysisMolecular StructureOrganophosphorus CompoundsAlcohol DehydrogenaseAmino AcidsAlcoholismPhosphotransferasesEthanolMagnetic Resonance SpectroscopyMolecular ConformationDysprosiumAlkaloidsNuclear Magnetic Resonance, BiomolecularDiaminesAmine Oxidase (Copper-Containing)PeptidomimeticsModels, MolecularPolyanhydridesPlant OilsDipeptidesGlycylglycineManuscripts, Medicalbeta-Alanine-Pyruvate TransaminaseElectrophoresis, CapillaryJapanBenzyl AlcoholBenzyl AlcoholsChinaBenzeneBenzyl CompoundsAzidesCatalogs, LibraryAmino Acids, EssentialFatty LiverLipid MetabolismLiverDietary Supplements
Amino Alcohols
Compounds possessing both a hydroxyl (-OH) and an amino group (-NH2).
Ethanolamine Ammonia-Lyase
An enzyme that catalyzes the deamination of ethanolamine to acetaldehyde. EC 4.3.1.7.
Alcohol Drinking
Behaviors associated with the ingesting of alcoholic beverages, including social drinking.
Ammonia-Lyases
Enzymes that catalyze the formation of a carbon-carbon double bond by the elimination of AMMONIA. EC 4.3.1.
1-Propanol
A colorless liquid made by oxidation of aliphatic hydrocarbons that is used as a solvent and chemical intermediate.
Stereoisomerism
The phenomenon whereby compounds whose molecules have the same number and kind of atoms and the same atomic arrangement, but differ in their spatial relationships. (From McGraw-Hill Dictionary of Scientific and Technical Terms, 5th ed)
Amination
The creation of an amine. It can be produced by the addition of an amino group to an organic compound or reduction of a nitro group.
Ethanolamines
AMINO ALCOHOLS containing the ETHANOLAMINE; (-NH2CH2CHOH) group and its derivatives.
Hydrogenation
Addition of hydrogen to a compound, especially to an unsaturated fat or fatty acid. (From Stedman, 26th ed)
Alcohols
Alkyl compounds containing a hydroxyl group. They are classified according to relation of the carbon atom: primary alcohols, R-CH2OH; secondary alcohols, R2-CHOH; tertiary alcohols, R3-COH. (From Grant & Hackh's Chemical Dictionary, 5th ed)
Amines
A group of compounds derived from ammonia by substituting organic radicals for the hydrogens. (From Grant & Hackh's Chemical Dictionary, 5th ed)
Boranes
The collective name for the boron hydrides, which are analogous to the alkanes and silanes. Numerous boranes are known. Some have high calorific values and are used in high-energy fuels. (From Grant & Hackh's Chemical Dictionary, 5th ed)
Acetaldehyde
A colorless, flammable liquid used in the manufacture of acetic acid, perfumes, and flavors. It is also an intermediate in the metabolism of alcohol. It has a general narcotic action and also causes irritation of mucous membranes. Large doses may cause death from respiratory paralysis.
Aldehydes
Organic compounds containing a carbonyl group in the form -CHO.
Palladium
A chemical element having an atomic weight of 106.4, atomic number of 46, and the symbol Pd. It is a white, ductile metal resembling platinum, and following it in abundance and importance of applications. It is used in dentistry in the form of gold, silver, and copper alloys.
Catalysis
The facilitation of a chemical reaction by material (catalyst) that is not consumed by the reaction.
Molecular Structure
The location of the atoms, groups or ions relative to one another in a molecule, as well as the number, type and location of covalent bonds.
Organophosphorus Compounds
Organic compounds that contain phosphorus as an integral part of the molecule. Included under this heading is broad array of synthetic compounds that are used as PESTICIDES and DRUGS.
Alcohol Dehydrogenase
A zinc-containing enzyme which oxidizes primary and secondary alcohols or hemiacetals in the presence of NAD. In alcoholic fermentation, it catalyzes the final step of reducing an aldehyde to an alcohol in the presence of NADH and hydrogen.
Amino Acids
Organic compounds that generally contain an amino (-NH2) and a carboxyl (-COOH) group. Twenty alpha-amino acids are the subunits which are polymerized to form proteins.
Alcoholism
A primary, chronic disease with genetic, psychosocial, and environmental factors influencing its development and manifestations. The disease is often progressive and fatal. It is characterized by impaired control over drinking, preoccupation with the drug alcohol, use of alcohol despite adverse consequences, and distortions in thinking, most notably denial. Each of these symptoms may be continuous or periodic. (Morse & Flavin for the Joint Commission of the National Council on Alcoholism and Drug Dependence and the American Society of Addiction Medicine to Study the Definition and Criteria for the Diagnosis of Alcoholism: in JAMA 1992;268:1012-4)
Phosphotransferases
A rather large group of enzymes comprising not only those transferring phosphate but also diphosphate, nucleotidyl residues, and others. These have also been subdivided according to the acceptor group. (From Enzyme Nomenclature, 1992) EC 2.7.
Ethanol
A clear, colorless liquid rapidly absorbed from the gastrointestinal tract and distributed throughout the body. It has bactericidal activity and is used often as a topical disinfectant. It is widely used as a solvent and preservative in pharmaceutical preparations as well as serving as the primary ingredient in ALCOHOLIC BEVERAGES.
Magnetic Resonance Spectroscopy
Spectroscopic method of measuring the magnetic moment of elementary particles such as atomic nuclei, protons or electrons. It is employed in clinical applications such as NMR Tomography (MAGNETIC RESONANCE IMAGING).
Molecular Conformation
The characteristic three-dimensional shape of a molecule.
Dysprosium
Dysprosium. An element of the rare earth family that has the atomic symbol Dy, atomic number 66, and atomic weight 162.50. Dysprosium is a silvery metal used primarily in the form of various salts.
Alkaloids
Organic nitrogenous bases. Many alkaloids of medical importance occur in the animal and vegetable kingdoms, and some have been synthesized. (Grant & Hackh's Chemical Dictionary, 5th ed)
Nuclear Magnetic Resonance, Biomolecular
NMR spectroscopy on small- to medium-size biological macromolecules. This is often used for structural investigation of proteins and nucleic acids, and often involves more than one isotope.
Diamines
Organic chemicals which have two amino groups in an aliphatic chain.
Amine Oxidase (Copper-Containing)
A group of enzymes including those oxidizing primary monoamines, diamines, and histamine. They are copper proteins, and, as their action depends on a carbonyl group, they are sensitive to inhibition by semicarbazide.
Peptidomimetics
Compounds that are designed to mimic the 3D structure of a natural peptide or protein.
Models, Molecular
Models used experimentally or theoretically to study molecular shape, electronic properties, or interactions; includes analogous molecules, computer-generated graphics, and mechanical structures.
Polyanhydrides
Anhydride polymers with a repeating structure of RC(=O)OC(=O)R. They readily hydrolyze in water making them useful for DELAYED-ACTION PREPARATIONS.
Plant Oils
Oils derived from plants or plant products.
Dipeptides
Peptides composed of two amino acid units.
Glycylglycine
The simplest of all peptides. It functions as a gamma-glutamyl acceptor.
Manuscripts, Medical
beta-Alanine-Pyruvate Transaminase
A PYRIDOXAL PHOSPHATE containing enzyme that catalyzes the transfer of an amino group from L-ALANINE to 3-oxopropanoate to generate PYRUVATE and BETA-ALANINE.
Electrophoresis, Capillary
A highly-sensitive (in the picomolar range, which is 10,000-fold more sensitive than conventional electrophoresis) and efficient technique that allows separation of PROTEINS; NUCLEIC ACIDS; and CARBOHYDRATES. (Segen, Dictionary of Modern Medicine, 1992)
Japan
Benzyl Alcohol
A colorless liquid with a sharp burning taste and slight odor. It is used as a local anesthetic and to reduce pain associated with LIDOCAINE injection. Also, it is used in the manufacture of other benzyl compounds, as a pharmaceutic aid, and in perfumery and flavoring.
Benzyl Alcohols
Alcohols derived from the aryl radical (C6H5CH2-) and defined by C6H5CHOH. The concept includes derivatives with any substituents on the benzene ring.
China
A country spanning from central Asia to the Pacific Ocean.
Benzene
Toxic, volatile, flammable liquid hydrocarbon byproduct of coal distillation. It is used as an industrial solvent in paints, varnishes, lacquer thinners, gasoline, etc. Benzene causes central nervous system damage acutely and bone marrow damage chronically and is carcinogenic. It was formerly used as parasiticide.
Benzyl Compounds
Azides
Organic or inorganic compounds that contain the -N3 group.
Catalogs, Library
Amino Acids, Essential
Amino acids that are not synthesized by the human body in amounts sufficient to carry out physiological functions. They are obtained from dietary foodstuffs.
Fatty Liver
Lipid infiltration of the hepatic parenchymal cells resulting in a yellow-colored liver. The abnormal lipid accumulation is usually in the form of TRIGLYCERIDES, either as a single large droplet or multiple small droplets. Fatty liver is caused by an imbalance in the metabolism of FATTY ACIDS.
Lipid Metabolism
Physiological processes in biosynthesis (anabolism) and degradation (catabolism) of LIPIDS.
Liver
A large lobed glandular organ in the abdomen of vertebrates that is responsible for detoxification, metabolism, synthesis and storage of various substances.
Dietary Supplements
Products in capsule, tablet or liquid form that provide dietary ingredients, and that are intended to be taken by mouth to increase the intake of nutrients. Dietary supplements can include macronutrients, such as proteins, carbohydrates, and fats; and/or MICRONUTRIENTS, such as VITAMINS; MINERALS; and PHYTOCHEMICALS.

Synthesis and anticonvulsant activity of 1,2-aminoalkanol derivatives. (1/233)

A series of 1,2-aminoalkanol derivatives were prepared and evaluated for anticonvulsant activity in the maximal electroshock seizure (MES) and subcutaneous pentylenetetrazole seizure threshold (scMet) assays and for neurotoxicity (TOX). Most interesting were the anticonvulsant results of S-(+)-2-amino-1-butanol derivative VIII, which displayed anti-MES activity with a protective index (TD50/ED50) of 4.55 corresponding with that for phenytoin, carbamazepine and valproate.  (+info)

Biochemistry and genetics of Klebsiella pneumoniae mutant strains unable to fix N2. (2/233)

Selected mutant strains of Klebsiella pneumoniae that are unable to fix nitrogen have been characterized according to nitrogenase component activity as well as antigenic cross-reacting material. The lesions in these strains have been mapped by transduction, and the results indicate that there are at least five genes specifically responsible for nitrogen fixation in vivo. Besides genes that specify the structure of the two nitrogenase components, there is a gene for a factor that is required for component I activity and a gene that codes for a factor possibly involved in electron transport to component II. A mutation in another site does not allow the organism to produce either of the nitrogenase components. All of these genes are co-transducible with the gene that specifics the structure of histidinol dehydrogenase.  (+info)

Selective production of staplabin and SMTPs in cultures of Stachybotrys microspora fed with precursor amines. (3/233)

Staplabin and SMTPs, a family of triprenyl phenol metabolites of Stachybotrys microspora, enhance fibrinolysis by modulating plasminogen conformation to increase its susceptibility to activation by plasminogen activators. We found that the production of these metabolites were markedly elevated by feeding the microbial culture with an amino acid or an amino alcohol that is a partial molecular constituent of the compound. Thus, the addition of 5-aminovaleric acid, 2-aminoethanol, Ser, Phe, Leu, Trp, Orn and Lys at 100 mg/ml resulted in 7- to 45-fold increases in the production of staplabin, SMTP-1, -3, -4, -5, -6, -7 and -8, respectively. Although the feeding at day 0 to 3 of culture supported the selective production, the supplementation after 5 days had little or no effect. When non-constituent amino acids were supplemented to cultures, production of hitherto uncharacterized congeners was observed.  (+info)

Mefloquine and new related compounds target the F(0) complex of the F(0)F(1) H(+)-ATPase of Streptococcus pneumoniae. (4/233)

The activities of mefloquine (MFL) and related compounds against previously characterized Streptococcus pneumoniae strains carrying defined amino acid substitutions in the c subunit of the F(0)F(1) H(+)-ATPase were studied. In addition, a series of MFL-resistant (Mfl(r)) strains were isolated and characterized. A good correlation was observed between inhibition of growth and inhibition of the membrane-associated F(0)F(1) H(+)-ATPase activity. MFL was about 10-fold more active than optochin and about 200-fold more active than quinine in inhibiting both the growth and the ATPase activities of laboratory pneumococcal strain R6. Mutant strains were inhibited by the different compounds to different degrees, depending on their specific mutations in the c subunit. The resistant strains studied had point mutations that changed amino acid residues in either the c subunit or the a subunit of the F(0) complex. Changes in the c subunit were located in one of the two transmembrane alpha helices: residues M13, G14, G20, M23, and N24 of helix 1 and residues M44, G47, V48, A49, and V57 of helix 2. Changes in the a subunit were also found in either of the transmembrane alpha helices, helix 5 or 6: residue L186 of helix 5 and residues W206, F209, and S214 of helix 6. These results suggest that the transmembrane helices of the c and a subunits interact and that the mutated residues are important for the structure of the F(0) complex and proton translocation.  (+info)

Directed reduction of beta-amino ketones to syn or anti 1,3-amino alcohol derivatives. (5/233)

[reaction: see text] The reduction of beta-amino ketones with samarium(II) iodide has been investigated. Either the syn or anti 1,3-amino alcohols can be obtained as the major product due to a divergence in selectivity with different N-protecting groups.  (+info)

Determination of the absolute configuration of (+)-xestoaminol C [(2S, 3R)-2-amino-3-tetradecanol], a metabolite of Fiji sponge, Xestospongia sp., by the synthesis of its N,O-diacetyl derivative. (6/233)

The N,O-diacetyl derivative of (+)-xestoaminol C (2-amino-3-tetradecanol, 1), an inhibitor of reverse transcriptase isolated from Xestospongia sp., was synthesized from (S)-alanine, and its absolute configuration was determined as 2S, 3R.  (+info)

Stereoselective synthesis of dinucleoside phosphorothioate using enantiopure 1,2-amino alcohols as chiral auxiliaries. (7/233)

Diastereopure nucleoside 3'-cyclic phosphoramidites were synthesized stereoselectively from enantiopure 1,2-amino alcohols. In the presence of a novel activator, these phosphoramidites underwent the condensation with 3'-O-tert-butyldimethylsilylthymidine to give the corresponding phosphite intermediates. Upon sulfurization, followed by deprotection, dithymidine phosphorothioate was obtained in good yield with good to excellent diastereoselectivity.  (+info)

Simple synthesis of mite pheromone beta-acaridial and its analogs in the secretion of Caloglyphus polyphyllae (Acari: Acaridae). (8/233)

A simple synthesis of beta-acaridial [(E)-1], the active principle of the sex, alarm and aggregation pheromone among astigmatid mites, was achieved in 5 steps from 1,2,4-butanetriol 2 in a 19% overall yield. Its analog, beta-acariolal 8, was also prepared in a 63% yield by oxidation of the intermediate, beta-acaridiol [(E)-7], with pyridinium dichromate (PDC). This synthetic route also gave beta-(Z)-acaridiol [(Z)-7] by using a Z-selective base in the Wittig reaction. (Z)-7 was oxidized to give a new monoterpene, beta-(Z)-acaridial [(Z)-1], which was detected as a trace component in the secretion of Caloglyphus polyphyllae, together with 8.  (+info)

Separation of amino alcohols using divalent dipeptides as counter ions in aqueous CESeparation of amino alcohols using divalent dipeptides as counter ions in aqueous CE
Divalent dipeptides have been introduced as counter ions in aqueous CZE. The dipeptides form ion pairs with amino alcohols in the BGE and facilitate the separation of amino alcohols. High concentrations of dipeptide caused reversed effective mobility for the analytes. The net charge of the dipeptide can be controlled using a buffer or a strong base, and regulates the interaction between the dipeptide and the amino alcohol. A stronger interaction and higher selectivity of amino alcohols was observed when the dipeptides were used as divalent counter ions, than in monovalent or uncharged form. Association constants for ion pairs between divalent dipeptides and amino alcohols can be used to enhance selectivity for amino alcohols in CZE. No chiral separation of amino alcohols was observed when using the dipeptides as ion-pairing chiral selectors in aqueous BGE, but addition of methanol to the BGE promoted enantioselectivity.. ...
http://uu.diva-portal.org/smash/record.jsf?pid=diva2:319700
Amidation of triglycerides by amino alcohols and their impact on plant oil-derived polymers - Polymer Chemistry (RSC Publishing)Amidation of triglycerides by amino alcohols and their impact on plant oil-derived polymers - Polymer Chemistry (RSC Publishing)
Amidation of plant oils with amino alcohols was methodologically examined. Twenty one amino alcohols, varying in alcohol substitutions, linkers and amino substitutions, were respectively reacted with high oleic soybean oil. The structural factors of amino alcohols controlled their reactivity in amidation. Wh
https://pubs.rsc.org/en/content/articlelanding/2016/py/c6py00048g
Conformationally restricted diamines and amino alcohols - EnamineConformationally restricted diamines and amino alcohols - Enamine
Diamine units in peptides.. Recently, Enamine has initiated an in-house project focusing on multigram scale syntheses of known and novel conformationally restricted monoprotected diamines and amino alcohols which can be used as molecular scaffolds in rational design of drugs and peptidomimetics bearing two different functional groups in well defined spatial arrangements.. Our minilibrary of monoprotected conformationally restricted cyclic diamines comprises molecules containing 1,2- or 1,3-diamine units adopting anti- configuration. The arrangement of amino groups in these diamines is similar to that in peptide chains of the -sheet secondary structures. High level of preorganization and low conformational mobility are distinguishing characteristics of many bicyclic compounds containing units of 1,2-, 1,3- and 1,4-diamines. The arrangement of amino groups in some molecules is virtually constrained whereas structures of other proposed diamines allow certain rotational degrees of freedom.. A set of ...
https://enamine.net/research/product-focus/125-conformationally-restricted-diamines-and-amino-alcohols
Substrate Controlled Synthesis of 1,2-Amino AlcoholsSubstrate Controlled Synthesis of 1,2-Amino Alcohols
Given the importance of the 1,2-amino alcohol motif the synthetic methods to access them are well developed. This thesis aims to give an overview of possible synthetic strategies in the context of substrate controlled, eg. diastereoselective, synthesis with the emphasis on amino acid derived starting materials. In substrate controlled synthesis the fate of the forming stereocenters is controlled by the existing stereocenters in the molecule as opposed to enantioselective synthesis where chiral information is brought to achiral substrate by the action of an external source of chirality such as chiral catalyst. These strategies include additions to reagents to amino acid derived aldehydes, additions to amino acid derived ketones and oxidation of allyl amine. The total syntheses of 1-deoxyaltronojirimycin and trans-3- hydroxypipecolic acid described here demonstrate the first strategy ...
https://aaltodoc.aalto.fi/handle/123456789/11280
Cyclodextrin-mediated enantioseparation of phenylalanine amide derivatives and amino alcohols by capillary electrophoresis-Role...Cyclodextrin-mediated enantioseparation of phenylalanine amide derivatives and amino alcohols by capillary electrophoresis-Role...
Cyclodextrin-mediated enantioseparation of phenylalanine amide derivatives and amino alcohols by capillary electrophoresis-Role of complexation constants and complex mobilities ...
http://publicatio.bibl.u-szeged.hu/4688/
OPUS 4 | SearchOPUS 4 | Search
This thesis investigates the biocatalytic synthesis of amines and amino alcohols. The applicability and economic feasibility of biocatalysis for chiral amine synthesis is reviewed and the findings were compared to established chemical processes using relevant process parameters (TON, TOF and STY). This review clearly showcases the potential of biocatalysis for the synthesis of chiral amines and provides a valuable guide for synthetic chemists who want to benefit from these new opportunities. Next, biocatalysis is applied for the synthesis of an amino alcohol with two stereocentres: A novel route for the synthesis of all four stereoisomers of 4-amino-1-phenylpentane-2-ol is presented. Enzymes were applied to install both stereocentres successively, which allowed the selective synthesis with high yields and optical purities. A small scale preparative asymmetric transamination yielded one amino alcohol stereoisomer selectively. The approach presented in this thesis provides a valuable option for ...
https://epub.ub.uni-greifswald.de/solrsearch/index/search/searchtype/simple/query/%2A%3A%2A/browsing/true/rows/20/institutefq/Institut+f%C3%BCr+Chemie+und+Biochemie/sortfield/year/sortorder/asc/start/0/subjectfq/Biokatalyse/yearfq/2015/author_facetfq/Kohls%2C+Hannes
Halogenated, Sulphonated, Nitrated Or Nitrosated Derivatives Of Phenols Or Phenol- Alcohols - Derivatives Containing Only...Halogenated, Sulphonated, Nitrated Or Nitrosated Derivatives Of Phenols Or Phenol- Alcohols - Derivatives Containing Only...
Halogenated, Sulphonated, Nitrated Or Nitrosated Derivatives Of Phenols Or Phenol- Alcohols - Derivatives Containing Only Halogen Substituents And Their Salts: Updated Search New Duty Drawback Rates from India Customs of year 2009, 2008, 2007, 2006 and 2005 in single view. Details of Duty Drawback Claim, Refund, Rules and Duty Drawback Scheme.
http://www.eximguru.com/drawback-rates/2908-halogenated-sulphonated-nitrated-or-nitrosated.aspx
Development of a hypersensitive periodate-cleavable amino acid that is methionine- and disulfide-compatible and its application...Development of a hypersensitive periodate-cleavable amino acid that is methionine- and disulfide-compatible and its application...
Incorporation of cleavable linkers into peptides and proteins is of particular value in the study of biological processes. Here we describe the synthesis of a cleavable linker that is hypersensitive to oxidative cleavage as the result of the periodate reactivity of a vicinal amino alcohol moiety. Two strategies directed towards the synthesis of a building block suitable for solid-phase peptide synthesis were developed: a chemoenzymatic route, involving L-threonine aldolase, and an enantioselective chemical route; these led to α,γ-diamino-β-hydroxybutanoic acids in diastereoisomerically mixed and enantiopure forms, respectively. Incorporation of the 1,2-amino alcohol linker into the backbone of a peptide generated a conditional peptide that was rapidly cleaved at very low concentrations of sodium periodate. This cleavable peptide ligand was applied in the generation of MHC exchange reagents for the detection of antigen-specific T cells in peripheral blood cells. The extremely low concentration of
https://pharm.ox.ac.uk/publications/640282
Amino Aldehydes Revisited<...Amino Aldehydes Revisited<...
TY - JOUR. T1 - Amino Aldehydes Revisited. AU - Mestrom, Luuk. AU - Bracco Garcia, M.P.. AU - Hanefeld, Ulf. PY - 2017/12/22. Y1 - 2017/12/22. N2 - The enzymatic oxidation of amino alcohols was studied to address the long-standing problem of product stability. Amino aldehydes, highly sought and unstable compounds, can be generated under mild conditions if they are immediately protected. Utilizing a range of alcohol dehydrogenases (ADHs) and semicarbazide as a scavenger, the enantioselective synthesis of protected amino aldehydes is possible. Glycerol dehydrogenase from Gluconobacter oxydans (GoGDH) displayed excellent enantioselectivity but limited substrate scope, whereas horse liver ADH catalyzed a broad range of conversions with low enantioselectivities.. AB - The enzymatic oxidation of amino alcohols was studied to address the long-standing problem of product stability. Amino aldehydes, highly sought and unstable compounds, can be generated under mild conditions if they are immediately ...
https://research.tudelft.nl/en/publications/amino-aldehydes-revisited
Determination of the relative configuration of vic-amino alcoholsDetermination of the relative configuration of vic-amino alcohols
A large set of syn- and anti-1,2-amino alcohols has been synthesized. Upon comparison of the CHO and CHN H-1 NMR shifts a general trend has been observed, making it possible to determine the relative configuration of 1,2-amino alcohols without derivatization or shift reagents.. ...
http://kth.diva-portal.org/smash/record.jsf?pid=diva2:340921
Année 2006 - Université de Cergy-PontoiseAnnée 2006 - Université de Cergy-Pontoise
1. Concise synthesis of enantiopure alfa-trifluoromethyl alanines, diamines and amino alcohols via the Strecker-type reaction, Huguenot, F. ; Brigaud, T. J. Org. Chem. 2006, 71, 7075-7078. 2. Straightforward synthesis of (S)- and (R)-alfa-trifluoromethyl proline from chiral oxazolidines derived from ethyl trifluoropyruvate, Chaume, G., Van Severen, M.-C., Marinkovic, S. ; Brigaud, T. Org. Lett. 2006, 8, 6123-6126. 3. Convenient asymmetric synthesis of beta-trifluoromethyl-beta-amino acid, beta-amino ketones and gama-amino alcohols via Reformatsky and Mannich type reactions from 2-trifluoromethyl-1,3-oxazolidines, Huguenot, F. ; Brigaud, T. J. Org. Chem. 2006, 71, 2159-2162. 4. Chiral 2-trifluoromethyl-4-phenyloxazolidine : A novel highly performing chiral auxiliary for amides alkylation, Tessier, A. ; Pytkowicz, J. ; Brigaud, T. Angew. Chem. Int. Ed. Engl. 2006, 45, 3677-3681. 5. Gram-Scale Preparation of a p-(C-Glucopyranosyl)-L-phenylalanine Derivative by a Negishi Cross-Coupling Reaction, ...
https://www.u-cergy.fr/fr/laboratoires/lcb/publications/annee-2006.html
Leicester Research Archive: Some photochemical reactions of aromatic hydrocarbons and related compounds.Leicester Research Archive: Some photochemical reactions of aromatic hydrocarbons and related compounds.
The photophysical and photochemical properties of aromatic hydrocarbons have been reviewed. Aromatic hydrocarbons were photoreduced upon irradiation in the presence of amines, and also photosensitized the decarboxylation of amino acids. Product and kinetic studies have shown that both these reactions involve the same initial step, i.e. transfer of an electron from the amino function to the first excited singlet state of the aromatic hydrocarbon. Products obtained from the decarboxylation of amino acids photosensitized by dyes and aromatic carbonyl and aza-aromatic compounds were identical with those obtained from the decarboxylations sensitized by aromatic hydrocarbons. The mechanism for photodecarboxylation by all these sensitizers was proposed to be the same. Amino alcohols quench the fluorescence of aromatic hydrocarbons less efficiently than do amines. This inefficiency has been attributed to hydrogen bonding between the hydroxylic proton and the nitrogen atom of the amino alcohol. Two ...
https://lra.le.ac.uk/handle/2381/34029
Enantiomeric Separation of Chiral Amines and Amino Alcohols Using Acetylated β-Cyclodextrin Stationary Phase by High...Enantiomeric Separation of Chiral Amines and Amino Alcohols Using Acetylated β-Cyclodextrin Stationary Phase by High...
Japans largest platform for academic e-journals: J-STAGE is a full text database for reviewed academic papers published by Japanese societies
https://www.jstage.jst.go.jp/article/jpchrom/37/2/37_2015.036/_article
CCCC 1984, Volume 49, Issue 8, Abstracts pp. 1816-1826 | Collection of Czechoslovak Chemical CommunicationsCCCC 1984, Volume 49, Issue 8, Abstracts pp. 1816-1826 | Collection of Czechoslovak Chemical Communications
Substitution reactions of (E)-11-(3-bromopropylidene)-6,11-dihydrodibenzo[b,e]thiepin (VIIIa) and its 2-chloro derivative VIIIb with 1-(2-hydroxyethyl)piperazine gave the title compounds IIIa and IIIb which afforded by treatment with acetic anhydride, decanoyl chloride and 3,4,5-trimethoxybenzoyl chloride the esters IVab-VIab. Reduction of the olefinic compounds IIIa and IIIb with hydrolytic acid resulted in the saturated amines IXa and IXb. The piperazine derivativeX was obtained by a substitution reaction of 2,11-dichloro-6,11-dihydrobenzo[b,e]thiepin with 1-(2-hydroxyethyl)piperazine. The amino alcohols IIIa and IIIb, as well as their acetates and 3,4,5-trimethoxybenzoates, are almost devoid of the CNS effects. The decanates Va and Vb have not the properties of the depot antipsychotics (neither antidepressants, nor neuroleptics). The saturated amino alcohol IXa showed some antihistamine, spasmolytic and adrenolytic effects.. ...
http://cccc.uochb.cas.cz/49/8/1816/
N-Heterocyclic carbene-catalyzed amidation of unactivated esters with amino alcohols (RSC Publishing)N-Heterocyclic carbene-catalyzed amidation of unactivated esters with amino alcohols (RSC Publishing)
You do not have JavaScript enabled. Please enable JavaScript to access the full features of the site or access our non-JavaScript page. ...
http://pubs.rsc.org/en/content/database/CCR0508009004
IDEALS @ Illinois: Enantioenriched Homoaldol Products, Beta-Substituted Ketones, Isoxazolines, and Beta-Lactams Through...IDEALS @ Illinois: Enantioenriched Homoaldol Products, Beta-Substituted Ketones, Isoxazolines, and Beta-Lactams Through...
A stereocontrolled intramolecular nitrone/olefin dipolar cycloaddition reaction of enantioenriched enals provides cyclopentyl isoxazoline products in 64--81% yields and with diastereomeric ratios of 78:22 to 84:16. An isoxazoline was converted into an enantiomerically pure beta-lactam via a beta-amino alcohol and a beta-amino acid in six synthetic steps in 25% overall yield ...
https://www.ideals.illinois.edu/handle/2142/84092
Synthesis of Aminoalcohol and Oxazolidone Chiral Stationary Phases for High-Performance Liquid Chromatography | SpringerLinkSynthesis of Aminoalcohol and Oxazolidone Chiral Stationary Phases for High-Performance Liquid Chromatography | SpringerLink
Several examples of a new family of chiral stationary phases (CSPs) have been prepared by treatment of silica gel with asymmetric optically active organosilanes derived from the reactions between...
https://link.springer.com/chapter/10.1007/978-1-4684-8282-9_11
Novel ureidoamides derived from amino acids: synthesis and preliminary biological screening | Repozitorij Farmaceutsko...Novel ureidoamides derived from amino acids: synthesis and preliminary biological screening | Repozitorij Farmaceutsko...
A series of novel amino acid ureidoamides 4a-o were prepared from N-(1-benzotriazolecarbonyl)- amino acid chloride 3, derived from L-alanine, L-valine, L-leucine, D-phenylglycine and L-phenylalanine, and the corresponding aminoalcohols (2-amino-1-ethanol, 3-amino-1-propanol and 5-amino-1-pentanol). The compounds were fully characterized by standard spectroscopic methods (IR, 1H and 13C NMR) and their structure was confirmed by elemental analysis. Antioxidant screenings (interaction with 1,1-diphenyl-2-picrylhydrazyl, soybean lipoxygenase inhibition activity, inhibition of linoleic acid lipid peroxidation) revealed that the prepared compounds possessed only modest activity. On the other hand, no significant antiproliferative activity against five human cell lines and very weak antimicrobial activity against several bacteria and fungi were detected ...
https://repozitorij.pharma.unizg.hr/islandora/object/pharma%3A790
Novel ureidoamides derived from amino acids: synthesis and preliminary biological screening | Repository of Faculty of Pharmacy...Novel ureidoamides derived from amino acids: synthesis and preliminary biological screening | Repository of Faculty of Pharmacy...
A series of novel amino acid ureidoamides 4a-o were prepared from N-(1-benzotriazolecarbonyl)- amino acid chloride 3, derived from L-alanine, L-valine, L-leucine, D-phenylglycine and L-phenylalanine, and the corresponding aminoalcohols (2-amino-1-ethanol, 3-amino-1-propanol and 5-amino-1-pentanol). The compounds were fully characterized by standard spectroscopic methods (IR, 1H and 13C NMR) and their structure was confirmed by elemental analysis. Antioxidant screenings (interaction with 1,1-diphenyl-2-picrylhydrazyl, soybean lipoxygenase inhibition activity, inhibition of linoleic acid lipid peroxidation) revealed that the prepared compounds possessed only modest activity. On the other hand, no significant antiproliferative activity against five human cell lines and very weak antimicrobial activity against several bacteria and fungi were detected ...
https://repozitorij.pharma.unizg.hr/en/islandora/object/pharma%3A790
Bufylline - DrugBankBufylline - DrugBank
This compound belongs to the class of organic compounds known as 1,2-aminoalcohols. These are organic compounds containing an alkyl chain with an amine group bound to the C1 atom and an alcohol group bound to the C2 atom ...
https://go.drugbank.com/drugs/DB13812
Catalytic Liquid Organic Hydrogen Carrier (LOHC) system | Yeda Research and Development Company Ltd.Catalytic Liquid Organic Hydrogen Carrier (LOHC) system | Yeda Research and Development Company Ltd.
Applications High potential hydrogen storage capacity (6.6 wt%) Inexpensive and readily available hydrogen carriers (aminoalcohols) Relatively mild release and regeneration conditionsAdvantages
http://yedarnd.com/technologies/catalytic-liquid-organic-hydrogen-carrier-lohc-system
Food for thought and health.: Lipid BiochemistryFood for thought and health.: Lipid Biochemistry
Fatty acids with 16 and l8-carbon chains can participate in the manufacture of phospholipids which are the main structural components of cell membranes. Phospholipids are similar to triglycerides in that fatty acid molecules are attached to a glycerol molecule, a three carbon alcohol (or, less commonly, sphingosine, a more complex amino alcohol). In triglycerides, all three esterifiable positions on a glycerol molecule are occupied by a fatty acid. In a phospholipids, only two are so occupied and the third is esterified to phosphoric acid which may have in turn other compounds attached to it such as choline, serine, glycerol, inositol or ethanolamine. Lecithin, the best known phospholipids, has choline attached to the phosphate and is thus termed phosphatidylcholine. If phosphoric acid alone is attached, the compound is called a phosphotidate. Many molecular variations are also possible by mixing various fatty acids on the glycerol backbone. (Fig. 6 ...
http://food-for-thought-and-health.blogspot.com/2007/10/lipid-biochemistry.html
Introducing alkyl substituent into the piperidine core goes multigram - Blog - EnamineIntroducing alkyl substituent into the piperidine core goes multigram - Blog - Enamine
Enamines EurJOC paper on the scalable and regioselective preparation of all isomeric (cyclo)alkyl piperidines and the corresponding amino alcohols was featured on the cover of the issue. The multigram quantities of these derivatives are available fr
https://enamine.net/blog/introducing-alkyl-substituent-into-the-piperidine-core-goes-multigram
sphingosine - definition and meaningsphingosine - definition and meaning
sphingosine: A basic, long-chain, unsaturated amino alcohol, C18H37NO2, found combined with lipids in the brain and in nerve tissue.
https://www.wordnik.com/words/sphingosine
Molbank | Free Full-Text | 1-{[Benzyl-(2-cyano-ethyl)-amino]-methyl}-5-methyl-1H-pyrazole-3-carboxylic acid ethyl esterMolbank | Free Full-Text | 1-{[Benzyl-(2-cyano-ethyl)-amino]-methyl}-5-methyl-1H-pyrazole-3-carboxylic acid ethyl ester
The products of aza-type Michael addition, i.e., β-amino carbonyl compounds and their derivatives, are often used as peptide analogs or precursors of optically active amino acids, amino alcohols, diamines, and lactams [1].[...]
http://www.mdpi.com/1422-8599/2006/5/M494
Three-Component Reaction of 1-(Oxyran-2-ylmethyl)-1 H -indole-3-carbaldehyde with CH-Acids and Amines | SpringerLinkThree-Component Reaction of 1-(Oxyran-2-ylmethyl)-1 H -indole-3-carbaldehyde with CH-Acids and Amines | SpringerLink
One-pot synthesis of 3-vinyl substituted indoles containing 1,2-amino alcohol fragment at the nitrogen atom was performed by the reactions of 1-(oxiran-2-y
https://rd.springer.com/article/10.1134/S1070363220040027?error=cookies_not_supported&code=a0a346e1-e85d-4c52-9e14-bf2cda0dd802
Angus Chemical to Present at in-cosmetics GlobalAngus Chemical to Present at in-cosmetics Global
The company will present four novel formulation kits at in-cosmetics Global utilizing its Ultra PC amino alcohols, including the new DMAMP Ultra PC.
https://www.cosmeticsandtoiletries.com/networking/eventcoverage/Angus-Chemical-to-Present-at-in-cosmetics-Global-479643703.html
Methyl bis[4-(benzyloxy)phenyl](hydroxy)acetate | C29H26O5 - PubChemMethyl bis[4-(benzyloxy)phenyl](hydroxy)acetate | C29H26O5 - PubChem
Methyl bis[4-(benzyloxy)phenyl](hydroxy)acetate | C29H26O5 | CID 564122 - structure, chemical names, physical and chemical properties, classification, patents, literature, biological activities, safety/hazards/toxicity information, supplier lists, and more.
https://pubchem.ncbi.nlm.nih.gov/compound/564122
TRC | Details of CAS = 58457-98-0, ChemicalName = Methyl 2-(S)-[N-[(Benzyloxy)carbonyl]amino-3-[N-[t-butyloxycarbonyl)amino]...TRC | Details of CAS = 58457-98-0, ChemicalName = Methyl 2-(S)-[N-[(Benzyloxy)carbonyl]amino-3-[N-[t-butyloxycarbonyl)amino]...
Buy high quality Methyl 2-(S)-[N-[(Benzyloxy)carbonyl]amino-3-[N-[t-butyloxycarbonyl)amino]-propionate 58457-98-0 from toronto research chemicals Inc.
https://www.trc-canada.com/product-detail/?M292725
N-{[2-(Benzyloxy)-1-naphthyl]methyl}-N-(1-propyl-1H-tetraazol-5-yl)amine | C22H23N5O - PubChemN-{[2-(Benzyloxy)-1-naphthyl]methyl}-N-(1-propyl-1H-tetraazol-5-yl)amine | C22H23N5O - PubChem
N-{[2-(Benzyloxy)-1-naphthyl]methyl}-N-(1-propyl-1H-tetraazol-5-yl)amine | C22H23N5O | CID 4122115 - structure, chemical names, physical and chemical properties, classification, patents, literature, biological activities, safety/hazards/toxicity information, supplier lists, and more.
https://pubchem.ncbi.nlm.nih.gov/compound/4122115
1-[4-(benzyloxy)-3-methoxybenzoyl]-4-[2-(pyrrolidin-1-yl)ethyl]piperazine hydrochloride, get quote1-[4-(benzyloxy)-3-methoxybenzoyl]-4-[2-(pyrrolidin-1-yl)ethyl]piperazine hydrochloride, get quote
Chemical structure of 1-[4-(benzyloxy)-3-methoxybenzoyl]-4-[2-(pyrrolidin-1-yl)ethyl]piperazine hydrochloride. See its properties and synonyms.
https://www.molport.com/shop/moleculelink/HOMFREIIOXQHNZ-UHFFFAOYSA-N/5610483
4-(benzyloxy)-2,6-diamino-5-nitropyrimidine Summary Report | CureHunter4-(benzyloxy)-2,6-diamino-5-nitropyrimidine Summary Report | CureHunter
4-(benzyloxy)-2,6-diamino-5-nitropyrimidine: a pyrimidine derivative that inhibit human O(6)-alkylguanine-DNA alkyltransferase (AGAT); structure in first source
http://www.curehunter.com/public/keywordSummaryC110781-4--benzyloxy--2-6-diamino-5-nitropyrimidine.do
SELECTBIO - Flow Chemistry Asia AgendaSELECTBIO - Flow Chemistry Asia Agenda
A robust self-supported chiral heterogeneous catalyst was synthesized from readily available titanium alkoxide and chiral aminoalcohol ligands. The extreme stability and recyclability of the catalyst enabled us to carry out the cyanation under continuous flow. The complete optimization and advantage of flow methods in improving the enantioselectivity of alphatic branched aldehydes will be presented. ...
http://selectbiosciences.com/conferences/Agenda.aspx?conf=fca2012
PQR | 1-[(4s)-4-{[(benzyloxy)carbonyl]amino}-4-carboxybutanoyl]-2-indolinecarboxylic acidPQR | 1-[(4s)-4-{[(benzyloxy)carbonyl]amino}-4-carboxybutanoyl]-2-indolinecarboxylic acid
You are viewing an interactive 3D depiction of the molecule 1-[(4s)-4-{[(benzyloxy)carbonyl]amino}-4-carboxybutanoyl]-2-indolinecarboxylic acid (C22H22N2O7) from the PQR.
http://pqr.pitt.edu/mol/QGHAKHPDYFMTMY-WMZOPIPTSA-N
3-(Benzyloxy)-2-thiophenecarbohydrazide | SCBT - Santa Cruz Biotechnology3-(Benzyloxy)-2-thiophenecarbohydrazide | SCBT - Santa Cruz Biotechnology
Buy 3-(Benzyloxy)-2-thiophenecarbohydrazide, a specialty product for proteomics research, from Santa Cruz. Molecular Formula: C12H12N2O2S, MW: 248.30
https://www.scbt.com/p/3-benzyloxy-2-thiophenecarbohydrazide
PQR | 1-[(benzyloxy)carbonyl]-l-prolyl-d-leucinePQR | 1-[(benzyloxy)carbonyl]-l-prolyl-d-leucine
You are viewing an interactive 3D depiction of the molecule 1-[(benzyloxy)carbonyl]-l-prolyl-d-leucine (C19H26N2O5) from the PQR.
http://pqr.pitt.edu/mol/YCYXUKRYYSXSLJ-CVEARBPZSA-N
3-(Benzyloxy)-4-nitrobenzenecarbohydrazide | SCBT - Santa Cruz Biotechnology3-(Benzyloxy)-4-nitrobenzenecarbohydrazide | SCBT - Santa Cruz Biotechnology
Buy 3-(Benzyloxy)-4-nitrobenzenecarbohydrazide, a biochemical for proteomics research, from Santa Cruz. Molecular Formula: C14H13N3O4, MW: 287.27
https://www.scbt.com/ko/p/3-benzyloxy-4-nitrobenzenecarbohydrazide
1S,2R)-2-((benzyloxy)carbonyl)cyclobutane-1-carboxylic acid1S,2R)-2-((benzyloxy)carbonyl)cyclobutane-1-carboxylic acid
(+/-) (1S,2R)-2-((benzyloxy)carbonyl)cyclobutane-1-carboxylic acid |p|SPC Code: SPC-a381|/p||p|CAS RN: 92828-74-5|/p||p|Smiles: O=C(O)[[email protected]]1CC[[email protected]]1C(=O)OCc1ccccc1|/p||p|Formula: C13H14O4|/p||p|Purity: 95|/p|
https://spirochem.com/catalog/1s-2r-2-benzyloxy-carbonyl-cyclobutane-1-carboxylic-acid.html
CLOBUTINOL - UKCLOBUTINOL - UK
Genomic Medicine UK is the home of comprehensive genomic testing in Harley Street in London. Our medical doctors and consultants work tirelessly to provide the best possible standards of testing and screening for genes that may cause cancers or diseases at an affordable cost. We use all available medical, diagnostic, and laboratory technology to provide our patients with a reliable evidence-based and thorough service ...
https://genomicmedicineuk.com/product/clobutinol/
3,7-dihydro-1,3-dimethyl-1H-purine-2,6-dione, compound with 1-aminopropan-2-ol (1:1), Sell 3,7-dihydro-1,3-dimethyl-1H-purine-2...3,7-dihydro-1,3-dimethyl-1H-purine-2,6-dione, compound with 1-aminopropan-2-ol (1:1), Sell 3,7-dihydro-1,3-dimethyl-1H-purine-2...
Trade leads from 3,7-dihydro-1,3-dimethyl-1H-purine-2,6-dione, compound with 1-aminopropan-2-ol (1:1) exporters and 3,7-dihydro-1,3-dimethyl-1H-purine-2,6-dione, compound with 1-aminopropan-2-ol (1:1) suppliers provided by ChemNet.com
http://www.chemnet.com/Offer-to-Sell/search.cgi?terms=3,7-dihydro-1,3-dimethyl-1H-purine-2,6-dione,%20compound%20with%201-aminopropan-2-ol%20
NWMN 1614 - AureoWikiNWMN 1614 - AureoWiki
CarbohydratesSugar alcoholsGlycerol and Glycerol-3-phosphate Uptake and Utilization Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46) ...
http://aureowiki.med.uni-greifswald.de/NWMN_1614
EMBL: CP001115.PE172EMBL: CP001115.PE172
CP001115.PE172 Location/Qualifiers FT CDS complement(226823..227560) FT /codon_start=1 FT /transl_table=11 FT /locus_tag=Deide_1p01284 FT /product=putative glycerophosphoryl diester FT phosphodiesterase FT /db_xref=EnsemblGenomes-Gn:Deide_1p01284 FT /db_xref=EnsemblGenomes-Tr:ACO47569 FT /db_xref=GOA:C1D2D0 FT /db_xref=InterPro:IPR017946 FT /db_xref=InterPro:IPR030395 FT /db_xref=UniProtKB/TrEMBL:C1D2D0 FT /protein_id=ACO47569.1 FT /translation=MSMIIGHRGSRHLWPENTLEGFGQLVNSGVEGVEFDVHLTADDQV FT IVIHDATLERTTHSSGPVRTRTLSELQSLRLRDSVEGLPSLEQVLEVFQNSALELHIEL FT KTDSTGQPYPGLEAQVIGTIAQFGLQQRSVLTSFNHEVLQKVRHLDSSARVLRSVDHST FT LAQAGGFKQAMIQLEALPDLLVAVEQSLLKETLQQFSARFGADRLGVWVVNHDADLRYW FT FRQHLRQITTDRVDLALQSRART MSMIIGHRGS RHLWPENTLE GFGQLVNSGV EGVEFDVHLT ADDQVIVIHD ATLERTTHSS 60 GPVRTRTLSE LQSLRLRDSV EGLPSLEQVL EVFQNSALEL HIELKTDSTG QPYPGLEAQV 120 IGTIAQFGLQ QRSVLTSFNH EVLQKVRHLD SSARVLRSVD HSTLAQAGGF KQAMIQLEAL 180 PDLLVAVEQS LLKETLQQFS ARFGADRLGV WVVNHDADLR YWFRQHLRQI TTDRVDLALQ 240 ...
http://pbil.univ-lyon1.fr/cgi-bin/acnuc-search-pe?query=CP001115.PE172&db=EMBL&ident=ACNUC7421
Raffaele Altara | Institute for Experimental Medical Research (IEMR)Raffaele Altara | Institute for Experimental Medical Research (IEMR)
Frisk M, Le C, Shen X, Røe ÅT, Hou Y, Manfra O, Silva GJJ, van Hout I, Norden ES, Aronsen JM, Laasmaa M, Espe EKS, Zouein FA, Lambert RR, Dahl CP, Sjaastad I, Lunde IG, Coffey S, Cataliotti A, Gullestad L, Tønnessen T, Jones PP, Altara R, Louch WE (2021 ...
https://iemr.no/about/staff/raffaele-altara/
Publications | Institute for Experimental Medical Research (IEMR)Publications | Institute for Experimental Medical Research (IEMR)
Tazmini K, Frisk M, Lewalle A, Laasmaa M, Morotti S, Lipsett DB, Manfra O, Skogestad J, Aronsen JM, Sejersted OM, Sjaastad I, Edwards AG, Grandi E, Niederer SA, Øie E, Louch WE (2020 ...
https://iemr.no/publications/?offset=5
Z-L-Gln-OSu - Creative PeptidesZ-L-Gln-OSu - Creative Peptides
Z-Gln-OSu;34078-85-8;AmbotzZAA1219;Z-L-Gln-OSu;SCHEMBL16385082;CTK8G3859;MolPort-008-269-456;C17H19N3O7;4054AB;ZINC71788219;AKOS016003264;AK-81324;KB-281504;ST24031989;2,5-Dioxo-1-pyrrolidinylN~2~-[(benzyloxy)carbonyl]-L-glutaminate;[(S)-4-Amino-1-[[(2,5-dioxo-1-pyrrolidinyl)oxy]carbonyl]-4-oxobutyl] ...
https://www.creative-peptides.com/product/z-l-gln-osu-item-cp25779-28941.html
Dr. Ronald Anglade with Georgia Urology - The Weekly Check-UpDr. Ronald Anglade with Georgia Urology - The Weekly Check-Up
Dr. Ronald Anglade is a native of New York. He received his undergraduate degree from Brown University, Providence, RI. He then returned to New York and received his medical degree from the State University of New York Health Science Center at Brooklyn (Downstate Medical Center).. He completed a residency in surgery and urology at the Boston University School of Medicine. He stayed on in Boston as faculty and received additional training by Dr. Irwin Goldstein, one of the worlds experts in sexual dysfunction. He also completed a postgraduate fellowship in male infertility and microsurgery.. His research interests include genetic causes of male infertility. He served as a visiting scientist in the lab of Dr. David Page at the MIT/Whitehead Institute for Biomedical Research in Cambridge, Massachusetts. The focus of his work included the impact of Y chromosome microdeletions on normal sperm production.. He is currently on staff at Emory Eastside Medical Center, Gwinnett Medical Center, Northside ...
https://weeklycheckup.com/2017/03/26/dr-ronald-anglade-with-georgia-urology/
The effect of bacterial flagellin on virus infection - eTheses RepositoryThe effect of bacterial flagellin on virus infection - eTheses Repository
Coinfection with bacteria and viruses is an understudied area of microbiology, despite its potential to modulate pathogen abundance and host survival. We investigated the effect of bacteria on virus infection and developed an \(in\) \(vitro\) system to study the first step: viral internalization. Our studies show that multiple bacterial species promote the entry of a diverse panel of viruses into lung and gut epithelial cells. Bacteria expressing the toll-like receptor (TLR)5 agonist, flagellin, are most efficient at inducing viral uptake and studies using recombinant flagellin or aflagellate bacterial strains confirm that flagellin has pro-viral activity. Flagellin promotes epithelial cells to support virus entry via TLR5-dependent activation of NF-KB. To extend these observations and study the role of flagellin in the complete viral replicative lifecycle, we studied human immunodeficiency virus (HIV)-1 replication in T cells. Flagellin augments HIV-1 entry and promoter activity and increases ...
http://etheses.bham.ac.uk/7327/
Plus itPlus it
This report is the first to detail the effects of clobutinol, a commonly used antitussive drug, on the HERG cardiac K+ channel. The rhythmic incident correlated to clobutinol in-take in the proband revealed the potential effects of the drug and instigated the present study, which also resulted in the identification of a novel HERG mutation responsible for LQT2.. Drug-Induced Action Potential Prolongation. We found that clobutinol displays an IC50 of ≈2 μM on HERG. As illustrated by computer modeling, clobutinol would induce only mild modifications in the ventricular action potential duration of unaffected individuals. The effects of clobutinol displayed a positive voltage dependence, suggesting that the molecule interacts with an activated state of the HERG channel. Drugs that block HERG current, are often associated with QT prolongation and development of the ventricular arrhythmia known as torsades de pointes. Among them are terfenadine, astemizole, and cisapride. Published IC50 values ...
http://molpharm.aspetjournals.org/content/66/5/1093
The Chemist | Journal of the American Institute of ChemistsThe Chemist | Journal of the American Institute of Chemists
Introduction Benzyl alcohol derivatives are found in natural products and play a central role in numerous mechanistic investigations [1]. Aminobenzyl alcohols are useful as antimicrobial agents [2] and herbicides [3]. 3-Aminobenzyl alcohol is used to synthesize gamma-L-glutamyl-4-nitroanilide derivative to determine γ-GTP (gamma-glutamyltranspeptides) in serum [4]. A hit-to-lead optimization program on dichlorobenzyl derivative discovers pyrimidine-5-carbonitrile-6-cyclopropyl as a functional antagonist of the human CXCR2 receptor and shows good oral bioavailability in the rat [5]. Alcohols are used in topical ophthalmic pharmaceuticals and are useful against cataracts [6]. In spite of these numerous applications and consequent interest in their qualitative and quantitative characterization, the vibrational spectra of benzyl alcohol derivative provide a deeper insight into their biological actions when they are administered as drugs and in the environment as herbicides. Several author groups ...
http://www.theaic.org/pub_thechemist_journals/Vol-89-No-1/Vol-89-No1-Article-2.html
Enantiopure - definition of Enantiopure by The Free DictionaryEnantiopure - definition of Enantiopure by The Free Dictionary
Define Enantiopure. Enantiopure synonyms, Enantiopure pronunciation, Enantiopure translation, English dictionary definition of Enantiopure. n. Either of a pair of molecules that are mirror images but cannot be superimposed on each other, and that rotate the plane of polarized light by an equal...
https://www.thefreedictionary.com/Enantiopure
Estimation on autocatalytic reaction on ethanolamine -A green approachEstimation on autocatalytic reaction on ethanolamine -A green approach
In recent years, ethanolamine is not only used to be an important major material of organic chemicals but also the most valued product among amino alcohols. However, ethanolamine might catch fire automatically when ethanolamine mixed with peroxide or nitrocellulose due to its thermal instability and high sensitivity to thermal sources. Moreover, runaway reactions happened on the process of ethanolamine will bring with severe damage to equipment, people, and environmental impact. Therefore, it is necessary to provide safety information regarding the decomposed mechanism and thermal hazard characteristics by using thermal analysis technology. As a green approach, the aim of this study is to obtain thermal safety parameters, such as apparent exothermic onset temperature, maximum temperature, heat of decomposition, self-heating rate, pressure rise rate, maximum pressure, by vent sizing package 2. The results will be used effectively to calculate the optimal parameters for process safer design and establish
https://www.techconnect.org/proceedings/paper.html?volume=TCB2015v2&chapter=9&paper=1189
Highly Diastereo- and Enantioselective Cascade Synthesis of Bicyclic Lactams in One-PotHighly Diastereo- and Enantioselective Cascade Synthesis of Bicyclic Lactams in One-Pot
A versatile and highly stereoselective synthetic route to functionalized bi- and tricyclic lactams (up to , 20:1 dr and 99% ee) in one pot from simple starting materials (allylic alcohols, enals, diamines and amino alcohols) using cascade transformations promoted by chiral amine/BrOnsted or metal/chiral amine/BrOnsted relay catalysis is disclosed. Here molecular oxygen is employed as the terminal oxidant for the latter relay catalysis approach.. ...
http://www.diva-portal.org/smash/record.jsf?pid=diva2:1198692
A new class of bis-oxazoline ligands for the Cu-catalysed asymmetric cyclopropanation of olefinsA new class of bis-oxazoline ligands for the Cu-catalysed asymmetric cyclopropanation of olefins
A set of new chiral bis-oxazolines, 5a-b and 6a-c, has been synthesised from D and L-diethyl 2,3-O-isopropylidene tartrates and chiral amino alcohols. These ligands were found to be efficient in the Cu(I)-catalysed asymmetric cyclopropanation of olefins.. ...
http://uu.diva-portal.org/smash/record.jsf?pid=diva2:97731
Products | ChiralblockProducts | Chiralblock
Cas Index,Name Index,α-Amino Acids,β-Amino Acids,Cyclic β-amino Acids,α-hydroxy Acids,β-Hydroxy Acids,Chiral Amines,Chiral Alcohols,Chiral Amino Alcohols,Chiral Pyrrolidines,Succinates,Chiral Compounds,Chiral Ligands,Chiral Catalyst,Others,,Chiralblock
http://www.chiralblock.com/sitemapnameDlist9.html
Didier Bourissou, Plaisance Du Touch FR - Patent applicationsDidier Bourissou, Plaisance Du Touch FR - Patent applications
METHOD FOR PREPARING STAR POLYMERS - The invention relates to a method for preparing linear polymers having an amide end or having a star architecture comprising an amide core, by means of a ring opening using lactide and glycolide monomers or a lactide monomer ring in the presence of a catalyst, wherein the method includes the steps of: (i) reacting the excess monomer(s) with an initiator in a solvent, said initiator being selected from among an amine and an amino alcohol, given that the initiator has at least one primary or secondary amine function; (ii) adding a catalyst, said catalyst being a non-nucleophilic base and including at least one neutral sp2 nitrogen atom; and (iii) neutralizing the reaction mixture. Said novel method is particularly advantageous in that it can be easily monitored and enables better modulation of the polymers, and thus of the properties thereof, than the methods of the prior art. The invention also relates to novel polymers that are obtainable by means of said ...
http://www.patentsencyclopedia.com/inventor/didier-bourissou-plaisance-du-touch-fr-1/
PUBLICATION | Systems Biotechnology Research Group (SyBiRG)PUBLICATION | Systems Biotechnology Research Group (SyBiRG)
Google Scholar Citations to the following publications. 35) Kim S, Kim Y, Suh DH, Lee CH, Yoo SM, Lee SY, and Yoon SH Heat-responsive and time-resolved transcriptome and metabolome analyses of Escherichia coli uncover thermo-tolerant mechanisms Scientific Reports 10(1):17715 (2020.10.19). 34) Kim H, Kim S, Kim D, and Yoon SH A single amino acid substitution in aromatic hydroxylase (HpaB) of Escherichia coli alters substrate specificity of the structural isomers of hydroxyphenylacetate BMC Microbiology 20:109 (2020.05.06). 33) Sarak S, Jeon H, Patil MD, Khobragade TP, Pagar AD, Sung S, Yoo H-W, Kim B-G, Yoon SH, and Yun H Enzymatic synthesis of aliphatic primary ω-amino alcohols from ω-amino fatty acids by carboxylic acid reductase Catalysis Letters 150:3079-3085 (2020.04.25) 32) Kim E-Y, Ashlock D, and Yoon SH Identification of critical connectors in the directed reaction-centric graphs of microbial metabolic networks BMC Bioinformatics 20:328 (2019.06). 31) Kim S, Kim Y, and Yoon SH ...
http://sybirg.re.kr/content/publication
Al/Hg Reduction of Nitroalcohols Promoted by Ultrasound - [www.rhodium.ws]Al/Hg Reduction of Nitroalcohols Promoted by Ultrasound - [www.rhodium.ws]
During a US-promoted Al/Hg reduction a highly reactive microdispersion is generated by shock wave-induced primary fragmentation together with the mass transport between the amalgam panicles and the solution of the substrate being increased by cavitation-induced turbulent flow7. As a result of applying the US-promoted Al/Hg method to 2-nitroalkanols. we report herein an inexpensive, rapid and mild method for the reduction of these substrates to the corresponding amino alcohols under the influence of ultrasound irradiation. 2-Nitroalkanols, conveniently obtained by the Henry reaction of aldehydes and nitroalkanes8, were subjected to sets of conditions involving ultrasound (US)-promoted and non-ultrasound (benchtop, BT) conditions. Overall the US-promoted reactions displayed improved yields over the benchtop cases together with a maximum 11-fold decrease in reaction time (Table 1)9.. Since the concomitant reduction of water, the proton source for both BT and US cases, is also accelerated, the ...
https://www.erowid.org/archive/rhodium/chemistry/al-hg.ultrasound.html
PublicationsPublications
Publications:. 1- Synthesis and Application of Some Asymmetric β-Amino Alcohol Ligands Derived, from D-Mannitol Abdullah M. Al Majid, Fatmah E.M. El-baih and Eman A. Alabdullkarem,, J.Saudi. Chem. Soc., 7, 65, 2003.. 2- Flow-Injection Chemiluminometric Determination of Pioglitazone HCl by Its Sensitizing Effect on the Cerium-Sulfite Reaction. Nawal A. Al-arfaj, Eman A. Al-Abdulkareem, Fatma. A. Aly, Anal. Sci., 25, 401, 2009. 3- Determination of enalapril maleate and atenolol in their pharmaceutical products and in biological fluids by flow-injection chemiluminescence. Nawal A. Al-arfaj, Eman A. Al-Abdulkareem, Fatma. A. Aly, Luminescence, online, May 20, 2009. 4- A Validated Adsorptive Stripping Voltammetric Determination of Antidiabetic Agent Pioglitazone HCl in Tablets and Biological Fluids. Nawal A. Al-arfaj, Eman A. Al-Abdulkareem, Fatma. A. Aly, Int. J. Biomed. Sci. 4, 310, 2008.. ...
http://faculty.ksu.edu.sa/16988/Pages/Publications.aspx
Peptaibols Summary Report | CureHunterPeptaibols Summary Report | CureHunter
Peptaibols: A group of peptides characterized by length of 1-2 dozen residues with a high proportion of them being non-proteinogenic, notably alpha-aminoisobutyric acid (Aib) and isovaline, and have a C-terminal amino alcohol and N terminal alkyl group. They are found in FUNGI and some are ANTI-INFECTIVE AGENTS. They form channels or pores in target organisms. The term is a contraction of peptide-Aib-alcohol.
http://www.curehunter.com/public/keywordSummaryD054848-Peptaibols.do
Ghent University Academic BibliographyGhent University Academic Bibliography
iframe src=https://biblio.ugent.be/publication?q=keyword+exact+%22HETEROALICYCLIC+AMINOALKANOL%22&embed=1&hide_pagination=1&hide_info=1&hide_options=1&hide_cluster=1 ...
https://biblio.ugent.be/publication?q=keyword+exact+%22HETEROALICYCLIC+AMINOALKANOL%22
Molecules | Free Full-Text | Nucleophilic Additions of 2-Furyllithium to Carbonyl Derivatives of L-Serine. Formal Synthesis of ...Molecules | Free Full-Text | Nucleophilic Additions of 2-Furyllithium to Carbonyl Derivatives of L-Serine. Formal Synthesis of ...
The nucleophilic addition of 2-furyllithium to esters derived from L-serine is described. The obtained furyl ketone 5 is stereoselectively reduced (ds≥95%) with sodium borohydride to afford the corresponding syn aminoalcohol 12 in enantiomerically pure form. Compound 12 was further converted into valuable α-hydroxy-β-amino acids by means of the furan-to-acid equivalence.
http://www.mdpi.com/1420-3049/3/1/26
Polyglutamic Acids Functionalised by Histidine Derivatives and Hydrophobic Groups and the Uses Thereof, in Particular for...Polyglutamic Acids Functionalised by Histidine Derivatives and Hydrophobic Groups and the Uses Thereof, in Particular for...
0065]in which: [0066]A independently represents: [0067]an NHR group in which R represents an H, a linear C2 to C10 or branched C3 to C10 alkyl or a benzyl, [0068]a terminal amino acid unit bonded via the nitrogen, the acid functional group(s) of which is (are) optionally modified by an amine or an alcohol corresponding to the definitions NHR and OR respectively; [0069]B is a divalent, trivalent or tetravalent bonding group preferably chosen from the following radicals: [0070]--O--, --NH--, --N--(C1 to C5)alkyl-, an amino acid residue (preferably of a natural amino acid), a diol, a triol, a diamine, a triamine, an aminoalcohol or a hydroxy acid comprising from 1 to 6 carbon atoms; [0071]D represents an H, a linear C2 to C10 or branched C3 to C10 acyl group or a pyroglutamate; [0072]the hydrophobic groups (HGs) each represent, independently of one another, a radical chosen from: [0073]linear or branched C8 to C30 alkyls which can optionally comprise at least one unsaturation and/or at least one ...
http://www.patentsencyclopedia.com/app/20100034886
Sell/Buy-China Foodpharm Group Co., LtdSupply4-(Benzyloxy)phenol,Chemicals Suppliers,Manufacturers,Exporters,Importers...Sell/Buy-China Foodpharm Group Co., LtdSupply4-(Benzyloxy)phenol,Chemicals Suppliers,Manufacturers,Exporters,Importers...
China Foodpharm Group Co., LtdSupply4-(Benzyloxy)phenol,China,chinese Chemicals Suppliers,Manufacturers,Exporters,Importers,Chemical Products,wholesaler,Chemical Instruments,Chemical Equipments ,Chemical additives,chemical iIntermediates,Chemical Industry
http://news.chemyq.com/En/ProdSellInfo.asp?ClassID=1&PID=48826
benzyloxy)methyl]benzene, in stockbenzyloxy)methyl]benzene, in stock
MolPort offers [(benzyloxy)methyl]benzene for your scientific research needs. It is also know by registry numbers ZINC000001687322, MFCD00004780. This compound is available from 8 suppliers, including AK Scientific, Inc., BLD Pharmatech Ltd..
https://www.molport.com/shop/molecule-link/MolPort-001-789-586
hisB - Imidazoleglycerol-phosphate dehydratase - Synechocystis sp. (strain PCC 6803 / Kazusa) - hisB gene & proteinhisB - Imidazoleglycerol-phosphate dehydratase - Synechocystis sp. (strain PCC 6803 / Kazusa) - hisB gene & protein
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class=publication>Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href=http://www.nrbook.com/b/bookcpdf.php>Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
https://www.uniprot.org/uniprot/P48054
Silomat Syrup (Clobutinol Hydrochloride; Sodium Benzoate) Boehringer IngelheimSilomat Syrup (Clobutinol Hydrochloride; Sodium Benzoate) Boehringer Ingelheim
Silomat Syrup information about active ingredients, pharmaceutical forms and doses by Boehringer Ingelheim, Silomat Syrup indications, usages and related health products lists
http://drugs-about.com/drugs-s/silomat-syrup.html
OrciprenalineOrciprenaline
Orciprenaline Orciprenaline Systematic (IUPAC) name 5-[1-hydroxy-2-(1-methylethylamino)ethyl]benzene-1,3-diol Identifiers CAS number 586-06-1 ATC code R03AB03
https://www.chemeurope.com/en/encyclopedia/Orciprenaline.html
Amidate - FDA prescribing information, side effects and usesAmidate - FDA prescribing information, side effects and uses
Amidate official prescribing information for healthcare professionals. Includes: indications, dosage, adverse reactions and pharmacology.
https://www.drugs.com/pro/amidate.html
Demonstration of the Innate Electrophilicity of 4-(3-(Benzyloxy)phenyl)-2-(ethylsulfinyl)-6-(trifluoromethyl)pyrimidine (BETP),...Demonstration of the Innate Electrophilicity of 4-(3-(Benzyloxy)phenyl)-2-(ethylsulfinyl)-6-(trifluoromethyl)pyrimidine (BETP),...
Thank you for sharing this Drug Metabolism & Disposition article.. NOTE: We request your email address only to inform the recipient that it was you who recommended this article, and that it is not junk mail. We do not retain these email addresses.. ...
https://dmd.aspetjournals.org/content/41/8/1470.full
1-[3,5-bis(benzyloxy)phenyl]-2-bromoethanone -... - Registration Dossier - ECHA1-[3,5-bis(benzyloxy)phenyl]-2-bromoethanone -... - Registration Dossier - ECHA
Use of this information is subject to copyright laws and may require the permission of the owner of the information, as described in the ECHA Legal Notice.. ...
https://chesar.echa.europa.eu/web/guest/registration-dossier/-/registered-dossier/20868/7/7/2
HeptaminolHeptaminol
Literature References: Prepn: H. T. F. Givens, R. M. Herbst, US 2457656 (1948 to Bilhuber); of hydrochloride: J. Doeuvre, J. Poizat, Compt. Rend. 224, 286 (1947). Pharmacokinetics and metabolism: F. Chanoine et al., Arzneim.-Forsch. 31, 1430 (1981). HPLC determn in biological fluids: R. R. Brodie et al., J. Chromatogr. 274, 179 (1983). Clinical trial in hypotension: D. Milon et al., Fundam. Clin. Pharmacol. 4, 695 (1990). Review of mode of action: B. Pourrias Ann. Pharm. Fr. 49, 127-138 (1991). ...
https://www.drugfuture.com/chemdata/Heptaminol.html
Enantiopure building blocks from sugars, 20. Perspectives in the use of low molecular weight carbohydrates as organic raw...Enantiopure building blocks from sugars, 20. Perspectives in the use of low molecular weight carbohydrates as organic raw...
Enantiopure building blocks from sugars, 20. Perspectives in the use of low molecular weight carbohydrates as organic raw materials ...
http://tubiblio.ulb.tu-darmstadt.de/7750/
DiVA - Search resultDiVA - Search result
In a preceding study we have described the development of a new hydroxyethylene (HE) core motif displaying P1 aryloxymethyl and P1 methoxy substituents delivering potent BACE-1 inhibitors. In a continuation of this work we have now explored the SAR of the S1 pocket by introducing a set of P1 alkoxy groups and evaluated them as BACE-1 inhibitors. Previously the P1 and P1 positions of the classical HE template have been relatively little explored due to the complexity of the chemical routes involved in modifications at these positions. However, the chemistries developed for the current HE template renders substituents in both the P1 and P1 positions readily available for SAR exploration. The BACE-1 inhibitors prepared displayed IC50 values in the range of 4-45 nM, where the most potent compounds featured small P1 groups. The cathepsin D selectivity which was high for the smallest P1 sustituents (P1=ethoxy, fold selectively ,600) dropped for larger groups (P1=benzyloxy, fold selectivity of ...
http://su.diva-portal.org/smash/resultList.jsf?dswid=1427&af=%5B%22personName%3A%5C%22Adolfsson%2C+Hans%5C%22%22%5D&p=1&fs=true&language=en&searchType=SIMPLE&query=&aq=%5B%5B%7B%22organisationId%22%3A%22631%22%7D%5D%5D&aq2=%5B%5B%5D%5D&aqe=%5B%5D&noOfRows=50&sortOrder=author_sort_asc&sortOrder2=title_sort_asc&onlyFullText=false&sf=all
Upcoming exams, not feeling too good. On lexapro. Can valdoxan be taken along with it? - Doctors insight on HealthcareMagicUpcoming exams, not feeling too good. On lexapro. Can valdoxan be taken along with it? - Doctors insight on HealthcareMagic
Question - Upcoming exams, not feeling too good. On lexapro. Can valdoxan be taken along with it?. Ask a Doctor about Enantiopure drugs, Ask a Psychiatrist
http://www.healthcaremagic.com/questions/Upcoming-exams-not-feeling-too-good-On-lexapro-Can-valdoxan-be-taken-along-with-it/388022
Isolation of Genomic DNA from Food and FeedIsolation of Genomic DNA from Food and Feed
The NucleoSpin Food Kit allows you to quickly isolate genomic DNA from many types of processed food or animal feed of plant or animal origin. We have optimized the lysis buffer and purification process to extract DNA from a variety of food products.
http://www.clontech.com/US/Products/Nucleic_Acid_Purification/Genomic_DNA/Food/Single_Prep?sitex=10020:22372:US&PROD=FlDkoyHEkjPGfVquUC1zydnu:S&PROD_pses=ZG5986C9D9869B05BD1930092E48C8EE90E97788E12382284C47A1CC15F57399A16CFA7D7D935B566980274F4535557C97D32E99CAE0011C3D
Β-MethylphenethylamineΒ-Methylphenethylamine
Hartung WH, Munch JC (1931). "Amino alcohols. VI. The preparation and pharmacodynamic activity of four isomeric ... β-Methylphenethylamine (β-Me-PEA, BMPEA), or 1-amino-2-phenylpropane, is an organic compound of the phenethylamine class, and a ... Changes in pharmacological action on substitution of phenyl nucleus and amino nitrogen". Ind. Eng. Chem. 37 (2): 149-51. doi: ...
https://en.wikipedia.org/wiki/Β-Methylphenethylamine
PhenylethanolaminePhenylethanolamine
Chemically, phenyethanolamine is an aromatic compound, an amine, and an alcohol. The amino-group makes this compound a weak ... W. H. Hartung and J. C. Munch (1929). "Amino alcohols. I. Phenylpropanolamine and para-tolylpropanolamine." J. Am. Chem. Soc. ...
https://en.wikipedia.org/wiki/Phenylethanolamine
Ethanolamine-phosphate phospho-lyaseEthanolamine-phosphate phospho-lyase
Metabolism of ethanolamine and 1-aminopropan-2-ol in species of Erwinia and the roles of amino alcohol kinase and amino alcohol ... Jones A, Faulkner A, Turner JM (1973). "Microbial metabolism of amino alcohols. ... amino alcohol O-phosphate phospholyase, O-phosphorylethanol-amine phospho-lyase, and ethanolamine-phosphate phospho-lyase ( ...
https://en.wikipedia.org/wiki/Ethanolamine-phosphate_phospho-lyase
Slayton A. Evans, Jr.Slayton A. Evans, Jr.
... amino alcohols to the corresponding aziridines with diethoxytriphenylphosphorane". The Journal of Organic Chemistry. 51 (1): 95 ... He also devised a method of asymmetric synthesis to synthesize alpha-amino phosphonic acids by adding phosphorus to sulfimides ... Lefebvre, Isabelle M.; Evans, Slayton A. (October 1997). "Studies toward the Asymmetric Synthesis of α-Amino Phosphonic Acids ...
https://en.wikipedia.org/wiki/Slayton_A._Evans,_Jr.
EthanolamineEthanolamine
The ethanolamines comprise a group of amino alcohols. A class of antihistamines is identified as ethanolamines, which includes ... containing both a primary amine and a primary alcohol. Ethanolamine is a colorless, viscous liquid with an odor reminiscent of ...
https://en.wikipedia.org/wiki/Ethanolamine
1-Aminopropan-2-ol1-Aminopropan-2-ol
It is an amino alcohol. The term isopropanolamine may also refer more generally to the additional homologs diisopropanolamine ( ... Amino-2-propanol at Sigma-Aldrich Smith, Michael B. (19 February 2020). March's Advanced Organic Chemistry: Reactions, ... Turner, JM (1967). "Microbial metabolism of amino ketones. L-1-aminopropan-2-ol dehydrogenase and L-threonine dehydrogenase in ...
https://en.wikipedia.org/wiki/1-Aminopropan-2-ol
Criegee oxidationCriegee oxidation
... the oxidation can be employed with β-amino alcohols, α-hydroxy carbonyls, and α-keto acids, In the case of β-amino alcohols, a ... The Criegee oxidation can also be employed with 2,3-epoxy alcohols forms α-acetoxy carbonyls. Because the substrates can be ... Baer, Erich (1942). "Oxidative Cleavage of Cyclic α-Keto Alcohols by Means of Lead Tetraacetate". Journal of the American ... ISBN 978-0-12-429785-2. Leonard, Nelson J.; Rebenstorf, Melvin A. (1945). "Lead Tetraacetate Oxidation of Aminoalcohols". ...
https://en.wikipedia.org/wiki/Criegee_oxidation
PeriodatePeriodate
... amino acids, 1,2-amino alcohols, 1,2-diamines, and epoxides to give aldehydes, ketones, and carboxylic acids. Alkenes can also ... Nicolet, Ben H.; Shinn, Leo A. (June 1939). "THE ACTION OF PERIODIC ACID ON α-AMINO ALCOHOLS". Journal of the American Chemical ... Where solubility is an issue periodic acid may be used, as this is soluble in alcohols; phase transfer catalysts are also ... 3, 1, 833 (1934) Clamp, J.R.; Hough, L. (Jan 1965). "The Periodate Oxidation of Amino Acids with Reference to Studies on ...
https://en.wikipedia.org/wiki/Periodate
Solvent impregnated resinSolvent impregnated resin
... include polar organics like amino-alcohols, organic acids, amino acids, flavonoids, and aldehydes on a bench-scale or pilot- ... "Chiral Separation of Amino-Alcohols using Extractant Impregnated Resins." J. Chromatogr. A 1142: 84-92. Juang, R.-S.; Chang, H ... used polyvinyl alcohol. In order to remove or recover the extracted solute, SIR particles can be regenerated using low pressure ...
https://en.wikipedia.org/wiki/Solvent_impregnated_resin
Malaprade reactionMalaprade reaction
3, 1, 833 1934; Nicolet, Ben H.; Shinn, Leo A. (1939). "The Action of Periodic Acid on α-Amino Alcohols". J. Am. Chem. Soc. 61 ... The reaction was first reported by Léon Malaprade in 1934[disputed - discuss] and also works with beta-aminoalcohols. Malaprade ...
https://en.wikipedia.org/wiki/Malaprade_reaction
SphingolipidSphingolipid
... s are a class of lipids containing a backbone of sphingoid bases, a set of aliphatic amino alcohols that includes ... and related amino alcohols". Journal of Lipid Research. 49 (8): 1621-39. doi:10.1194/jlr.R800012-JLR200. PMC 2444003. PMID ... demonstrated that serine palmitoyltransferase has some activity toward other species of fatty acyl-CoA and alternative amino ...
https://en.wikipedia.org/wiki/Sphingolipid
MicrobodyMicrobody
This facilitates the breakdown of fats, alcohols and amino acids. Generally microbodies are involved in detoxification of ...
https://en.wikipedia.org/wiki/Microbody
ValinolValinol
It is part of a broader class of amino alcohols. Valinol can be generated by converting the carboxylic group of valine to an ... Dickman, D.A.; Meyers, A.I.; Smith, G.A.; Gawley, R.E. (1990). "Reduction of α-Amino Acids". Organic Syntheses. 7: 530. doi: ... Valinol is an organic compound named after, and commonly produced from, the amino acid valine. The compound is chiral and is ... S)-iPr-PHOX - an oxazoline ligand made using valinol Sigma-Aldrich Co., 2-Amino-3-methyl-1-butanol. Retrieved on 2014-10-22. ...
https://en.wikipedia.org/wiki/Valinol
White catalystWhite catalyst
Rice, G. T.; White, M. C. (2009). "Allylic C-H Amination for the Preparation of syn-1,3-Amino Alcohol Motifs". J. Am. Chem. Soc ... This strategy has been applied to the synthesis of 1,2 and 1,3-amino alcohols. The amination proceeds with high yields and good ... Fraunhoffer, K. J.; White, M. C. (2007). "syn-1,2-Amino Alcohols via Diastereoselective Allylic C-H Amination". J. Am. Chem. ... Kenneth J. Fraunhoffer & M. Christina White (2007). "syn-1,2-Amino Alcohols via Diastereoselective Allylic C-H Amination". J. ...
https://en.wikipedia.org/wiki/White_catalyst
PropanolaminesPropanolamines
They are amino alcohols that are derivatives of 1-amino-2-propanol. Propanolamines include: Acebutolol Atenolol Betaxolol ...
https://en.wikipedia.org/wiki/Propanolamines
Hofmann-Löffler reactionHofmann-Löffler reaction
2-amino-alcohols using a variant of the Hofmann-Löffler-Freytag reaction to promote β selective C-H amination of alcohols. In ... "Enantioselective radical C-H amination for the synthesis of β-amino alcohols". Nature Chemistry. 12 (8): 697-704. doi:10.1038/ ... Wappes, Ethan A.; Nakafuku, Kohki M.; Nagib, David A. (2 August 2017). "Directed β C-H Amination of Alcohols via Radical Relay ... Van De Woude, G.; Biesemans, M.; van Hove, L. (1980). "Amino steroids - functionalization of position 20 from position 18 in a ...
https://en.wikipedia.org/wiki/Hofmann–Löffler_reaction
Arthrobacter busseiArthrobacter bussei
These include carbohydrates (pentoses, hexoses and oligosaccharides), sugar alcohols and amino acids. Under aerobic conditions ... Furthermore amino acids leucine and valine are assimilated. Carbohydrates that cannot be used are erythritol, D-arabinose, D- ...
https://en.wikipedia.org/wiki/Arthrobacter_bussei
Chiral auxiliaryChiral auxiliary
Oxazolidinones can be prepared from amino acids or readily available amino alcohols. A large number of oxazolidinones are ... The preparation of a variety of enantiomerically pure uncommon R-amino acids can be achieved by the alkylation of chiral ... The syn-stereorelationship between the methyl group and the new secondary alcohol results from a six-membered ring Zimmerman- ... Tanaka, Kiyoshi; Ahn, Mija; Watanabe, Yukari; Fuji, Kaoru (1996-06-01). "Asymmetric synthesis of uncommon α-amino acids by ...
https://en.wikipedia.org/wiki/Chiral_auxiliary
OxazolineOxazoline
Chirality is easily incorporated by using 2-amino alcohols prepared by the reduction of amino acids; which are both optically ... amino alcohol (typically obtained by the reduction of an amino acid) with a suitable functional group.[7][8][9] The overall ... A routine route to oxazolines entails reactions of acyl chlorides with 2-amino alcohols. Thionyl chloride is commonly used to ... The cyclisation of an amino alcohol and an aldehyde produces an intermediate oxazolidine which can be converted to an oxazoline ...
https://en.wikipedia.org/wiki/Oxazoline
1-Deoxysphingolipids1-Deoxysphingolipids
It is an amino alcohol and a bioactive sphingoid. Its distinctive trait is that the terminal hydroxy group has been replaced by ... It is formed by a sphingoid and an amino alcohol and it constitutes the conjugated base of 1-deoxymethylsphinganine (1+). Its ... the amino acid substrate is replaced by L-alanina or L-glycine. This atypical sphingolipids are formed as the result of a ... role is accepting a hydron from a donor via its organic amino compound; it is a Bronsted base. It is also known as deoxymethyl- ...
https://en.wikipedia.org/wiki/1-Deoxysphingolipids
Imidic acidImidic acid
For example, methanolamine, the parent compound of the amino alcohols, can be dehydrogenated to methanimidic acid, the parent ... H2NCH2OH → HNCHOH + H2 (tautomer of formamide) Geminal amino alcohols with side chains similarly form imidic acids with the ... Imidic acids can be formed by metal-catalyzed dehydrogenation of geminal amino alcohols. ...
https://en.wikipedia.org/wiki/Imidic_acid
Candida blankiiCandida blankii
Consequently, it oxidizes many forms of alcohol, amino acid, carbohydrates, and other organic compounds. As a BOD biosensor, ...
https://en.wikipedia.org/wiki/Candida_blankii
TryptopholTryptophol
Dickinson, JR; Salgado, LE; Hewlins, MJ (2003). "The catabolism of amino acids to long chain and complex alcohols in ... Tryptophol is an aromatic alcohol that induces sleep in humans. It is found in wine as a secondary product of ethanol ... This latter compound is transformed to tryptophol by alcohol dehydrogenase. It is formed from tryptophan, along with indole-3- ... Ehrlich demonstrated that yeast attacks the natural amino acids essentially by splitting off carbon dioxide and replacing the ...
https://en.wikipedia.org/wiki/Tryptophol
CromakalimCromakalim
Ring opening of the oxirane with ammonia gives a mixture of the trans amino alcohols (6). These are probably resolved at this ...
https://en.wikipedia.org/wiki/Cromakalim
AlaninolAlaninol
... the compound is classified as an amino alcohol. It can be generated by converting the carboxylic group of alanine to an alcohol ... Dickman, D.A.; Meyers, A.I.; Smith, G.A.; Gawley, R.E. (1990). "Reduction of α-Amino Acids". Organic Syntheses. 7: 530. doi: ...
https://en.wikipedia.org/wiki/Alaninol
Tiffeneau-Demjanov rearrangementTiffeneau-Demjanov rearrangement
The principal method for synthesizing the starting amino alcohols is through the addition of cyanide anion to a cyclic ketone. ... The resulting hydroxynitrile is then reduced, forming the desired amino alcohol. This method forms diastereomers, possibly ... The alcohol's presence explains how this E1 reaction does not occur. Moreover, having an alcohol present puts the developing ... other factors began to be tabled as possibilities for what was controlling product formation of unsymmetrical amino alcohols. ...
https://en.wikipedia.org/wiki/Tiffeneau–Demjanov_rearrangement
GlycosphingolipidGlycosphingolipid
... s are a subtype of glycolipids containing the amino alcohol sphingosine. They may be considered as ...
https://en.wikipedia.org/wiki/Glycosphingolipid
LevopropoxypheneLevopropoxyphene
Reaction of the ketone with benzylmagnesium bromide gives the amino alcohol. It is of note that this intermediate fails to show ... Esterification of the alcohol by means of propionic anhydride affords the propionate. The presence of two chiral centers in ...
https://en.wikipedia.org/wiki/Levopropoxyphene
CUBICCUBIC
They found that basic amino alcohols are ideally suited for this purpose, probably because amino groups effectively solvate ... Amino alcohols have also beneficial effect when used for clearing of other tissues, which are mostly highly vascularized, and ... Amino alcohols reduce pigmentation of those tissues very effectively by eluting the hem from hemoglobin. The original protocol ... The CUBIC method is very powerful, due to amino alcohols and consequent ability to clear almost any organ or even whole body of ...
https://en.wikipedia.org/wiki/CUBIC
KetoneKetone
With an alcohols or alkoxides to gives the hemiketal or its conjugate base. With a diol to the ketal. This reaction is employed ... and amino acids in most vertebrates, including humans. Ketone bodies are elevated in the blood (ketosis) after fasting, ... For specialized or small scale organic synthetic applications, ketones are often prepared by oxidation of secondary alcohols: R ... With a metal hydride gives a metal alkoxide salt, hydrolysis of which gives the alcohol, an example of ketone reduction ...
https://en.m.wikipedia.org/wiki/Ketone
AcneAcne
Rosacea tends to occur more frequently in older adults.[20] Facial redness triggered by heat or the consumption of alcohol or ... Hydroquinone lightens the skin when applied topically by inhibiting tyrosinase, the enzyme responsible for converting the amino ...
https://en.wikipedia.org/wiki/Acne_vulgaris
SakeSake
a b c d The weight of added alcohol must be below 10% of the weight of the rice (after polishing) used in the brewing process. ... Iron will bond with an amino acid produced by the kōji to produce off flavors and a yellowish color. Manganese, when exposed to ... "alcohol consumption". Encyclopedia Britannica. Retrieved March 9, 2017.. *^ Robinson, Jancis (2006). The Oxford Companion to ... The origin of sake is unclear, the earliest reference to the use of alcohol in Japan is recorded in the Book of Wei in the ...
https://en.wikipedia.org/wiki/Sake
Lyme diseaseLyme disease
The EPA recommends several tick repellents for use on exposed skin, including DEET, picaridin, IR3535 (a derivative of amino ... The wound and hands should then be cleaned with alcohol or soap and water.[141] The tick may be disposed by placing it in a ... container with alcohol, sealed bag, tape or flushed down the toilet.[141] The bitten person should write down where and when ...
https://en.wikipedia.org/wiki/Lyme_disease
Senarai reka cipta pada zaman pertengahan Islam Bahasa Melayu, ensiklopedia bebasSenarai reka cipta pada zaman pertengahan Islam Bahasa Melayu, ensiklopedia bebas
... al-anbiq al-ama), aludel (al-uthal), goblets (qadah), flasks (qarura atau quwarir), flask air mawar (ma wariyya), cauldron ( ... "Alcohol and the Distillation of Wine in Arabic Sources". History of Science and Technology in Islam. Dicapai 2008-03-29.. ... Ahmad Y Hassan, Alcohol and the Distillation of Wine in Arabic Sources, History of Science and Technology in Islam ... Medicinal-grade alcohol: Dikeluarkan melalui penyulingan. Alat-alat penyulingan ini untuk kegunaan dalam kimia dan perubatan ...
https://ms.wikipedia.org/wiki/Reka_cipta_pada_zaman_pertengahan_Islam
GABAA receptor positive allosteric modulatorGABAA receptor positive allosteric modulator
Examples of GABAA PAMs include alcohol (ethanol), benzodiazepines such as diazepam (Valium) and alprazolam (Xanax), Z-drugs ... pyrimidinone and 3-amino-1,2,4-triazole derivatives". Bioorganic & Medicinal Chemistry. 23 (3): 480-7. doi:10.1016/j.bmc. ...
https://en.wikipedia.org/wiki/GABAA_receptor_positive_allosteric_modulator
Wikipedia:Makala za msingi za kamusi elezo/Zote 1000, kamusi elezo huruWikipedia:Makala za msingi za kamusi elezo/Zote 1000, kamusi elezo huru
Alcohol * sw:Alcohol. Alexander Pushkin * sw:Alexander Pushkin. Alexander the Great * sw:Aleksander Mashuhuri. Alfred Hitchcock ... Kama viungo vya Kiswahili bado ni vyekundu, ni alama ya kwamba ama jina halikusahihishwa bado, au hakuna makala bado. Mpangilio ...
https://sw.wikipedia.org/wiki/Wikipedia:Makala_za_msingi_za_kamusi_elezo/Zote_1000
腎上腺素 - 維基百科，自由的百科全書腎上腺素 - 維基百科，自由的百科全書
Glutamate receptor antagonist（英語：Excitatory amino acid antagonist） (NMDA（英語：NMDA receptor antagonist）) ... MOPET（英語：Homovanillyl alcohol）. *Hydroxytyrosol（英語：Hydroxytyrosol）. *3-Methoxytyramine（英語：3-Methoxytyramine） ... Glutamate receptor agonist（英語：Excitatory amino acid agonist） (AMPA（英語：Ampakine）) ...
https://zh.wikipedia.org/zh-hk/肾上腺素
EndosporeEndospore
This excess sulfur is concentrated in spore coats as an amino acid, cysteine. It is believed that the macromolecule accountable ... alcohols, quaternary ammonium compounds and detergents have little effect on endospores. However, sterilant alkylating agents ...
https://en.wikipedia.org/wiki/Bacterial_spore
ElutionElution
For instance, a mixture of amino acids may be separated by ion-exchange chromatography. Under a particular set of conditions, ... Alcohols. Acids and Bases (Amines) Eluting Power (Least Eluting Power → Greatest Eluting Power) ... the amino acids will elute in the same order and at the same elution volume. ...
https://en.wikipedia.org/wiki/Eluant
Hypothalamic-pituitary-adrenal axisHypothalamic-pituitary-adrenal axis
Spencer RL, Hutchison KE (1999). "Alcohol, aging, and the stress response". Alcohol Research & Health. 23 (4): 272-83. PMID ... Inclusion of the amino acid L-tryptophan, a precursor of 5HT, in the feed of rainbow trout made the trout less aggressive and ...
https://en.wikipedia.org/wiki/Hypothalamic-pituitary-adrenal_axis
Visual impairmentVisual impairment
a b c AMA Guides Archived 2006-05-02 at the Wayback Machine ... denatured ethyl alcohol, to avoid paying taxes on selling ...
https://en.m.wikipedia.org/wiki/Blindness
2017 London Bridge attack2017 London Bridge attack
She eventually divorced him after he tried to force his extremist beliefs on her.[85] He used to drink alcohol.[86] He lived ... Giuseppe Amato, an Italian prosecutor, said "We did our best. We could just monitor and surveil ... [Zaghba] and send a note to ...
https://en.wikipedia.org/wiki/June_2017_London_Bridge_attack
Mineral (nutrient)Mineral (nutrient)
Ashmead, H. DeWayne (1993). The Roles of Amino Acid Chelates in Animal Nutrition. Westwood: Noyes Publications.. ... Pervasive and required for several enzymes such as carboxypeptidase, liver alcohol dehydrogenase, and carbonic anhydrase ... and essential amino acids.[4] The five major minerals in the human body are calcium, phosphorus, potassium, sodium, and ... amino acids, organic acids, etc.) improves the bioavailability of the supplemented mineral.[36] ...
https://en.wikipedia.org/wiki/Dietary_mineral
HalostachineHalostachine
The amino-ketone was reduced with lithium aluminum hydride to the corresponding amino-alcohol, and the N-benzyl group finally ... Chemically, N-methylphenyethanolamine is an aromatic compound, an amine, and an alcohol. The amino-group makes this compound a ... I. Aralkylamines and Alcohols." J. Org. Chem. 25 1779-1784. R. Lukes, V. Dienstbierova, J. Kovar and K. Blaha (1961). "Uber die ... α-amino acid chlorides. Application to the preparation of β-arylalkylamines and 3-substituted 1,2,3,4-tetrahydroisoquinolines ...
https://en.wikipedia.org/wiki/Halostachine
TeaTea
... and alcohol - combined.[4] Most tea consumed outside East Asia is produced on large plantations in the hilly regions of India ... such as the polyphenols and amino acids, but is a suspension when all of the insoluble components are considered, such as the ...
https://en.wikipedia.org/wiki/Tea
ArchaeaArchaea
Other organic compounds such as alcohols, acetic acid or formic acid are used as alternative electron acceptors by methanogens ... it lacks D-amino acids and N-acetylmuramic acid.[102] ...
https://en.m.wikipedia.org/wiki/Archaea
HistoneHistone
About 7% of the US population is addicted to alcohol. In rats exposed to alcohol for up to 5 days, there was an increase in ... The single-letter amino acid abbreviation (e.g., K for Lysine) and the amino acid position in the protein ... compared amino acid compositions in the same histone from different organisms, and compared amino acid sequences of the same ... 3. Complete amino acid sequence of pea seedling histone IV; comparison with the homologous calf thymus histone". The Journal of ...
https://en.wikipedia.org/wiki/Histone_modification
BiofuelBiofuel
Alcohol fuels are produced by fermentation of sugars derived from wheat, corn, sugar beets, sugar cane, molasses and any sugar ... Escherichia coli strains have also been successfully engineered to produce butanol by modifying their amino acid metabolism.[36 ... Biologically produced alcohols, most commonly ethanol, and less commonly propanol and butanol, are produced by the action of ... Bioethanol is an alcohol made by fermentation, mostly from carbohydrates produced in sugar or starch crops such as corn, ...
https://en.wikipedia.org/wiki/Biofuels
Flux (metallurgy)Flux (metallurgy)
A more aggressive early composition was a mixture of saturated solution of zinc chloride, alcohol, and glycerol.[14] ... and sometimes amino acids. Some milder fluxes also contain halides or organohalides. ... Common high-activity activators are mineral acids, often together with halides, amines, water and/or alcohols: *hydrochloric ...
https://en.wikipedia.org/wiki/Flux_(metallurgy)
MT-TIMT-TI
... is a small 69 nucleotide RNA (human mitochondrial map position 4263-4331) that transfers the amino acid isoleucine to a ...
https://en.wikipedia.org/wiki/MT-TI
FesoterodineFesoterodine
2-[(1R)-3-(Di(propan-2-yl)amino)-1-phenylpropyl]-4-(hydroxymethyl)phenyl] 2-methylpropanoate ...
https://en.wikipedia.org/wiki/Fesoterodine
PeroxisomePeroxisome
... and alcohol, by means of the peroxidation reaction: H. 2. O. 2. +. R. ′. H. 2. →. R. ′. +. 2. H. 2. O. {\displaystyle \mathrm { ... Specific amino acid sequences (PTS or peroxisomal targeting signal) at the C-terminus (PTS1) or N-terminus (PTS2) of ... About 25% of the ethanol alcohol humans drink is oxidized to acetaldehyde in this way.[8] In addition, when excess H2O2 ... Peroxisomes contain oxidative enzymes, such as D-amino acid oxidase and uric acid oxidase.[9] However the last enzyme is absent ...
https://en.wikipedia.org/wiki/Peroxisome
AmineAmine
Protonated amino groups (-NH+. 3) are the most common positively charged moieties in proteins, specifically in the amino acid ... For example, methyl and ethyl amines are gases under standard conditions, whereas the corresponding methyl and ethyl alcohols ... Higher amines have the prefix amino as a functional group. IUPAC however does not recommend this convention,[citation needed] ... The substituent -NH2 is called an amino group.[6]. Compounds with a nitrogen atom attached to a carbonyl group, thus having the ...
https://en.m.wikipedia.org/wiki/Amines
SilaneSilane
... is the silicon analogue of methane. Because of the greater electronegativity of hydrogen in comparison to silicon, this Si-H bond polarity is the opposite of that in the C-H bonds of methane. One consequence of this reversed polarity is the greater tendency of silane to form complexes with transition metals. A second consequence is that silane is pyrophoric - it undergoes spontaneous combustion in air, without the need for external ignition.[11] However, the difficulties in explaining the available (often contradictory) combustion data are ascribed to the fact that silane itself is stable and that the natural formation of larger silanes during production, as well as the sensitivity of combustion to impurities such as moisture and to the catalytic effects of container surfaces causes its pyrophoricity.[12][13] Above 420 °C, silane decomposes into silicon and hydrogen; it can therefore be used in the chemical vapor deposition of silicon. The Si-H bond strength is around 384 kJ/mol, which ...
https://en.wikipedia.org/wiki/Silane
YohimbineYohimbine
Agonists: Alcohols (e.g., butanol, ethanol (alcohol), trichloroethanol). *m-CPBG. *Phenylbiguanide. *Piperazines (e.g., BZP, ... 2-Amino-1,2-dihydronaphthalene. *2-Aminoindane. *5-(2-Aminopropyl)indole. *2-Aminotetralin ...
https://en.wikipedia.org/wiki/Yohimbine
Protecting groupProtecting group
Orthogonal protection of L-Tyrosine (Protecting groups are marked in blue, the amino acid is shown in black). (1) Fmoc- ... For example, lithium aluminium hydride is a highly reactive but useful reagent capable of reducing esters to alcohols. It will ... In the example shown, the protected amino acid tyrosine, the benzyl ester can be removed by hydrogenolysis, the ... Kamaya, Yasushi; T Higuchi (2006). "Metabolism of 3,4-dimethoxycinnamyl alcohol and derivatives by Coriolus versicolor". FEMS ...
https://en.wikipedia.org/wiki/Protecting_group
ProlameProlame
17β-((3-Hydroxypropyl)amino)estradiol; 17β-[(3-Hydroxypropyl)amino]estra-1,3,5(10)-trien-3-ol. ... Prolame, also known as 17β-((3-hydroxypropyl)amino)estradiol, is a synthetic, steroidal estrogen and a 17β-aminoestrogen with ... an amino-estrogen with prolonged anticoagulant and brief estrogenic effects". Steroids. 45 (2): 151-7. PMID 3841424.. ...
https://en.wikipedia.org/wiki/Prolame
FolateFolate
... amino]pentanedioic acid[1] , OtherNames = N-(4-{[(2-amino-4-oxo-1,4-dihydropteridin-6-yl)methyl]amino}benzoyl)-L-glutamic acid ... Alcohols. Skauk't categeries: *Pages uisin ISBN magic airtins. *Chemical airticles wi unkent parameter in Chembox ... 2-amino-4-oxo-1H-pteridin-6-yl)methylamino]benzoyl] ...
https://sco.wikipedia.org/wiki/Folic_acid
Determination of the relative configuration of vic-amino alcoholsDetermination of the relative configuration of vic-amino alcohols
amino alcohols, configuration, NMR National Category Organic Chemistry Research subject. Organic Chemistry Identifiers. URN: ... Determination of the relative configuration of vic-amino alcohols. Olofsson, Berit Royal Institute of Technology, Sweden. ... A large set of syn- and anti-1,2-amino alcs. has been synthesized. Upon comparison of the CHO and CHN 1H NMR shifts a general ... the relative configuration of 1,2-amino alcs. without derivatization or shift reagents. ...
http://www.diva-portal.org/smash/record.jsf?pid=diva2:766460
N-Protected Amino Alcohols | Organic Chemicals | Spectrum ChemicalN-Protected Amino Alcohols | Organic Chemicals | Spectrum Chemical
Get N-Protected Amino Alcohols Spectrum Chemical. SpectrumChemical.com carries a full line of fine chemicals, lab appliances ... N-Protected Amino Alcohols N-Protected Amino Alcohols. N-Protected Amino Alcohols ...
https://www.spectrumchemical.com/OA_HTML/Chemicals_TCI-Organic-Chemicals_Synthetic-Organic-Chemistry_Chiral-Building-Blocks_N-Protected-Amino-Alcohols.jsp?queryStr=Q
Amino Acids As A Source Of Higher Alcohols | 44468Amino Acids As A Source Of Higher Alcohols | 44468
Proof of principle that high amino acid concentrations will generate higher alcohol levels has been obtained by adding amino ... Higher alcohols, such as n-butanol, isobutanol, isoamyl alcohol (3-methyl-1-butanol) and active amyl alcohol (2-methyl-1- ... Amino acids as a source of higher alcohols. World Bioenergy Congress and Expo. Henry P Oamen, Caroline Paget, Chris Grant and ... In Saccharomyces cerevisiae, higher alcohol production is via amino acid catabolism through the Ehrlich pathway, but the yield ...
https://www.omicsonline.org/proceedings/amino-acids-as-a-source-of-higher-alcohols-44468.html
What Mandatory Alcohol Screening Means for Alberta Drivers | AMAWhat Mandatory Alcohol Screening Means for Alberta Drivers | AMA
As of Dec 18, 2018, police can require a breath sample during any traffic stop regardless of impairment signs. Heres everything you need to know about the new Canada-wide law, along with how to stay safe and legal on the road.
https://ama.ab.ca/blog/mandatory-alcohol-screening
Clenbuterol hydrochloride - 4-Amino-α-(t-butylaminomethyl)-3,5-dichlorobenzyl alcohol hydrochlorideClenbuterol hydrochloride - 4-Amino-α-(t-butylaminomethyl)-3,5-dichlorobenzyl alcohol hydrochloride
5-dichlorobenzyl alcohol hydrochloride. CAS 21898-19-1. Molecular Weight 313.65. Browse Clenbuterol hydrochloride and related ...
https://www.sigmaaldrich.com/US/en/substance/clenbuterolhydrochloride3136521898191
Amino-alcohols sales value UK 2010-2016 | StatistaAmino-alcohols sales value UK 2010-2016 | Statista
This statistic shows the sales value of amino-alcohols based on PRODCOM estimates** in the United Kingdom (UK) between 2010 and ... Amino-alcohols: sales value in the United Kingdom (UK) 2010-2016 Published by M. Garside, Feb 27, 2020 ... Amino-alcohols, their esters and esters with only one oxygen function and their salts excluding monoethanolamine and its salts ... Sales value of amino-alcohols in the United Kingdom between 2010 and 2016 (in 1,000 GBP) ...
https://www.statista.com/statistics/328433/amino-alcohols-sales-value-in-the-united-kingdom-uk/
The synthesis of N-heterocycles via copper/TEMPO catalysed aerobic oxidation of amino alcohols - Green Chemistry (RSC...The synthesis of N-heterocycles via copper/TEMPO catalysed aerobic oxidation of amino alcohols - Green Chemistry (RSC...
N-Heterocycles can be prepared using alcohol oxidation as a key synthetic step. Herein we report studies exploring the ... amino. alcohols James C. A. Flanagan,a Laura M. Dornan,a Mark G. McLaughlin,a Niall G. McCreanor,a Matthew J. Cook*a and Mark J ... amino. alcohols J. C. A. Flanagan, L. M. Dornan, M. G. McLaughlin, N. G. McCreanor, M. J. Cook and M. J. Muldoon, Green Chem., ... alcohol oxidation. as a key synthetic step. Herein we report studies exploring the potential of Cu/TEMPO as an aerobic ...
https://pubs.rsc.org/en/content/articlelanding/2012/gc/c2gc35062a
Molecules | Free Full-Text | Short and Efficient Synthesis of Optically Active N-Tosyl Aziridines from 2-Amino AlcoholsMolecules | Free Full-Text | Short and Efficient Synthesis of Optically Active N-Tosyl Aziridines from 2-Amino Alcohols
Higher substituted amino alcohols give better yields using potassium carbonate in acetonitrile. Both procedures use simple ... Two alternative and complementary one-pot procedures for the direct transformation of 2-amino alcohols to N-tosyl aziridines ... Keywords: Amino alcohols; bis-tosylation; inorganic bases; 1; 3-elimination; aqueous solvent Amino alcohols; bis-tosylation; ... AMA Style. Bieber LW, De Araújo MCF. Short and Efficient Synthesis of Optically Active N-Tosyl Aziridines from 2-Amino Alcohols ...
http://www.mdpi.com/1420-3049/7/12/902
Materials | Free Full-Text | Amino Alcohol Oxidation with Gold Catalysts: The Effect of Amino GroupsMaterials | Free Full-Text | Amino Alcohol Oxidation with Gold Catalysts: The Effect of Amino Groups
This comparison allowed us to state that the presence of amino groups has a crucial effect on the catalytic performance, in ... The catalytic systems have been tested in the liquid phase oxidation of aminoalcohols (serinol and ethanolamine) and the ... AMA Style. Villa A, Campisi S, Schiavoni M, Prati L. Amino Alcohol Oxidation with Gold Catalysts: The Effect of Amino Groups. ... Amino Alcohol Oxidation with Gold Catalysts: The Effect of Amino Groups. Alberto Villa. ...
http://mdpi.com/1996-1944/6/7/2777
Direct N-alkylation of unprotected amino acids with alcohols | Science AdvancesDirect N-alkylation of unprotected amino acids with alcohols | Science Advances
Direct N-alkylation of unprotected amino acids with alcohols Message Subject. (Your Name) has forwarded a page to you from ... We present a method for N-alkylation of unprotected amino acids with alcohols with excellent yield and stereochemistry ... We present a method for N-alkylation of unprotected amino acids with alcohols with excellent yield and stereochemistry ...
https://advances.sciencemag.org/content/3/12/eaao6494/tab-e-letters
Determination of the relative configuration of vic-amino alcoholsDetermination of the relative configuration of vic-amino alcohols
amino alcohols, configuration, NMR, circular-dichroism spectra, beta-amino, asymmetric-synthesis, enantiomeric purity, acid, ... A large set of syn- and anti-1,2-amino alcohols has been synthesized. Upon comparison of the CHO and CHN H-1 NMR shifts a ... Determination of the relative configuration of vic-amino alcohols. Olofsson, B. Somfai, Peter KTH, Superseded Departments, ... general trend has been observed, making it possible to determine the relative configuration of 1,2-amino alcohols without ...
http://kth.diva-portal.org/smash/record.jsf?pid=diva2:340921
Import of Amino-Alcohols (Excluding Monoethanolamine and Its Salts, Diethanolamine and Its Salts, Triethanolamine and Its Salts...Import of Amino-Alcohols (Excluding Monoethanolamine and Its Salts, Diethanolamine and Its Salts, Triethanolamine and Its Salts...
Import of Amino-Alcohols (Excluding Monoethanolamine and Its Salts, Diethanolamine and Its Salts, Triethanolamine and Its Salts ... Import of Amino-Alcohols (Excluding Monoethanolamine and Its Salts, Diethanolamine and Its Salts, Triethanolamine and Its Salts ... Finland - Import of Amino-Alcohols (Excluding Monoethanolamine and Its Salts, Diethanolamine and Its Salts, Triethanolamine and ... Finland - Import of Amino-Alcohols (Excluding Monoethanolamine and Its Salts, Diethanolamine and Its Salts, Triethanolamine and ...
https://www.nationmaster.com/nmx/timeseries/finland-import-of-amino-alcohols-excluding-monoethanolamine-and-its-salts-diethanolamine-and-its-salts-triethanolamine-and-its-salts
Preparation of Mesoporous Silica-Supported Chiral Amino Alcohols for the Enantioselective Addition of Diethylzinc to Aldehyde...Preparation of Mesoporous Silica-Supported Chiral Amino Alcohols for the Enantioselective Addition of Diethylzinc to Aldehyde...
The immobilized amino alcohols served as a heterogeneous chiral catalyst for the asymmetric addition of diethylzinc to ... Preparation of Mesoporous Silica-Supported Chiral Amino Alcohols for the Enantioselective Addition of Diethylzinc to Aldehyde ... The developed catalytic process yielded optically enriches secondary aromatic alcohols with 92-99% conversion and 70-82% ...
https://www.hindawi.com/journals/jnm/2015/381836/abs/
Conformationally restricted diamines and amino alcohols - EnamineConformationally restricted diamines and amino alcohols - Enamine
Conformationally restricted diamines and amino alcohols The primary structure of a peptide can be formally considered as a ... Conformationally restricted amino alcohols. All products are >96% chemically pure, and >95% (mostly > 99%) optically pure. ... The arrangement of amino groups in these diamines is similar to that in peptide chains of the -sheet secondary structures. High ... The arrangement of amino groups in some molecules is virtually constrained whereas structures of other proposed diamines allow ...
https://enamine.net/research/product-focus/125-conformationally-restricted-diamines-and-amino-alcohols
Microwave-assisted Synthesis of β-Amino AlcoholsMicrowave-assisted Synthesis of β-Amino Alcohols
Introduction β-amino alcohols, also known as vicinal amino alcohols or 1,2-amino alcohols, can be found in naturally occurring ... Amino acids containing a β-amino alcohol. Another well-known example of a naturally occurring amino alcohol is bestatin (3) ( ... Amino alcohol 22 71 was obtained in 90% yield with only a trace amount of the regioisomeric amino alcohol according to GC-MS ... A number of non-naturally occurring β-amino alcohols have demonstrated pharmacological activity. One example is amino alcohol 9 ...
https://www.docme.ru/doc/4250781/microwave-assisted-synthesis-of-%CE%B2-amino-alcohols
Ice addiction pales into insignificance compared to harms linked to alcohol abuse, AMA says - ABC News (Australian...Ice addiction 'pales into insignificance' compared to harms linked to alcohol abuse, AMA says - ABC News (Australian...
... arguing its focus on methamphetamine is misplaced and alcohol abuse is a far more pressing issue. ... Ice addiction pales into insignificance compared to harms linked to alcohol abuse, AMA says. The World Today ... Photo: Dr Gannon said the issue of alcohol abuse needs to be given the same amount of attention as ice. (AAP: Mick Tsikas) ... Is alcohol more dangerous than ice?. Alex Wodak, president of the Australian Drug Law Reform Foundation, said both drugs were ...
https://www.abc.net.au/news/2017-08-02/governments-focus-on-methamphetamine-misplaced,-ama-says/8767664
Amidation of triglycerides by amino alcohols and their impact on plant oil-derived polymers - Polymer Chemistry (RSC Publishing)Amidation of triglycerides by amino alcohols and their impact on plant oil-derived polymers - Polymer Chemistry (RSC Publishing)
Twenty one amino alcohols, varying in alcohol substitutions, linkers and amino substitutions, were respectively reacted with ... The structural factors of amino alcohols controlled their reactivity in amidation. Wh ... Amidation of plant oils with amino alcohols was methodologically examined. ... Amidation of plant oils with amino alcohols was methodologically examined. Twenty one amino alcohols, varying in alcohol ...
https://pubs.rsc.org/en/content/articlelanding/2016/py/c6py00048g
Plasmodium falciparum: role of absolute stereochemistry in the antimalarial activity of synthetic amino alcohol antimalarial...Plasmodium falciparum: role of absolute stereochemistry in the antimalarial activity of synthetic amino alcohol antimalarial...
The enantiomers of amino alcohol antimalarial agents in which the amine is part of an acyclic group, such as in halofantrine, ... This large a differential between the activity of (+)- and (-)-isomers was not observed for other synthetic amino alcohol ... Thus, the effect of absolute stereochemistry of the amino alcohol antimalarial agents on antimalarial activity appears to ... Plasmodium falciparum: role of absolute stereochemistry in the antimalarial activity of synthetic amino alcohol antimalarial ...
https://www.ncbi.nlm.nih.gov/pubmed/8513873?dopt=Abstract
Enzymatic Cascade Reactions for the Synthesis of Chiral Amino Alcohols from L-lysine | ProtocolEnzymatic Cascade Reactions for the Synthesis of Chiral Amino Alcohols from L-lysine | Protocol
Chiral amino alcohols are versatile molecules for use as scaffolds in organic synthesis. Starting from L-lysine, we synthesize ... Chiral amino alcohols are versatile molecules for use as auxiliaries or scaffolds in organic synthesis6. The amino alcohol ... 7. NMR Analysis of Purified Amino Alcohols. *Dissolve purified amino alcohols in D2O (700 µL) and transfer the solution to a ... but access to chiral γ-amino alcohols or secondary amino alcohols often requires tedious synthetic pathways together with ...
https://www.jove.com/video/56926/enzymatic-cascade-reactions-for-synthesis-chiral-amino-alcohols-from
Separation of amino alcohols using divalent dipeptides as counter ions in aqueous CESeparation of amino alcohols using divalent dipeptides as counter ions in aqueous CE
The dipeptides form ion pairs with amino alcohols in the BGE and facilitate the separation of amino alcohols. High ... Association constants for ion pairs between divalent dipeptides and amino alcohols can be used to enhance selectivity for amino ... Separation of amino alcohols using divalent dipeptides as counter ions in aqueous CE. Haglöf, Jakob Uppsala University, ... No chiral separation of amino alcohols was observed when using the dipeptides as ion-pairing chiral selectors in aqueous BGE, ...
http://uu.diva-portal.org/smash/record.jsf?pid=diva2:319700
Enantiomeric Separation of Chiral Amines and Amino Alcohols Using Acetylated β-Cyclodextrin Stationary Phase by High...Enantiomeric Separation of Chiral Amines and Amino Alcohols Using Acetylated β-Cyclodextrin Stationary Phase by High...
Keywords: Enantiomeric separation, Chiral stationary phase, Acetylated β-cyclodextrin, Chiral amine, Chiral amino alcohol ... Enantiomeric Separation of Chiral Amines and Amino Alcohols Using Acetylated β-Cyclodextrin Stationary Phase by High- ... exhibits excellent performance for the separation of chiral amines and amino alcohols in reversed phase mode. Conventional ...
https://www.jstage.jst.go.jp/article/jpchrom/37/2/37_2015.036/_article
IDEALS @ Illinois: Stereoselective synthesis of 1,2-disubstitued βeta-amino alcohols and amino thiolsIDEALS @ Illinois: Stereoselective synthesis of 1,2-disubstitued βeta-amino alcohols and amino thiols
Stereoselective synthesis of 1,2-disubstitued βeta-amino alcohols and amino thiols. Welcome to the IDEALS Repository. ... Stereoselective synthesis of 1,2-disubstitued βeta-amino alcohols and amino thiols. Roth, Aaron ... Stereoselective synthesis of 1,2-disubstitued βeta-amino alcohols and amino thiols. ... 2-amino alcohols. A number of methods are examined prior to the identification of 1,2-conjugate addition of aryl and alkyl ...
https://www.ideals.illinois.edu/handle/2142/108470
Browsing Masters Theses by Subject 3-Amino AlcoholBrowsing Masters Theses by Subject "3-Amino Alcohol"
The Diastereoselective Synthesis of 1,3-Diamines and Amino Alcohols via 2-Azaallyl Anion Ring-Opening of Aziridines and ... Among these, the 1,3-diamine and 1,3-amino alcohol scaffolds are important ... ... Browsing Masters Theses by Subject "3-Amino Alcohol". 0-9. A. B. C. D. E. F. G. H. I. J. K. L. M. N. O. P. Q. R. S. T. U. V. W ...
https://dukespace.lib.duke.edu/dspace/handle/10161/2493/browse?type=subject&value=3-Amino+Alcohol
Amino Acid-Urea Cream - Side Effects, Uses, Dosage, Overdose, Pregnancy, Alcohol | RxWikiAmino Acid-Urea Cream - Side Effects, Uses, Dosage, Overdose, Pregnancy, Alcohol | RxWiki
Get up-to-date information on Amino Acid-Urea Cream side effects, uses, dosage, overdose, pregnancy, alcohol and more. Learn ... How was your experience with Amino Acid-Urea Cream?. First, a little about yourself. Male Female ... Amino Acid-Urea Cream is a brand name medication included in the following groups of medications: Carbamide products, Solutions ... Amino Acid-Urea Cream consists of multiple generic medications. The generic medications are listed below. ...
https://www.rxwiki.com/amino-acid-urea-cream
Galactose Oxidase Variants for the Oxidation of Amino Alcohols in Enzyme Cascade Synthesis | Research Explorer | The University...Galactose Oxidase Variants for the Oxidation of Amino Alcohols in Enzyme Cascade Synthesis | Research Explorer | The University...
Galactose Oxidase Variants for the Oxidation of Amino Alcohols in Enzyme Cascade Synthesis. Research output: Contribution to ... Another variant, M3-5, was found to exhibit activity towards free and N-Cbz-protected aliphatic and aromatic amino alcohols ... The use of selected engineered galactose oxidase (GOase) variants for the oxidation of amino alcohols to aldehydes under mild ... HomeResearchResearch ExplorerPublicationsGalactose Oxidase Variants for the Oxidation of Amino Alcoho... ...
https://www.research.manchester.ac.uk/portal/en/publications/galactose-oxidase-variants-for-the-oxidation-of-amino-alcohols-in-enzyme-cascade-synthesis
China 4-Dodecyl Benzene Sulfonyl Azide, China O-Nitrobenzylalcohol, China O-Amino benzyl alcohol, Products Catalog1China 4-Dodecyl Benzene Sulfonyl Azide, China O-Nitrobenzylalcohol, China O-Amino benzyl alcohol, Products Catalog1
O-Amino benzyl alcohol. Yizheng EAST Chemical Co., Ltd.(Yizheng EAST Chemical Co., Ltd.) More>>. ...
http://chemnet.com/ChinaSuppliers/14820/Products-Catalog-Pharmaceuticals%20and%20Biochemicals-1.html
Essential Amino Acid Supplement Lowers Intrahepatic Lipid despite Excess Alcohol Consumption[v1] | PreprintsEssential Amino Acid Supplement Lowers Intrahepatic Lipid despite Excess Alcohol Consumption[v1] | Preprints
We have previously demonstrated that an essential amino acid supplement (EAAS) improved protein synthesis and reduced ... indicating chronic and excess alcohol consumption. Based on these results, we conclude that 13 grams of proprietary EAAS ... and blood lipids in individuals with mild to moderate alcohol use disorder (AUD). Following consent, determination of ... Excess alcohol consumption is a top risk factor for death and disability. Fatty liver will likely develop and the risk of liver ...
https://www.preprints.org/manuscript/201912.0265/v1
Biodegradable microfluidic scaffolds for tissue engineering from amino alcohol-based poly(ester amide) elastomers. | Harvard...Biodegradable microfluidic scaffolds for tissue engineering from amino alcohol-based poly(ester amide) elastomers. | Harvard...
Biodegradable microfluidic scaffolds for tissue engineering from amino alcohol-based poly(ester amide) elastomers. ... Biodegradable microfluidic scaffolds for tissue engineering from amino alcohol-based poly(ester amide) elastomers. ... Biodegradable microfluidic scaffolds for tissue engineering from amino alcohol-based poly(ester amide) elastomers. ...
https://connects.catalyst.harvard.edu/Profiles/display/844701
Diastereoselective Synthesis of gamma -Hydroxy-beta -Amino Alcohols and (2S,3S)-beta -Hydroxyleucine from Chiral D-(N,N...Diastereoselective Synthesis of gamma -Hydroxy-beta -Amino Alcohols and (2S,3S)-beta -Hydroxyleucine from Chiral D-(N,N...
... amino alcs. II (R = CHMe2, Me, Ph, Bu) in good yield. Transformation of II (R = CHMe2) into (2S,3S)-beta -hydroxyleucine (III) ... Alcohols Role: SPN (Synthetic preparation) ; PREP (Preparation) (amino ; hydroxy; diastereoselective synthesis of hydroxy amino ... Home , Diastereoselective Synthesis of gamma -Hydroxy-beta -Amino Alcohols and (2S,3S)-beta -Hydroxyleucine from Chiral D-(N,N- ... Diastereoselective Synthesis of gamma -Hydroxy-beta -Amino Alcohols and (2S,3S)-beta -Hydroxyleucine from Chiral D-(N,N- ...
https://infoscience.epfl.ch/record/158177
p-Amino Phenylethyl Alcohol, China p-Amino Phenylethyl Alcohol Manufacturers, China p-Amino Phenylethyl Alcohol Suppliers -...p-Amino Phenylethyl Alcohol, China p-Amino Phenylethyl Alcohol Manufacturers, China p-Amino Phenylethyl Alcohol Suppliers -...
... provide p-Amino Phenylethyl Alcohol product and the products related with China p-Amino Phenylethyl Alcohol - cidic ... China p-Amino Phenylethyl Alcohol Suppliers and China p-Amino Phenylethyl Alcohol Manufacturers, ... China p-Amino Phenylethyl Alcohol Suppliers, China p-Amino Phenylethyl Alcohol Manufacturers. ... Send your inquiry to p-Amino Phenylethyl Alcohol supplier. Enter your inquiry here and then click Send. Enter between 20 to ...
http://www.chemnet.com/ChinaSuppliers/24165/p-Amino-Phenylethyl-Alcohol--2353445.html
DerivativesEstersAdding amino acidsDiamines and amino alcoholsKetonesAcids with alcoholsSynthesize amino alcoholsAromaticAminesAldehydesAbstractEnantiomers of amino alcoholAmidationFatty alcoholsSecondary alcoholsEssential aminoOxidationSeparationCatalystsEthanolScaffoldsHydroxyConcentrationsDerived from amino acidsCompoundsMoleculesNatural amino acidsBeta-aminoReactionAziridinesProteinsSubstancesIncluding amino acidEthylBiocatalyticDiastereoselective SynthesisOrganicConsumptionSyntheticMethylAddictionSelectivity2019TertiaryAcid therapySterolsAlcsMetabolismSaccharomycesSubstrateBiochemicalsNeurotransmitterOxygenDehydrogenaseProtein
Derivatives4
  • The present invention relates to a process for the preparation of amino alcohol derivatives or salts thereof. (patents.com)
  • The results obtained make those two ( S )-amino-alcohol quinoline derivatives good candidates for the development of new artemisinin-based combination therapy (ACT), hopefully with fewer neurologic side effects than those currently marketed ACT, including MQ. (biomedcentral.com)
  • Quantitative Structure Activity Relationships Study of Amino Alcohols Derivatives as Antifungal Agents Against Candida. (ajphs.com)
  • A catalytic protocol for the base-mediated amidation of unactivated esters with amino alcohol derivatives is reported. (strath.ac.uk)
Esters1
  • Amino-alcohols, their esters and esters with only one oxygen function and their salts excluding monoethanolamine and its salts as well as diethanolamine, its salts, triethanolamine and its salts. (statista.com)
Adding amino acids1
  • Proof of principle that high amino acid concentrations will generate higher alcohol levels has been obtained by adding amino acids exogenously. (omicsonline.org)
Diamines and amino alcohols1
  • Recently, Enamine has initiated an in-house project focusing on multigram scale syntheses of known and novel conformationally restricted monoprotected diamines and amino alcohols which can be used as molecular scaffolds in rational design of drugs and peptidomimetics bearing two different functional groups in well defined spatial arrangements. (enamine.net)
Ketones5
  • The immobilized amino alcohols served as a heterogeneous chiral catalyst for the asymmetric addition of diethylzinc to aldehydes and transfer hydrogenation to ketones. (hindawi.com)
  • These strategies include additions to reagents to amino acid derived aldehydes, additions to amino acid derived ketones and oxidation of allyl amine. (aalto.fi)
  • In a related fashion, alcohol oxidases convert primary and secondary alcohols to aldehydes and ketones, respectively. (springer.com)
  • Trifluoroacetylation of the 3 position hydroxyl groups after pentylation of the 2,6 hydroxyl groups creates a phase with high selectivity for oxygen containing analytes in the form of alcohols, ketones, acids, aldehydes, lactones, and halogenated compounds. (sigmaaldrich.com)
  • Chiral primary amino amide organocatalysts were designed and synthesized as new organocatalysts for the enantioselective Michael addition of 4-hydroxycoumarin with α,β-unsaturated ketones to produce chiral warfarin (up to 56% ee with up to 92% yield). (elsevier.com)
Acids with alcohols4
  • We present a method for N-alkylation of unprotected amino acids with alcohols with excellent yield and stereochemistry retention. (sciencemag.org)
  • We report the first powerful catalytic strategy for the direct N-alkylation of unprotected α-amino acids with alcohols. (cloudfront.net)
  • Herein, we demonstrate the catalytic direct N-alkylation of amino acids with alcohols as inexpensive and renewable reaction partners in a fully atom-economic process avoiding racemization and producing only water as by-product ( Fig. 2B ). (cloudfront.net)
  • B ) Sustainable, waste-free direct coupling of α-amino acids with alcohols. (cloudfront.net)
Synthesize amino alcohols2
  • We have developed an efficient, regioselective route to synthesize amino alcohols via microwaveassisted aminolysis of several hindered and unhindered epoxides using amine nucleophiles of varying strengths. (docme.ru)
  • Starting from L-lysine, we synthesize amino alcohols by an enzymatic cascade reaction combining diastereoselective C-H oxidation catalyzed by dioxygenase followed by cleavage of the carboxylic acid moiety of the corresponding hydroxyl amino acid by a decarboxylase. (jove.com)
Aromatic3
  • The developed catalytic process yielded optically enriches secondary aromatic alcohols with 92-99% conversion and 70-82% enantioselectivity. (hindawi.com)
  • Thus, the effect of absolute stereochemistry of the amino alcohol antimalarial agents on antimalarial activity appears to depend upon both the flexibility of the amine portion of the molecule and the structure of the aromatic portion of the molecule. (nih.gov)
  • Another variant, M3-5, was found to exhibit activity towards free and N-Cbz-protected aliphatic and aromatic amino alcohols allowing the synthesis of lactams such as 3,4-dihydronaphthalen-1(2H)-one, 2-pyrrolidone and valerolactam in one-pot tandem reactions with xanthine dehydrogenase (XDH) or aldehyde oxidase (PaoABC). (manchester.ac.uk)
Amines6
  • The acetylated β-cyclodextrin phase (SUMICHIRAL TM OA-7700) exhibits excellent performance for the separation of chiral amines and amino alcohols in reversed phase mode. (go.jp)
  • The obtained compounds are important building blocks, which can be orthogonally deprotected to give either free alcohols, amines, or terminal alkynes. (epfl.ch)
  • α-Amino acids are a prominent class of naturally occurring chiral compounds ( 1 ) that may serve as renewable alternatives to amines derived from fossil resources ( Fig. 1A ) ( 2 , 3 ). (cloudfront.net)
  • Reactions of ethyl (2S)-lactate with various amines affords lactamides that are reduced with borane-methyl sulfide in the presence of boron trifluoride etherate to generate enantiomerically pure β-amino alcohols in good yield. (northumbria.ac.uk)
  • Chiral N-diphenylphosphiny 1-3-quinoly lamines (DPP amines) with up to 74.9% e.e. were obtained by the enantioselective alkylation using dialkylzincs in the presence of various chiral amino alcohols. (elsevier.com)
  • Aldehydes, carboxylic acids and epoxides separate better on the gamma while alcohols, alcohol amines and other linear molecules separate better on the beta derivative. (sigmaaldrich.com)
Aldehydes3
  • The use of selected engineered galactose oxidase (GOase) variants for the oxidation of amino alcohols to aldehydes under mild conditions in aqueous systems is reported. (manchester.ac.uk)
  • In this review, the mechanism of copper-containing and flavoprotein alcohol oxidases is discussed in view of their ability to accept electronically activated or non-activated alcohols and their propensity towards over-oxidation of aldehydes yielding carboxylic acids. (springer.com)
  • In general, N-alkylation of α-amino acids is performed using stoichiometric methods, such as reductive alkylation with aldehydes, which use inorganic reductants or nucleophilic substitution with alkyl halides ( 14 ). (cloudfront.net)
Abstract1
  • ii ABSTRACT β-amino alcohols are common substructures in many biologically active compounds and can also be used as catalysts for asymmetric reactions. (docme.ru)
Enantiomers of amino alcohol2
  • The enantiomers of amino alcohol antimalarial agents in which the amine is part of an acyclic group, such as in halofantrine, displayed little, if any, differential antimalarial activity. (nih.gov)
  • Pure ( S ) enantiomers of amino-alcohol quinolines previously displayed a good in vitro anti-malarial activity. (biomedcentral.com)
Amidation1
  • This amidation reaction exhibits a broad substrate scope and good functional group tolerance, and offers a powerful means for the C(sp 3 )-H functionalization of alcohols. (elsevier.com)
Fatty alcohols3
  • An iron-catalyzed route to mono- N -alkyl amino acids using renewable fatty alcohols is also described that represents an ideal green transformation for obtaining fully bio-based surfactants. (cloudfront.net)
  • Fatty alcohols play a variety of biological roles in all kingdoms of life. (carleton.ca)
  • Fatty acyl reductase (FAR) enzymes catalyze the reduction of fatty acyl-coenzyme A (CoA) or fatty acyl-acyl carrier protein (ACP) substrates to primary fatty alcohols. (carleton.ca)
Secondary alcohols1
  • The secondary alcohols were obtained in 76-95% yield with 57-96% enantiomeric excesses. (metu.edu.tr)
Essential amino4
  • The authors present an interesting study of the effects of essential amino acids on hepatic lipids, which may have important therapeutic implications. (preprints.org)
  • A quick review of the literature regarding the effects of essential amino acids on lipids and processes that impact their metabolism would help advance the Discussion and provide guidance to future research. (preprints.org)
  • The manner in which the addiction depletes the body of essential amino acids can exacerbate withdrawal symptoms and prolong the entire detoxification process. (ranchcreekrecovery.com)
  • In a manner, the essential amino acids your body produces function as life-giving and life-balancing elements. (ranchcreekrecovery.com)
Oxidation6
  • N -Heterocycles can be prepared using alcohol oxidation as a key synthetic step. (rsc.org)
  • The catalytic systems have been tested in the liquid phase oxidation of aminoalcohols (serinol and ethanolamine) and the corresponding polyols (glycerol and ethylene glycol). (mdpi.com)
  • GOase variant F2 catalyses the regioselective oxidation of N-carbobenzyloxy (Cbz)-protected 3-amino-1,2-propanediol to the corresponding α-hydroxyaldehyde which was then used in an aldolase reaction. (manchester.ac.uk)
  • 2010 ). In this context, the oxidation of alcohols is an important transformation in synthetic chemistry, which allows to introduce carbonyl groups, which represent excellent acceptors for C -, N -, O - and S -nucleophiles and thereby allows the extension of a given carbon backbone. (springer.com)
  • In flavoprotein oxidases, the oxidation proceeds via two half reactions, where the alcohol is first oxidised by a two-electron transfer during the reductive half reaction , yielding reduced flavin. (springer.com)
  • The alcohol-related surplus of NADH causes alterations in fatty acid metabolism, such as slowing down the breakdown or oxidation of fatty acids. (52.52.137)
Separation4
  • The dipeptides form ion pairs with amino alcohols in the BGE and facilitate the separation of amino alcohols. (diva-portal.org)
  • No chiral separation of amino alcohols was observed when using the dipeptides as ion-pairing chiral selectors in aqueous BGE, but addition of methanol to the BGE promoted enantioselectivity. (diva-portal.org)
  • We developed a new method for chiral separation of fourteen amino alcohols by nonaqueous capillary electrophoresis (NACE) with the D-(+)-gluconic acid δ-lactone-boric acid complex as chiral selector. (bvsalud.org)
  • 2002. Effects of vegetable extracts by solvent separation on alcohol dehydrogenase activity from Saccharomyces cerevisiae. (koreascience.or.kr)
Catalysts2
  • This comparison allowed us to state that the presence of amino groups has a crucial effect on the catalytic performance, in particular decreasing the durability to the catalysts, but did not substantially vary the selectivity. (mdpi.com)
  • Setting our design criteria, the ultimate method should be applicable to the exclusive use of biorenewable feedstock amino acids and alcohols, be based on abundant Fe-based catalysts, produce only innocuous water as side product, and directly lead to a common product, that is, a surfactant. (cloudfront.net)
Ethanol17
  • Alcohols are a group of organic compounds, including ethanol ( drinking alcohol ) and methanol (wood alcohol) among many others. (wikimedia.org)
  • For the specific type of alcohol known as ethanol, see Category:Ethanol . (wikimedia.org)
  • For ethanol used as drinking alcohol, see Category:Alcohol . (wikimedia.org)
  • For beverages containing ethanol as drinking alcohol, see Category:Alcoholic beverages . (wikimedia.org)
  • 12. The composition of claim 11 wherein said alcohol is ethanol. (google.es)
  • Effects of chronic alcohol consumption on plasma branched-chain amino acids and alanine concentrations were evaluated, and basal blood concentrations of these amino acids were estimated after chronic ethanol intake and after a withdrawal period in 30 admitted alcoholics. (geoscience.net)
  • The safe permissible intake of alcohol varies legally from country to country and can be broadly classified as 8- 20 grams of ethanol per day. (medindia.net)
  • For ethanol found in alcoholic drinks, see Alcohol (drug) . (wikipedia.org)
  • [2] The term alcohol originally referred to the primary alcohol ethanol (ethyl alcohol), which is used as a drug and is the main alcohol present in alcoholic drinks . (wikipedia.org)
  • An important class of alcohols, of which methanol and ethanol are the simplest members, includes all compounds for which the general formula is C n H 2n+1 OH. (wikipedia.org)
  • The meaning of alcohol was extended to distilled substances in general, and then narrowed to ethanol, when "spirits" was a synonym for hard liquor . (wikipedia.org)
  • The word's meaning became restricted to "spirit of wine" (the chemical known today as ethanol ) in the 18th century and was extended to the class of substances so-called as "alcohols" in modern chemistry after 1850. (wikipedia.org)
  • The term ethanol was invented in 1892, blending " ethane " with the "-ol" ending of "alcohol", which was generalized as a libfix . (wikipedia.org)
  • These results indicate that alcohol metabolizing enzyme activities can be enhanced by arginine and methionine, suggesting that arginine and methionine have potent ethanol-metabolizing activities. (koreascience.or.kr)
  • 1988. Effect of acute ethanol administration on human alcohol aldehyde dehydrogenase activity. (koreascience.or.kr)
  • Group 1 (Alcohol) was given a stock diet plus 10% (v/v) ethanol in drinking water. (ubc.ca)
  • At that time, the alcohol group was changed to 30% (v/v) ethanol. (ubc.ca)
Scaffolds2
  • Chiral amino alcohols are versatile molecules for use as scaffolds in organic synthesis. (jove.com)
  • Biodegradable microfluidic scaffolds for tissue engineering from amino alcohol-based poly(ester amide) elastomers. (harvard.edu)
Hydroxy5
  • The reactions of I with Grignard and organocerium reagents were highly stereoselective (Felkin model) to give gamma -hydroxy-beta -amino alcs. (epfl.ch)
  • 24184-43-8 (D-Serine methyl ester) Role: RCT (Reactant), RACT (Reactant or reagent) (diastereoselective synthesis of hydroxy amino alcs. (epfl.ch)
  • 202478-35-1P Role: RCT (Reactant), SPN (Synthetic preparation), PREP (Preparation), RACT (Reactant or reagent) (diastereoselective synthesis of hydroxy amino alcs. (epfl.ch)
  • 202478-38-4P Role: SPN (Synthetic preparation), PREP (Preparation) (diastereoselective synthesis of hydroxy amino alcs. (epfl.ch)
  • An efficient synthesis of a versatile scaffold 3, anti-2-chloro-3-hydroxy ester can be achieved via a boron mediated diastereofacial anti-aldol reaction of 2-(N methylbenzyl-N 2,4,6-trimethylbenzyl)-amino-l-phenylpropanol chloroester 1 and the uridyl aldehyde derivative 2. (nebraska.edu)
Concentrations2
  • Alcohol consumption also had no effect upon maternal plasma glucose and albumin concentrations. (ubc.ca)
  • It is concluded that maternal alcohol consumption produces distinct changes in some maternal and fetal plasma nutrient concentrations (ie. (ubc.ca)
Derived from amino acids2
  • And, of course, those neurotransmitters are derived from amino acids. (coalitionrecovery.com)
  • The last two can be derived from amino acids present in alga. (abo.fi)
Compounds7
  • Vicinal amino alcohols are important structural motifs of bioactive compounds. (epfl.ch)
  • These 1,2-amino alcohol containing compounds range from important physiological constituents of human body, like the hormone epinephrine and the amino acid serine, to peculiar secondary metabolites, like amaminol and calyculin, encountered in deep sea creatures. (aalto.fi)
  • Alcohols are a rich source of compounds from renewable sources, but they have to be activated in order to allow the modification of their carbon backbone. (springer.com)
  • In particular, N -alkyl amino acids are highly valuable as chiral building blocks for the synthesis of pharmaceutically active compounds ( 4 ), biodegradable polymers ( 5 ), ligands for asymmetric catalysis ( 6 ), or in other specialized applications ( Fig. 1B ) ( 7 - 9 ). (cloudfront.net)
  • Despite the obvious potential of N -alkyl amino acids, there is a complete lack of selective catalytic methods to obtain these compounds via direct functionalization of unprotected α-amino acids. (cloudfront.net)
  • Specifically, amino acids are characterized as organic compounds containing amine and carboxyl functional groups with a "side chain" that's unique to each of the different amino acids. (coalitionrecovery.com)
  • HS Code 292250 Amino-alcohol-phenols, amino-acid-phenols and other amino-compounds with oxygen function (excl. (hscode.org)
Molecules1
  • The arrangement of amino groups in some molecules is virtually constrained whereas structures of other proposed diamines allow certain rotational degrees of freedom. (enamine.net)
Natural amino acids2
  • The alternative pathway uses natural amino acids, which are directly coupled with alcohols derived from renewable resources to obtain fully bio-based N -alkyl amino acids. (cloudfront.net)
  • Amino acid therapy is a clinical method of addressing the damage inflicted by your alcohol addiction through a systematic supplemental replacement of the natural amino acids lost throughout the course of your substance use disorder. (ranchcreekrecovery.com)
Beta-amino2
  • The C-2-symmetrical bis-beta -amino alcohols 1-6 were prepared and especially attention is focused on bridges. (edu.hk)
  • which link the two beta -amino alcohol units. (edu.hk)
Reaction1
  • Microwave assisted N-O bond cleavage of novel N-methyl isoxazolidines under mild conditions have been studied and found to afford 1,3-amino alcohols readily with high yield in a short reaction time. (niscair.res.in)
Aziridines2
  • Two alternative and complementary one-pot procedures for the direct transformation of 2-amino alcohols to N-tosyl aziridines are presented. (mdpi.com)
  • De Araújo, M.C.F. Short and Efficient Synthesis of Optically Active N-Tosyl Aziridines from 2-Amino Alcohols. (mdpi.com)
Proteins2
  • However, amino acids are involved in various other types of cellular-level activities and reactions, which is why the residues - byproducts of various processes, events, and functions - that are left by proteins comprised of amino acids are the second-most common substance in the human body. (coalitionrecovery.com)
  • Acetaldehyde, the initial breakdown product of alcohol, is not directly toxic to the hepatocytes (liver cells), but it can bind with proteins in the cells and alter their structure, making liver cells more susceptible to damage. (52.52.137)
Substances2
  • A spokesman for Health Minister Greg Hunt said the National Drug Strategy identified a range of priority substances, including alcohol. (abc.net.au)
  • When the liver is overtaxed by detoxifying harmful substances in alcohol and drugs, its ability to get rid of these fatty acids is compromised. (52.52.137)
Including amino acid1
  • For this reason, Coalition Recovery offers a number of complementary and supplemental therapies, including amino acid therapy for addiction. (coalitionrecovery.com)
Ethyl2
  • Lewis, F , Eichler, MC & Grayson, D 2009, ' Synthesis of β-Amino alcohols via the reduction of lactamides derived from Ethyl (2S)-Lactate with Borane-Methyl Sulfide ', Synlett , vol. 12, pp. 1923-1928. (northumbria.ac.uk)
  • Specifications Hand Sanitizer *Moisturizing with vitamin E *Effective at killing 99.99% of germs Purell Hand Sanitizer Form Gel Active ingredients 62% Food Grade Ethyl Alcohol (The alcohol content can be adjusted from 30%-70% as required) Benifits. (phrmg.org)
Biocatalytic1
  • Overall, this work describes a concise and efficient biocatalytic route to chiral amino alcohols and illustrates an integrated multidisciplinary approach to bioconversion process design and scale-up. (ucl.ac.uk)
Diastereoselective Synthesis1
  • diastereoselective, synthesis with the emphasis on amino acid derived starting materials. (aalto.fi)
Organic2
  • β-Methylphenethylamine (β-Me-PEA, BMPEA), or 1-amino-2-phenylpropane, is an organic compound of the phenethylamine class, and a positional isomer of the drug amphetamine, with which it shares some properties. (wikipedia.org)
  • In chemistry , alcohol is an organic compound that carries at least one hydroxyl functional group (−OH) bound to a saturated carbon atom. (wikipedia.org)
Consumption17
  • Coker, R.H. Essential Amino Acid Supplement Lowers Intrahepatic Lipid despite Excess Alcohol Consumption. (preprints.org)
  • Excess alcohol consumption is a top risk factor for death and disability. (preprints.org)
  • Post-EAAS phosphatidylethanol was elevated and remained unchanged in LD at 407±141 ng/ml and HD at 429±196 ng/ml, indicating chronic and excess alcohol consumption. (preprints.org)
  • Removing these elements through excessive alcohol consumption forces the body to search for alternative sources, even accepting the numbing effects of alcohol as a viable replacement when all else fails. (ranchcreekrecovery.com)
  • In the second stage of alcoholism, alcohol consumption increases in frequency and is no longer tied to special events like partying. (aminoco.com)
  • As a result, when NADH is abundant as a result of alcohol consumption, fatty acids (in the form of triacylglycerols) accumulate in the liver. (52.52.137)
  • How Do You Know if Your Alcohol Consumption Is Damaging Your Liver? (52.52.137)
  • Strachan the benefits associated with moderate alcohol consumption had been ignored while drafting the guidelines. (medindia.net)
  • Take this anonymous self-test to evaluate your alcohol consumption and determine if your drinking pattern poses a risk for hazardous health conditions. (medindia.net)
  • The AMA is calling for stronger policies to curb dangerous excess alcohol consumption. (medindia.net)
  • Alcohol consumption is the main offender. (medindia.net)
  • Effect of maternal alcohol consumption upon plasma. (ubc.ca)
  • The current study was conducted to determine the effect of maternal alcohol consumption upon plasma amino acids, glucose, folic acid, zinc and magnesium levels in rat dams and their fetuses. (ubc.ca)
  • Throughout the experiment daily food consumption by alcohol-treated and pair-fed animals was recorded. (ubc.ca)
  • Maternal alcohol consumption had no significant effect upon maternal or fetal plasma levels of folic acid, zinc, and most amino acids. (ubc.ca)
  • Fetal plasma lactic acid was not significantly affected by maternal alcohol consumption. (ubc.ca)
  • However, fetal hypoglycemia, produced by chronic maternal alcohol consumption, may contribute to the growth retardation seen in the Fetal Alcohol Syndrome. (ubc.ca)
Synthetic5
  • Plasmodium falciparum: role of absolute stereochemistry in the antimalarial activity of synthetic amino alcohol antimalarial agents. (nih.gov)
  • This large a differential between the activity of (+)- and (-)-isomers was not observed for other synthetic amino alcohol antimalarial agents containing a piperidine ring. (nih.gov)
  • Given the importance of the 1,2-amino alcohol motif the synthetic methods to access them are well developed. (aalto.fi)
  • As an alternative to (thermodynamically disfavoured) nicotinamide-dependent alcohol dehydrogenases, alcohol oxidases make use of molecular oxygen but their application is under-represented in synthetic biotransformations. (springer.com)
  • The monograph covers its application -- from natural products to synthetic pharmaceuticals -- detailing complex syntheses using the amino group as templates and modern techniques focussing on the introduction of the amino group. (wiley.com)
Methyl2
  • Higher alcohols, such as n-butanol, isobutanol, isoamyl alcohol (3-methyl-1-butanol) and active amyl alcohol (2-methyl-1-butanol) possess better fuel characteristics than bioethanol, but their production lags behind in terms of commercial viability. (omicsonline.org)
  • 4-amino-α-[(tert-butylamino)methyl]-3,5-dic. (europa.eu)
Addiction13
  • Dealing with the ramifications of an alcohol addiction can take a significant amount of time and effort on your part. (ranchcreekrecovery.com)
  • This means that the longer you struggle with your alcohol addiction, the longer it may take for your body to reset your internal systems to achieve a level of personal homeostasis. (ranchcreekrecovery.com)
  • What is Amino Acid Therapy for Addiction? (ranchcreekrecovery.com)
  • This therapeutic approach assesses the specific deficiencies associated with your alcohol addiction and begins correcting that course through a structured method of amino acid ingestion throughout the recovery process. (ranchcreekrecovery.com)
  • Since there's much overlap between certain psychological disorders and addiction, amino acid therapy can be an extremely effective tool for addiction rehabilitation. (coalitionrecovery.com)
  • On one hand alcohol has been a substance of social lubrication and celebration for thousands of years, but on the other it is, in essence, a poison that can lead to addiction and have devastating personal consequences. (aminoco.com)
  • This article describes the signs of alcohol addiction and what happens when a loved one reaches the end stages of alcohol abuse. (aminoco.com)
  • Some people can drink alcohol regularly and never develop an alcohol addiction problem. (aminoco.com)
  • It also begins an addiction pattern whereby people begin to develop a dependency on the feeling that alcohol provides. (aminoco.com)
  • Alcohol dependency is a habit that can be stopped, but alcohol addiction is characterized by an inability to curb the harmful use of alcohol. (aminoco.com)
  • Amino Acid Therapy for Addiction is an innovative approach and can help restore brain function while reducing cravings & withdrawal symptoms. (serenityspringsrecovery.com)
  • Our Amino Acid Therapy is offered as a treatment for addiction. (serenityspringsrecovery.com)
  • There are four different NeuroRecover ™ intravenous formulas available, consisting of unique combinations of a few select amino acids in a base of NAD (nicotinamide adenine dinucleotide), that are specifically designed to assist the nervous system in repairing those receptors damaged by substance use, as well as by dopamine-damaging activities (e.g. gambling and pornography addiction). (serenityspringsrecovery.com)
Selectivity2
  • A stronger interaction and higher selectivity of amino alcohols was observed when the dipeptides were used as divalent counter ions, than in monovalent or uncharged form. (diva-portal.org)
  • Association constants for ion pairs between divalent dipeptides and amino alcohols can be used to enhance selectivity for amino alcohols in CZE. (diva-portal.org)
20191
  • In 2019, the country was ranked number 16 comparing other countries in Import of Amino-Alcohols (Excluding Monoethanolamine and Its Salts, Diethanolamine and Its Salts, Triethanolamine and Its Salts) with €3,845,112. (nationmaster.com)
Tertiary1
  • Simple monoalcohols that are the subject of this article include primary (RCH 2 OH), secondary (R 2 CHOH) and tertiary (R 3 COH) alcohols. (wikipedia.org)
Acid therapy8
  • In particular, amino acid therapy focuses on replenishing a specific set of amino acids within the brain of a recovering addict in order to improve everything from brain functioning to mood stability to overall physical wellbeing. (ranchcreekrecovery.com)
  • While the overall benefit of amino acid therapy is a healthy and functioning mind and body, the specific benefits of this form of treatment can be isolated into a few key concepts. (ranchcreekrecovery.com)
  • By identifying which amino acids in particular are replenished and enhanced through amino acid therapy, you can better understand the beneficial impact of this therapeutic approach during your recovery journey. (ranchcreekrecovery.com)
  • Amino acid therapy aids in balancing these catecholamines and positively impacting every facet of your daily existence. (ranchcreekrecovery.com)
  • Amino acid therapy directly impacts GABA by restoring equilibrium to your system and allowing you to maintain a composed and relaxed manner during the more difficult moments of your recovery journey. (ranchcreekrecovery.com)
  • however, there's another important facet of amino acids that is important to the ability of amino acid therapy to be beneficial: Neurotransmitters - which are responsible for a wide variety of functions by relaying electrical signals between different parts of the brain - are made largely from amino acids that are obtained from the protein in one's diet. (coalitionrecovery.com)
  • NeuroRecover™ also known as infusion therapy or amino acid therapy uses proprietary amino acid based intravenous preparations to assist neurological repair of the addicted brain. (serenityspringsrecovery.com)
  • NeuroRecover ™ is an amino acid therapy administered as a daily intravenous solution for eight hours a day. (serenityspringsrecovery.com)
Sterols1
  • sterols) together with suitable alcohol oxidases, their microbial source, relative activities and (stereo)selectivities. (springer.com)
Alcs2
Metabolism3
  • It is important to know how much of each AA is present, as some amino acids exert specific effects on body systems that can impact lipid metabolism. (preprints.org)
  • alcohol metabolism. (ncl.ac.uk)
  • Alanine-transferase (ALT) is an enzyme involved in amino acid metabolism and is uniquely derived from the liver. (52.52.137)
Saccharomyces2
  • In Saccharomyces cerevisiae, higher alcohol production is via amino acid catabolism through the Ehrlich pathway, but the yield is relatively low. (omicsonline.org)
  • The present study examined the comparative effects of various amino acids on the alcohol dehydrogenase (ADH) and acetaldehyde dehydrogenase (ALDH) activities of yeast Saccharomyces cereviciae and rat liver homogenate in vitro. (koreascience.or.kr)
Substrate1
  • ESR5 focuses on expanding the substrate scope of amino acid hydroxylases in order to create a generally applicable three-step cascade. (biocascades.eu)
Biochemicals1
  • Chiral amino alcohols represent an important class of value-added biochemicals and pharmaceutical intermediates. (ucl.ac.uk)
Neurotransmitter3
  • GABA (Gama amino butyric acid) is the major inhibitory neurotransmitter of the brain, it keeps the excitatory system from becoming overactive, while also relaxing and calming the entire brain.Low levels are associated with substance abuse, anxiety, depression, panic attacks, seizures, and mood swings. (ranchcreekrecovery.com)
  • Granted, it's not a direct conversion from amino acid to neurotransmitter, but without amino acids, the brain would be lacking a material that's crucial to the production of essential neurotransmitters. (coalitionrecovery.com)
  • Drugs and alcohol damage the nervous system by artificially stimulating neurotransmitter receptors. (serenityspringsrecovery.com)
Oxygen1
  • Furthermore, the basic elements of an amino acid include carbon, hydrogen, oxygen, and nitrogen, but the "side chain" can be a much wider variety of different elements. (coalitionrecovery.com)
Dehydrogenase3
  • The interaction between alcohol and the liver begins when approximately 80% of the alcohol you ingest arrives at the liver where much of the alcohol dehydrogenase in the body is situated. (52.52.137)
  • The enzyme that metabolizes alcohol, alcohol dehydrogenase, removes a hydrogen atom from alcohol and transfers it to a molecule of NAD. (52.52.137)
  • We propose below that the eutG gene encodes an alcohol dehydrogenase. (asm.org)
Protein5
  • We have previously demonstrated that an essential amino acid supplement (EAAS) improved protein synthesis and reduced intrahepatic lipid in the elderly. (preprints.org)
  • Determine, under different quantities, how much of Serine, Ser or S, proteinogenic amino acid nutrient can be found in Soy protein concentrate, produced by alcohol extraction . (traditionaloven.com)
  • As such, materials that make up protein - called amino acids - would likewise be extremely important for similar reasons. (coalitionrecovery.com)
  • 2.) Generation of a broad-spectrum amino acid decarboxylase by protein engineering. (biocascades.eu)
  • We identified individual amino acids that affect protein levels or 16:0-CoA versus 18:0-CoA specificity by expressing in yeast FAR5 and FAR8 domain-swap chimeras and site-specific mutants. (carleton.ca)
SNAC-tag for sequence-specific chemical protein cleavage | Nature Methods
SNAC-tag for sequence-specific chemical protein cleavage | Nature Methods (nature.com)
Reductive dearomative arylcarboxylation of indoles with CO 2 via visible-light photoredox catalysis | Nature Communications
Reductive dearomative arylcarboxylation of indoles with CO 2 via visible-light photoredox catalysis | Nature Communications (nature.com)
The synthesis of N-heterocycles via copper/TEMPO catalysed aerobic oxidation of amino alcohols - Green Chemistry (RSC...
The synthesis of N-heterocycles via copper/TEMPO catalysed aerobic oxidation of amino alcohols - Green Chemistry (RSC... (pubs.rsc.org)
Materials | Free Full-Text | Amino Alcohol Oxidation with Gold Catalysts: The Effect of Amino Groups
Materials | Free Full-Text | Amino Alcohol Oxidation with Gold Catalysts: The Effect of Amino Groups (mdpi.com)
Ice addiction 'pales into insignificance' compared to harms linked to alcohol abuse, AMA says - ABC News (Australian...
Ice addiction 'pales into insignificance' compared to harms linked to alcohol abuse, AMA says - ABC News (Australian... (abc.net.au)
Direct N-alkylation of unprotected amino acids with alcohols | Science Advances
Direct N-alkylation of unprotected amino acids with alcohols | Science Advances (advances.sciencemag.org)
Amidation of triglycerides by amino alcohols and their impact on plant oil-derived polymers - Polymer Chemistry (RSC Publishing)
Amidation of triglycerides by amino alcohols and their impact on plant oil-derived polymers - Polymer Chemistry (RSC Publishing) (pubs.rsc.org)
Artificial Sweeteners - effects, food, nutrition, body, diet, carbohydrate, health, amino
Artificial Sweeteners - effects, food, nutrition, body, diet, carbohydrate, health, amino (faqs.org)
Beibei Guo - Research database - University of Groningen
Beibei Guo - Research database - University of Groningen (rug.nl)
4-amino-α-[(tert-butylamino)methyl]-3,5-dic... - Lista de sustancias del anexo III - ECHA
4-amino-α-[(tert-butylamino)methyl]-3,5-dic... - Lista de sustancias del anexo III - ECHA (echa.europa.eu)
Novel thidiazuron-derived inhibitors of cytokinin oxidase/dehydrogenase | SpringerLink
Novel thidiazuron-derived inhibitors of cytokinin oxidase/dehydrogenase | SpringerLink (link.springer.com)
Alcohol - Wikipedia
Alcohol - Wikipedia (en.wikipedia.org)
Salt Imports in Spain
Salt Imports in Spain (nationmaster.com)
Alcohol Legal Suppliers, all Quality Alcohol Legal Suppliers on Alibaba.com
Alcohol Legal Suppliers, all Quality Alcohol Legal Suppliers on Alibaba.com (alibaba.com)
Wellbutrin SR (Bupropion Hydrochloride Sustained-Release): Side Effects, Interactions, Warning, Dosage & Uses
Wellbutrin SR (Bupropion Hydrochloride Sustained-Release): Side Effects, Interactions, Warning, Dosage & Uses (rxlist.com)
Which of the following ligands is expected to be monodentate, | bartleby
Which of the following ligands is expected to be monodentate, | bartleby (bartleby.com)
These highlights do not include all the information needed to use BUPROPION HYDROCHLORIDE EXTENDED-RELEASE TABLETS (SR) safely...
These highlights do not include all the information needed to use BUPROPION HYDROCHLORIDE EXTENDED-RELEASE TABLETS (SR) safely... (dailymed.nlm.nih.gov)
EPR Achievements: The Case Of Paint In The U.S. - Coatings World
EPR Achievements: The Case Of Paint In The U.S. - Coatings World (coatingsworld.com)
Solid-phase synthesis and chemical space analysis of a 190-membered alkaloid/terpenoid-like library | PNAS
Solid-phase synthesis and chemical space analysis of a 190-membered alkaloid/terpenoid-like library | PNAS (pnas.org)
Higher Performance, Higher Solids - A New Platform For High-Solids Alkyds - Coatings World
Higher Performance, Higher Solids - A New Platform For High-Solids Alkyds - Coatings World (coatingsworld.com)
Catalytic asymmetric reductive hydroalkylation of enamides and enecarbamates to chiral aliphatic amines | Nature Communications
Catalytic asymmetric reductive hydroalkylation of enamides and enecarbamates to chiral aliphatic amines | Nature Communications (nature.com)
Enzymatic Cascade Reactions for the Synthesis of Chiral Amino Alcohols from L-lysine | Protocol
Enzymatic Cascade Reactions for the Synthesis of Chiral Amino Alcohols from L-lysine | Protocol (jove.com)
'protective clothing' Protocols and Video...
'protective clothing' Protocols and Video... (jove.com)
'chemical industry' Protocols and Video...
'chemical industry' Protocols and Video... (jove.com)
Supramolecular ionogels prepared with bis(amino alcohol)oxamides as gelators: ionic transport and mechanical properties - RSC...
Supramolecular ionogels prepared with bis(amino alcohol)oxamides as gelators: ionic transport and mechanical properties - RSC... (pubs.rsc.org)
Amino-alcohols sales value UK 2010-2016 | Statista
Amino-alcohols sales value UK 2010-2016 | Statista (statista.com)
DailyMed - BUPROPION HYDROCHLORIDE tablet
DailyMed - BUPROPION HYDROCHLORIDE tablet (dailymed.nlm.nih.gov)
2-Aminobenzyl alcohol
2-Aminobenzyl alcohol (webbook.nist.gov)
These highlights do not include all the information needed to use BUPROPION HYDROCHLORIDE EXTENDED-RELEASE TABLETS (SR) ...
These highlights do not include all the information needed to use BUPROPION HYDROCHLORIDE EXTENDED-RELEASE TABLETS (SR) ... (dailymed.nlm.nih.gov)