Amino Acid Sequence
Sequence Homology, Amino Acid
Molecular Sequence Data
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
Cloning, Molecular
Amino Acids
Base Sequence
Sequence Homology, Nucleic Acid
Sequence Alignment
The arrangement of two or more amino acid or base sequences from an organism or organisms in such a way as to align areas of the sequences sharing common properties. The degree of relatedness or homology between the sequences is predicted computationally or statistically based on weights assigned to the elements aligned between the sequences. This in turn can serve as a potential indicator of the genetic relatedness between the organisms.
DNA, Complementary
Peptide Fragments
Escherichia coli
A species of gram-negative, facultatively anaerobic, rod-shaped bacteria (GRAM-NEGATIVE FACULTATIVELY ANAEROBIC RODS) commonly found in the lower part of the intestine of warm-blooded animals. It is usually nonpathogenic, but some strains are known to produce DIARRHEA and pyogenic infections. Pathogenic strains (virotypes) are classified by their specific pathogenic mechanisms such as toxins (ENTEROTOXIGENIC ESCHERICHIA COLI), etc.
Cyanogen Bromide
Amino Acid Substitution
The naturally occurring or experimentally induced replacement of one or more AMINO ACIDS in a protein with another. If a functionally equivalent amino acid is substituted, the protein may retain wild-type activity. Substitution may also diminish, enhance, or eliminate protein function. Experimentally induced substitution is often used to study enzyme activities and binding site properties.
Restriction Mapping
DNA
A deoxyribonucleotide polymer that is the primary genetic material of all cells. Eukaryotic and prokaryotic organisms normally contain DNA in a double-stranded state, yet several important biological processes transiently involve single-stranded regions. DNA, which consists of a polysugar-phosphate backbone possessing projections of purines (adenine and guanine) and pyrimidines (thymine and cytosine), forms a double helix that is held together by hydrogen bonds between these purines and pyrimidines (adenine to thymine and guanine to cytosine).
Binding Sites
Sequence Analysis, DNA
Protein Conformation
The characteristic 3-dimensional shape of a protein, including the secondary, supersecondary (motifs), tertiary (domains) and quaternary structure of the peptide chain. PROTEIN STRUCTURE, QUATERNARY describes the conformation assumed by multimeric proteins (aggregates of more than one polypeptide chain).
Trypsin
Electrophoresis, Polyacrylamide Gel
Species Specificity
The restriction of a characteristic behavior, anatomical structure or physical system, such as immune response; metabolic response, or gene or gene variant to the members of one species. It refers to that property which differentiates one species from another but it is also used for phylogenetic levels higher or lower than the species.
Substrate Specificity
Genes
RNA, Messenger
RNA sequences that serve as templates for protein synthesis. Bacterial mRNAs are generally primary transcripts in that they do not require post-transcriptional processing. Eukaryotic mRNA is synthesized in the nucleus and must be exported to the cytoplasm for translation. Most eukaryotic mRNAs have a sequence of polyadenylic acid at the 3' end, referred to as the poly(A) tail. The function of this tail is not known for certain, but it may play a role in the export of mature mRNA from the nucleus as well as in helping stabilize some mRNA molecules by retarding their degradation in the cytoplasm.
Sequence Analysis
Chromatography, High Pressure Liquid
Mutation
Peptides
Members of the class of compounds composed of AMINO ACIDS joined together by peptide bonds between adjacent amino acids into linear, branched or cyclical structures. OLIGOPEPTIDES are composed of approximately 2-12 amino acids. Polypeptides are composed of approximately 13 or more amino acids. PROTEINS are linear polypeptides that are normally synthesized on RIBOSOMES.
Open Reading Frames
Plasmids
Amino Acid Motifs
Amino Acids, Essential
Models, Molecular
Chymotrypsin
Amino Acid Transport Systems
Gene Library
Mutagenesis, Site-Directed
Cattle
Conserved Sequence
Structure-Activity Relationship
Blotting, Northern
Protein Structure, Tertiary
The level of protein structure in which combinations of secondary protein structures (alpha helices, beta sheets, loop regions, and motifs) pack together to form folded shapes called domains. Disulfide bridges between cysteines in two different parts of the polypeptide chain along with other interactions between the chains play a role in the formation and stabilization of tertiary structure. Small proteins usually consist of only one domain but larger proteins may contain a number of domains connected by segments of polypeptide chain which lack regular secondary structure.
Codon
A set of three nucleotides in a protein coding sequence that specifies individual amino acids or a termination signal (CODON, TERMINATOR). Most codons are universal, but some organisms do not produce the transfer RNAs (RNA, TRANSFER) complementary to all codons. These codons are referred to as unassigned codons (CODONS, NONSENSE).
DNA Primers
Polymerase Chain Reaction
In vitro method for producing large amounts of specific DNA or RNA fragments of defined length and sequence from small amounts of short oligonucleotide flanking sequences (primers). The essential steps include thermal denaturation of the double-stranded target molecules, annealing of the primers to their complementary sequences, and extension of the annealed primers by enzymatic synthesis with DNA polymerase. The reaction is efficient, specific, and extremely sensitive. Uses for the reaction include disease diagnosis, detection of difficult-to-isolate pathogens, mutation analysis, genetic testing, DNA sequencing, and analyzing evolutionary relationships.
Proteins
Linear POLYPEPTIDES that are synthesized on RIBOSOMES and may be further modified, crosslinked, cleaved, or assembled into complex proteins with several subunits. The specific sequence of AMINO ACIDS determines the shape the polypeptide will take, during PROTEIN FOLDING, and the function of the protein.
Protein Binding
Recombinant Fusion Proteins
Carrier Proteins
Blotting, Southern
Protein Structure, Secondary
Macromolecular Substances
Chromatography, Ion Exchange
Plant Proteins
Chromatography, Gel
Gene Expression
Endopeptidases
Sequence Analysis, Protein
Transcription, Genetic
Multigene Family
A set of genes descended by duplication and variation from some ancestral gene. Such genes may be clustered together on the same chromosome or dispersed on different chromosomes. Examples of multigene families include those that encode the hemoglobins, immunoglobulins, histocompatibility antigens, actins, tubulins, keratins, collagens, heat shock proteins, salivary glue proteins, chorion proteins, cuticle proteins, yolk proteins, and phaseolins, as well as histones, ribosomal RNA, and transfer RNA genes. The latter three are examples of reiterated genes, where hundreds of identical genes are present in a tandem array. (King & Stanfield, A Dictionary of Genetics, 4th ed)
Rabbits
Chickens
Protein Biosynthesis
Saccharomyces cerevisiae
Thermolysin
Peptide Mapping
Analysis of PEPTIDES that are generated from the digestion or fragmentation of a protein or mixture of PROTEINS, by ELECTROPHORESIS; CHROMATOGRAPHY; or MASS SPECTROMETRY. The resulting peptide fingerprints are analyzed for a variety of purposes including the identification of the proteins in a sample, GENETIC POLYMORPHISMS, patterns of gene expression, and patterns diagnostic for diseases.
Serine Endopeptidases
DNA Restriction Enzymes
Enzymes that are part of the restriction-modification systems. They catalyze the endonucleolytic cleavage of DNA sequences which lack the species-specific methylation pattern in the host cell's DNA. Cleavage yields random or specific double-stranded fragments with terminal 5'-phosphates. The function of restriction enzymes is to destroy any foreign DNA that invades the host cell. Most have been studied in bacterial systems, but a few have been found in eukaryotic organisms. They are also used as tools for the systematic dissection and mapping of chromosomes, in the determination of base sequences of DNAs, and have made it possible to splice and recombine genes from one organism into the genome of another. EC 3.21.1.
Sequence Homology
Nucleic Acid Hybridization
Widely used technique which exploits the ability of complementary sequences in single-stranded DNAs or RNAs to pair with each other to form a double helix. Hybridization can take place between two complimentary DNA sequences, between a single-stranded DNA and a complementary RNA, or between two RNA sequences. The technique is used to detect and isolate specific sequences, measure homology, or define other characteristics of one or both strands. (Kendrew, Encyclopedia of Molecular Biology, 1994, p503)
Membrane Proteins
Plants
Multicellular, eukaryotic life forms of kingdom Plantae (sensu lato), comprising the VIRIDIPLANTAE; RHODOPHYTA; and GLAUCOPHYTA; all of which acquired chloroplasts by direct endosymbiosis of CYANOBACTERIA. They are characterized by a mainly photosynthetic mode of nutrition; essentially unlimited growth at localized regions of cell divisions (MERISTEMS); cellulose within cells providing rigidity; the absence of organs of locomotion; absence of nervous and sensory systems; and an alternation of haploid and diploid generations.
Oligonucleotide Probes
Synthetic or natural oligonucleotides used in hybridization studies in order to identify and study specific nucleic acid fragments, e.g., DNA segments near or within a specific gene locus or gene. The probe hybridizes with a specific mRNA, if present. Conventional techniques used for testing for the hybridization product include dot blot assays, Southern blot assays, and DNA:RNA hybrid-specific antibody tests. Conventional labels for the probe include the radioisotope labels 32P and 125I and the chemical label biotin.
Genetic Complementation Test
Protein Sorting Signals
Evolution, Molecular
Chromosome Mapping
Swine
Any of various animals that constitute the family Suidae and comprise stout-bodied, short-legged omnivorous mammals with thick skin, usually covered with coarse bristles, a rather long mobile snout, and small tail. Included are the genera Babyrousa, Phacochoerus (wart hogs), and Sus, the latter containing the domestic pig (see SUS SCROFA).
Biological Evolution
Enzyme Stability
Liver
Carboxypeptidases
Chromatography, Affinity
Isoenzymes
Hydrogen-Ion Concentration
Transfection
Glycoproteins
Alanine
Mass Spectrometry
Peptide Hydrolases
Mutagenesis
Protein Processing, Post-Translational
Any of various enzymatically catalyzed post-translational modifications of PEPTIDES or PROTEINS in the cell of origin. These modifications include carboxylation; HYDROXYLATION; ACETYLATION; PHOSPHORYLATION; METHYLATION; GLYCOSYLATION; ubiquitination; oxidation; proteolysis; and crosslinking and result in changes in molecular weight and electrophoretic motility.
Consensus Sequence
A theoretical representative nucleotide or amino acid sequence in which each nucleotide or amino acid is the one which occurs most frequently at that site in the different sequences which occur in nature. The phrase also refers to an actual sequence which approximates the theoretical consensus. A known CONSERVED SEQUENCE set is represented by a consensus sequence. Commonly observed supersecondary protein structures (AMINO ACID MOTIFS) are often formed by conserved sequences.
Tissue Distribution
Accumulation of a drug or chemical substance in various organs (including those not relevant to its pharmacologic or therapeutic action). This distribution depends on the blood flow or perfusion rate of the organ, the ability of the drug to penetrate organ membranes, tissue specificity, protein binding. The distribution is usually expressed as tissue to plasma ratios.
Genomic Library
Oligodeoxyribonucleotides
Biological Transport
Isoelectric Point
Temperature
RNA
A polynucleotide consisting essentially of chains with a repeating backbone of phosphate and ribose units to which nitrogenous bases are attached. RNA is unique among biological macromolecules in that it can encode genetic information, serve as an abundant structural component of cells, and also possesses catalytic activity. (Rieger et al., Glossary of Genetics: Classical and Molecular, 5th ed)
DNA-Binding Proteins
Chemistry
Glycine
Isoleucine
Glycosylation
Chemical Phenomena
Proline
Catalysis
Cricetinae
Bacillus
Pepsin A
Formed from pig pepsinogen by cleavage of one peptide bond. The enzyme is a single polypeptide chain and is inhibited by methyl 2-diaazoacetamidohexanoate. It cleaves peptides preferentially at the carbonyl linkages of phenylalanine or leucine and acts as the principal digestive enzyme of gastric juice.
Disulfides
Gene Expression Regulation, Bacterial
Cell Membrane
Organ Specificity
Point Mutation
Blotting, Western
Chromatography
Techniques used to separate mixtures of substances based on differences in the relative affinities of the substances for mobile and stationary phases. A mobile phase (fluid or gas) passes through a column containing a stationary phase of porous solid or liquid coated on a solid support. Usage is both analytical for small amounts and preparative for bulk amounts.
COS Cells
CELL LINES derived from the CV-1 cell line by transformation with a replication origin defective mutant of SV40 VIRUS, which codes for wild type large T antigen (ANTIGENS, POLYOMAVIRUS TRANSFORMING). They are used for transfection and cloning. (The CV-1 cell line was derived from the kidney of an adult male African green monkey (CERCOPITHECUS AETHIOPS).)
Exons
Trypsin Inhibitors
Electrophoresis, Paper
Solubility
Carbohydrates
Oxidoreductases
The class of all enzymes catalyzing oxidoreduction reactions. The substrate that is oxidized is regarded as a hydrogen donor. The systematic name is based on donor:acceptor oxidoreductase. The recommended name will be dehydrogenase, wherever this is possible; as an alternative, reductase can be used. Oxidase is only used in cases where O2 is the acceptor. (Enzyme Nomenclature, 1992, p9)
Operon
Glutamine
Circular Dichroism
Aspartic Acid
Amino Acid Transport Systems, Basic
DNA, Recombinant
Genetic Code
Immunoblotting
Cross Reactions
Ferredoxins
Transcription Factors
Tryptophan
An essential amino acid that is necessary for normal growth in infants and for NITROGEN balance in adults. It is a precursor of INDOLE ALKALOIDS in plants. It is a precursor of SEROTONIN (hence its use as an antidepressant and sleep aid). It can be a precursor to NIACIN, albeit inefficiently, in mammals.
Valine
Plants, Medicinal
Repetitive Sequences, Nucleic Acid
Sequences of DNA or RNA that occur in multiple copies. There are several types: INTERSPERSED REPETITIVE SEQUENCES are copies of transposable elements (DNA TRANSPOSABLE ELEMENTS or RETROELEMENTS) dispersed throughout the genome. TERMINAL REPEAT SEQUENCES flank both ends of another sequence, for example, the long terminal repeats (LTRs) on RETROVIRUSES. Variations may be direct repeats, those occurring in the same direction, or inverted repeats, those opposite to each other in direction. TANDEM REPEAT SEQUENCES are copies which lie adjacent to each other, direct or inverted (INVERTED REPEAT SEQUENCES).
Pseudomonas
Mutagenesis, Insertional
Mutagenesis where the mutation is caused by the introduction of foreign DNA sequences into a gene or extragenic sequence. This may occur spontaneously in vivo or be experimentally induced in vivo or in vitro. Proviral DNA insertions into or adjacent to a cellular proto-oncogene can interrupt GENETIC TRANSLATION of the coding sequences or interfere with recognition of regulatory elements and cause unregulated expression of the proto-oncogene resulting in tumor formation.
Fabaceae
The large family of plants characterized by pods. Some are edible and some cause LATHYRISM or FAVISM and other forms of poisoning. Other species yield useful materials like gums from ACACIA and various LECTINS like PHYTOHEMAGGLUTININS from PHASEOLUS. Many of them harbor NITROGEN FIXATION bacteria on their roots. Many but not all species of "beans" belong to this family.
Streptomyces
Bacterial Outer Membrane Proteins
Serine
Cells, Cultured
Geobacillus stearothermophilus
Threonine
Phenylalanine
Introns
Gene Expression Regulation
Lectins
Proteins that share the common characteristic of binding to carbohydrates. Some ANTIBODIES and carbohydrate-metabolizing proteins (ENZYMES) also bind to carbohydrates, however they are not considered lectins. PLANT LECTINS are carbohydrate-binding proteins that have been primarily identified by their hemagglutinating activity (HEMAGGLUTININS). However, a variety of lectins occur in animal species where they serve diverse array of functions through specific carbohydrate recognition.
Isoelectric Focusing
Viral Structural Proteins
Viral proteins that are components of the mature assembled VIRUS PARTICLES. They may include nucleocapsid core proteins (gag proteins), enzymes packaged within the virus particle (pol proteins), and membrane components (env proteins). These do not include the proteins encoded in the VIRAL GENOME that are produced in infected cells but which are not packaged in the mature virus particle,i.e. the so called non-structural proteins (VIRAL NONSTRUCTURAL PROTEINS).
Nitrogen
Repetitive Sequences, Amino Acid
Promoter Regions, Genetic
Binding, Competitive
The amino acid sequence of Neurospora NADP-specific glutamate dehydrogenase. The tryptic peptides. (1/190738)
The NADP-specific glutamate dehydrogenase of Neurospora crassa was digested with trypsin, and peptides accounting for 441 out of the 452 residues of the polypeptide chain were isolated and substantially sequenced. Additional experimental detail has been deposited as Supplementary Publication SUP 50052 (11 pages) with the British Library (Lending Division), Boston Spa, Wetherby, W. Yorkshire LS23 7BQ, U.K., from whom copies may be obtained under the terms given in Biochem J. (1975) 145, 5. (+info)The amino acid sequence of Neurospora NADP-specific glutamate dehydrogenase. Peptides from digestion with a staphylococcal proteinase. (2/190738)
The extracellular proteinase of Staphylococcus aureus strain V8 was used to digest the NADP-specific glutamate dehydrogenase of Neurospora crassa. Of 35 non-overlapping peptides expected from the glutamate content of the polypeptide chain, 29 were isolated and substantially sequenced. The sequences obtained were valuable in providing overlaps for the alignment of about two-thirds of the sequences found in tryptic peptides [Wootton, J. C., Taylor, J, G., Jackson, A. A., Chambers, G. K. & Fincham, J. R. S. (1975) Biochem. J. 149, 739-748]. The blocked N-terminal peptide of the protein was isolated. This peptide was sequenced by mass spectrometry, and found to have N-terminal N-acetylserine by Howard R. Morris and Anne Dell, whose results are presented as an Appendix to the main paper. The staphylococcal proteinase showed very high specificity for glutamyl bonds in the NH4HCO3 buffer used. Partial splits of two aspartyl bonds, both Asp-Ile, were probably attributable to the proteinase. No cleavage of glutaminyl or S-carboxymethylcysteinyl bonds was found. Additional experimental detail has been deposited as Supplementary Publication SUP 50053 (5 pages) with the British Library (Lending Division), Boston Spa, Wetherby, W. Yorkshire LS23 7BQ, U.K, from whom copies may be obtained under the terms given in Biochem. J. (1975) 1458 5. (+info)Novel regulation of the homeotic gene Scr associated with a crustacean leg-to-maxilliped appendage transformation. (3/190738)
Homeotic genes are known to be involved in patterning morphological structures along the antero-posterior axis of insects and vertebrates. Because of their important roles in development, changes in the function and expression patterns of homeotic genes may have played a major role in the evolution of different body plans. For example, it has been proposed that during the evolution of several crustacean lineages, changes in the expression patterns of the homeotic genes Ultrabithorax and abdominal-A have played a role in transformation of the anterior thoracic appendages into mouthparts termed maxillipeds. This homeotic-like transformation is recapitulated at the late stages of the direct embryonic development of the crustacean Porcellio scaber (Oniscidea, Isopoda). Interestingly, this morphological change is associated with apparent novelties both in the transcriptional and post-transcriptional regulation of the Porcellio scaber ortholog of the Drosophila homeotic gene, Sex combs reduced (Scr). Specifically, we find that Scr mRNA is present in the second maxillary segment and the first pair of thoracic legs (T1) in early embryos, whereas protein accumulates only in the second maxillae. In later stages, however, high levels of SCR appear in the T1 legs, which correlates temporally with the transformation of these appendages into maxillipeds. Our observations provide further insight into the process of the homeotic leg-to-maxilliped transformation in the evolution of crustaceans and suggest a novel regulatory mechanism for this process in this group of arthropods. (+info)The Drosophila kismet gene is related to chromatin-remodeling factors and is required for both segmentation and segment identity. (4/190738)
The Drosophila kismet gene was identified in a screen for dominant suppressors of Polycomb, a repressor of homeotic genes. Here we show that kismet mutations suppress the Polycomb mutant phenotype by blocking the ectopic transcription of homeotic genes. Loss of zygotic kismet function causes homeotic transformations similar to those associated with loss-of-function mutations in the homeotic genes Sex combs reduced and Abdominal-B. kismet is also required for proper larval body segmentation. Loss of maternal kismet function causes segmentation defects similar to those caused by mutations in the pair-rule gene even-skipped. The kismet gene encodes several large nuclear proteins that are ubiquitously expressed along the anterior-posterior axis. The Kismet proteins contain a domain conserved in the trithorax group protein Brahma and related chromatin-remodeling factors, providing further evidence that alterations in chromatin structure are required to maintain the spatially restricted patterns of homeotic gene transcription. (+info)The homeobox gene Pitx2: mediator of asymmetric left-right signaling in vertebrate heart and gut looping. (5/190738)
Left-right asymmetry in vertebrates is controlled by activities emanating from the left lateral plate. How these signals get transmitted to the forming organs is not known. A candidate mediator in mouse, frog and zebrafish embryos is the homeobox gene Pitx2. It is asymmetrically expressed in the left lateral plate mesoderm, tubular heart and early gut tube. Localized Pitx2 expression continues when these organs undergo asymmetric looping morphogenesis. Ectopic expression of Xnr1 in the right lateral plate induces Pitx2 transcription in Xenopus. Misexpression of Pitx2 affects situs and morphology of organs. These experiments suggest a role for Pitx2 in promoting looping of the linear heart and gut. (+info)Mrj encodes a DnaJ-related co-chaperone that is essential for murine placental development. (6/190738)
We have identified a novel gene in a gene trap screen that encodes a protein related to the DnaJ co-chaperone in E. coli. The gene, named Mrj (mammalian relative of DnaJ) was expressed throughout development in both the embryo and placenta. Within the placenta, expression was particularly high in trophoblast giant cells but moderate levels were also observed in trophoblast cells of the chorion at embryonic day 8.5, and later in the labyrinth which arises from the attachment of the chorion to the allantois (a process called chorioallantoic fusion). Insertion of the ROSAbetageo gene trap vector into the Mrj gene created a null allele. Homozygous Mrj mutants died at mid-gestation due to a failure of chorioallantoic fusion at embryonic day 8.5, which precluded formation of the mature placenta. At embryonic day 8.5, the chorion in mutants was morphologically normal and expressed the cell adhesion molecule beta4 integrin that is known to be required for chorioallantoic fusion. However, expression of the chorionic trophoblast-specific transcription factor genes Err2 and Gcm1 was significantly reduced. The mutants showed no abnormal phenotypes in other trophoblast cell types or in the embryo proper. This study indicates a previously unsuspected role for chaperone proteins in placental development and represents the first genetic analysis of DnaJ-related protein function in higher eukaryotes. Based on a survey of EST databases representing different mouse tissues and embryonic stages, there are 40 or more DnaJ-related genes in mammals. In addition to Mrj, at least two of these genes are also expressed in the developing mouse placenta. The specificity of the developmental defect in Mrj mutants suggests that each of these genes may have unique tissue and cellular activities. (+info)A Drosophila doublesex-related gene, terra, is involved in somitogenesis in vertebrates. (7/190738)
The Drosophila doublesex (dsx) gene encodes a transcription factor that mediates sex determination. We describe the characterization of a novel zebrafish zinc-finger gene, terra, which contains a DNA binding domain similar to that of the Drosophila dsx gene. However, unlike dsx, terra is transiently expressed in the presomitic mesoderm and newly formed somites. Expression of terra in presomitic mesoderm is restricted to cells that lack expression of MyoD. In vivo, terra expression is reduced by hedgehog but enhanced by BMP signals. Overexpression of terra induces rapid apoptosis both in vitro and in vivo, suggesting that a tight regulation of terra expression is required during embryogenesis. Terra has both human and mouse homologs and is specifically expressed in mouse somites. Taken together, our findings suggest that terra is a highly conserved protein that plays specific roles in early somitogenesis of vertebrates. (+info)Requirement of a novel gene, Xin, in cardiac morphogenesis. (8/190738)
A novel gene, Xin, from chick (cXin) and mouse (mXin) embryonic hearts, may be required for cardiac morphogenesis and looping. Both cloned cDNAs have a single open reading frame, encoding proteins with 2,562 and 1,677 amino acids for cXin and mXin, respectively. The derived amino acid sequences share 46% similarity. The overall domain structures of the predicted cXin and mXin proteins, including proline-rich regions, 16 amino acid repeats, DNA-binding domains, SH3-binding motifs and nuclear localization signals, are highly conserved. Northern blot analyses detect a single message of 8.9 and 5.8 kilo base (kb) from both cardiac and skeletal muscle of chick and mouse, respectively. In situ hybridization reveals that the cXin gene is specifically expressed in cardiac progenitor cells of chick embryos as early as stage 8, prior to heart tube formation. cXin continues to be expressed in the myocardium of developing hearts. By stage 15, cXin expression is also detected in the myotomes of developing somites. Immunofluorescence microscopy reveals that the mXin protein is colocalized with N-cadherin and connexin-43 in the intercalated discs of adult mouse hearts. Incubation of stage 6 chick embryos with cXin antisense oligonucleotides results in abnormal cardiac morphogenesis and an alteration of cardiac looping. The myocardium of the affected hearts becomes thickened and tends to form multiple invaginations into the heart cavity. This abnormal cellular process may account in part for the abnormal looping. cXin expression can be induced by bone morphogenetic protein (BMP) in explants of anterior medial mesoendoderm from stage 6 chick embryos, a tissue that is normally non-cardiogenic. This induction occurs following the BMP-mediated induction of two cardiac-restricted transcription factors, Nkx2.5 and MEF2C. Furthermore, either MEF2C or Nkx2.5 can transactivate a luciferase reporter driven by the mXin promoter in mouse fibroblasts. These results suggest that Xin may participate in a BMP-Nkx2.5-MEF2C pathway to control cardiac morphogenesis and looping. (+info)
The American Journal of Tropical Medicine and Hygiene | Repeated Immunogenic Amino Acid Sequences of Plasmodium Species Share...
N-Terminal Amino Acid Sequence Determination of Proteins by N-Terminal Dimethyl Labeling: Pitfalls and Advantages When Compared...
Primary and secondary structure of bovine retinal S antigen (48-kDa protein) | PNAS
Protein primary structure - Wikipedia
2423-Symbols and Format To Be Used for Nucleotide and/or Amino Acid Sequence Data
120(5)
Substrate specificity of protein kinases - Patent # 5532167 - PatentGenius
پروتئین - ویکیپدیا، دانشنامهٔ آزاد
The hormonal control of glycogen metabolism: The amino acid sequence at the phosphorylation site of protein phosphatase...
Deduced primary structure of rat tryptophan-2,3-dioxygenase<...
Role of Transmembrane Domain and Cytoplasmic Tail Amino Acid Sequences of Influenza A Virus Neuraminidase in Raft Association...
AgriLife scientist: Functional amino acids regulate key metaboli... ( COLLEGE STATION - Functional amino ac...)
Predicting and clustering plant CLE genes with a new method developed specifically for short amino acid sequences | BMC...
SSE: a nucleotide and amino acid sequence analysis platform. - Experimental Medicine Division
GLI3 encodes a 190-kilodalton protein with multiple regions of GLI similarity. | Molecular and Cellular Biology
SMART: UBQ domain annotation
Complete amino acid sequence of beta-tubulin from porcine brain | PNAS
Patent US4394443 - Method for cloning genes - Google Patents
Patent US4394443 - Method for cloning genes - Google Patents
Design of amino acid sequences to fold into C-alpha model proteins<...
A classification of glycosyl hydrolases based on amino acid sequence similarities | Biochemical Journal
The modification of the conserved GXXXG motif of the membrane-spanning segment of subunit g destabilizes the supramolecular...
Embracing Independent Lifestyles -Burley House Nursing Home, 258 Burley Road, Leeds, West Yorkshire LS4 2LA
Download The Paraphrase Of Shem Nh Vii1 Nag Hammadi And Manichaean Studies
Impact of naturally occurring amino acid variations on the detection of HIV-1 p24 in diagnostic antigen tests | BMC Infectious...
Degeneracy of the information contained in amino acid sequences: Evidence from overlaid genes | SpringerLink
Nucleotide and amino acid sequence of lymphocyte-derived corticotropin: Endotoxin induction of a truncated peptide
Amino acid sequence in DENV2 NS2B/NS3 protease. The res | Open-i
Biosimilars/Biologics Drug Characterisation
Experts and Doctors on amino acid sequence in San Diego, California, United States
C - Population Dynamics - Ecology Center
SMART: Secondary literature for DeoRC domain
Proteolytic processing of QSOX1A ensures efficient secretion of a potent disulfide catalyst | Biochemical Journal | Portland...
Sec72p contributes to the selective recognition of signal peptides by the secretory polypeptide translocation complex. | JCB
Sec72p contributes to the selective recognition of signal peptides by the secretory polypeptide translocation complex. |...
Insulin regulation of a novel WD-40 repeat protein in adipocytes<...
Indian Patents. 229347:CYTOKINE RECEPTOR ZALPHA11
Wholesale Amino Acid Structures, China Wholesale Amino Acid Structures Manufacturers & Suppliers | Made-in-China.com
Primary structure and domain organization of human alpha and beta adducin. | Journal of Cell Biology | Rockefeller University...
Primary structure of murine major histo compatibility complex allo antigens amino acid sequence of the amino terminal 98...
Cell surface A33 antigen
N-terminal Amino Acid Sequencing of Mouse Monoclonal Antibodies Using the Edman Method : SHIMADZU (Shimadzu Corporation)
The amino acid sequences of the phosphorylated sites in troponin-I from rabbit skeletal muscle<...
Untitled
Plus it
COVID-19: Priorities for national biomedical research centre located in a hotspot region - The Hindu
Adaptor protein XB130 is a Rac-controlled component of lamellipodia that regulates cell motility and invasion | Journal of Cell...
MHC molecule - Free Study Notes for MBA MCA BBA BCA BA BSc BCOM MCOM MSc
Amino acid codes - Dynamical Systems @ CFisUC
Molecular Cloning and Primary Structure of Rat Testes Metalloendopeptidase EC 3.4.24.15<...
Recombinant Human NKG2-D type II integral membrane protein(KLRK1),partial (Active) - Cusabio
Complete amino acid sequences of bovine thymopoietins I, II, and III: closely homologous polypeptides | Meta
Homologous proteins - amino acid sequence in fasta format, Biology
Amino acid sequence data on glial fibrillary acidic protein (GFA); implications for the subdivision of intermediate filaments...
Aldehyde Tags, Uses Thereof in Site-Specific Protein Modification - Patent application
Nucleotide sequence analysis of the gene encoding the Deinococcus radiodurans surface protein, derived amino acid sequence, and...
Molecular Evolution of Odorant-Binding Protein Genes OS-E and OS-F in Drosophila | Genetics
20 Common Amino Acids That Keep You Alive - My Blog
Amino acid sequence homologies between rabbit, rat, and human serum re by J. Sundelin, B. C. Laurent et al.
Oncogenes: their role in normal and malignant growth - The nuclear location signal | Proceedings of the Royal Society of London...
Amino acid sequence comparison of three new balb/c mouse kappa chains. by D J. Mc kean, M Potter et al.
Mitochondrial DNA polymerases from yeast to man: a new family of polymerases.
| DIAL.pr - BOREAL
Application of molecular descriptors for recognition of phosphorylation sites in amino acid sequences
METH-1, a human ortholog of ADAMTS-1, and METH-2 are members of a new family of proteins with angio-inhibitory activity. -...
Determination of the carboxyl termini of the alpha and beta subunits of yeast K1 killer toxin. Requirement of a...
Identification of an active site cysteine residue in human type I Ins(1,4,5)P3 5-phosphatase by chemical modification and site...
Purification and sequence analysis of two rat tissue inhibitors of metalloproteinases.
Letter to the Editor : Amino Acid Sequence Similarity Between Retroviral and E. coli RNase H and Hepadnaviral Gene Products ::...
Cloning of a novel family of mammalian GTP-binding proteins (RagA, RagBs, RagBl) with remote similarity to the Ras-related...
Formats: Text / Subjects: Amino Acid Sequence and Molecular Sequence Data / Titles: Hox-1.11 and Hox-4.9 Homeobox Genes /...
Identification and specificities of N‐terminal acetyltransferases from Saccharomyces cerevisiae | The EMBO Journal
Platinum Publications as of December 3, 2013
Cloning and DNA sequence of the omc gene encoding the outer membrane protein-macromolecular complex from Neisseria gonorrhoeae....
RevTrans: multiple alignment of coding DNA from aligned amino acid sequences<...
Idealized signal sequences: The role of charge and hydrophobicity in by Jennifer Winslow Izard
SMART: TNFR domain annotation
Evista cost, Evista effets indesirables
Download Teaching Harry Potter: The Power Of Imagination In Multicultural Classrooms 2011
Mouse cellular nucleic acid binding proteins: a highly conserved fami by C H. Warden, S K. Krisans et al.
Critical residues for structure and catalysis in short-chain dehydrogenases/reductases. - Immunology
CHIP with U-box/Tetratricopeptide repeats Protein Superfamily Detail
Anti-cd40 antibody mutants
Zebra: web-server for bioinformatic analysis of large protein superfamilies to identify variable amino acid residues...
Hierarchical motif vectors for prediction of functional sites in amino acid sequences using quasi-supervised learning
Low-resolution structural studies of human Stanniocalcin-1 | BMC Structural Biology | Full Text
Experts and Doctors on amino acid sequence in Cambridge, Massachusetts, United States
Protonix : Protonix where to buy, Protonix side effects dry mouth
Subunit E of the vacuolar H+-ATPase of Hordeum vulgare L.: cDNA cloning, expression and immunological analysis
Restricted usage of T cell receptor V alpha/J alpha gene segments with different nucleotide but identical amino acid sequences...
IDEALS @ Illinois: Thelin Operon in Pseudomonas Incognita: Cloning, Nucleotide Sequence and Deduced Amino Acid Sequence of...
The complete sequence and gene organization of the short unique region of herpesvirus of turkeys | Microbiology Society
Requirement of a novel gene, Xin, in cardiac morphogenesis | Development
Protein - Wikipedia
Effects of systematic variation of amino acid sequence on the mechanical properties of a self-assembling, oligopeptide...
Predicting protein function by machine learning on amino acid sequences - a critical evaluation | BMC Genomics | Full Text
Baldwin effect - encyclopedia article - Citizendium
Protein - Wikipedia
KDEL (amino acid sequence)
Articles with short description, Short description matches Wikidata, Amino acids, Amino acid motifs, Peptide sequences). ... H-Histidine D-Aspartic acid E-Glutamic acid L-Leucine Three letter code is: His-Asp-Glu-Leu. ER retention KKXX (amino acid ... KDEL is a target peptide sequence in mammals and plants located on the C-terminal end of the amino acid structure of a protein ... K-Lysine D-Aspartic acid E-Glutamic acid L-Leucine Therefore, the KDEL sequence in three letter code is: Lys-Asp-Glu-Leu. The ...
HDEL (amino acid sequence)
HDEL is a target peptide sequence in plants and yeasts located on the C-terminal end of the amino acid structure of a protein. ... H-Histidine D-Aspartic acid E-Glutamic acid L-Leucine Three letter code is: His-Asp-Glu-Leu. Denecke J.; De Rycke R.; Botterman ... The similar sequence KDEL performs the same function in animals, while plants are known to utilize both KDEL and HDEL signaling ... The HDEL sequence prevents a protein from being secreted from the endoplasmic reticulum (ER) and facilitates its return if it ...
KKXX (amino acid sequence)
... any amino acid X- any amino acid ER retention KDEL (amino acid sequence) COPI Signal peptide Protein targeting Martin J. ... v t e (Amino acids, Amino acid motifs, All stub articles, Molecular biology stubs). ... KKXX and for some proteins XKXX is a target peptide motif located in the C terminus in the amino acid structure of a protein ... The abbreviation KKXX is formed by the corresponding standard abbreviations for lysine (K) and any amino acid (X). This letter ...
N-acyl phosphatidylethanolamine-specific phospholipase D
The NAPEPLD cDNA sequence predicts 396 amino acid sequences in both mice and rats, which are 89% and 90% identical to that of ... "Amino Acid Sequencing". W.M. Keck Facility at Yale. 2006-10-23. Retrieved 2009-01-12. The Procise 494 cLC is described from the ... Regulation of Fatty Acid Ethanolamide Biosynthesis by Bile Acids". Structure. 23 (3): 598-604. doi:10.1016/j.str.2014.12.018. ... Bile acids bind with high affinity to selective pockets in this cavity, enhancing dimer assembly and enabling catalysis. NAPE- ...
Complement component 1s
The complete amino acid sequence". European Journal of Biochemistry. 169 (3): 547-53. doi:10.1111/j.1432-1033.1987.tb13644.x. ... The complete amino acid sequence". European Journal of Biochemistry. 169 (3): 547-53. doi:10.1111/j.1432-1033.1987.tb13644.x. ... Partial sequence determination of the heavy chain and identification of the peptide bond cleaved during activation". European ... Tosi M, Duponchel C, Meo T, Julier C (December 1987). "Complete cDNA sequence of human complement Cls and close physical ...
Endothiapepsin
Barkholt V (September 1987). "Amino acid sequence of endothiapepsin. Complete primary structure of the aspartic protease from ... Endothiapepsin (EC 3.4.23.22, Endothia aspartic proteinase, Endothia acid proteinase, Endothia parasitica acid proteinase, ...
SPINK1
Amino acid sequence of the reduced S-aminoethylated protein". Archives of Biochemistry and Biophysics. 179 (1): 189-99. doi: ... Purification and amino acid sequence". European Journal of Biochemistry. 188 (3): 501-6. doi:10.1111/j.1432-1033.1990.tb15428.x ... Yamamoto T, Nakamura Y, Nishide J, Emi M, Ogawa M, Mori T, Matsubara K (Oct 1985). "Molecular cloning and nucleotide sequence ...
Glutamate-cysteine ligase
The complete amino acid sequence". European Journal of Biochemistry. 169 (3): 547-553. doi:10.1111/j.1432-1033.1987.tb13644.x. ... This peptide coupling is unique in that it occurs between the amino moiety of the cysteine and the terminal carboxylic acid of ... to metabolize γ-GC and GSH into its constituent amino acids. GCL enzymatic activity generally dictates cellular GSH levels and ...
HIST1H3B
Isolation and amino acid sequence". J. Biochem. 90 (4): 1205-11. doi:10.1093/oxfordjournals.jbchem.a133573. PMID 7309716. ... 2003). "The DNA sequence and analysis of human chromosome 6". Nature. 425 (6960): 805-811. Bibcode:2003Natur.425..805M. doi: ... 2003). "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences". Proc. Natl. Acad. Sci ... 1986). "Enhancer-facilitated expression of prokaryotic and eukaryotic genes using human histone gene 5' regulatory sequences". ...
H3F3A
Isolation and amino acid sequence". Journal of Biochemistry. 90 (4): 1205-11. doi:10.1093/oxfordjournals.jbchem.a133573. PMID ... Wells D, Hoffman D, Kedes L (April 1987). "Unusual structure, evolutionary conservation of non-coding sequences and numerous ... "The Groucho/transducin-like enhancer of split transcriptional repressors interact with the genetically defined amino-terminal ... evidence that basally expressed histone genes have intervening sequences and encode polyadenylylated mRNAs". Proceedings of the ...
HIST1H2BE
Isolation and amino acid sequence". J. Biochem. 85 (2): 615-24. doi:10.1093/oxfordjournals.jbchem.a132371. PMID 422550. Dobner ... 2003). "The DNA sequence and analysis of human chromosome 6". Nature. 425 (6960): 805-11. Bibcode:2003Natur.425..805M. doi: ... 2003). "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences". Proc. Natl. Acad. Sci ...
HIST1H2BG
Isolation and amino acid sequence". J. Biochem. 85 (2): 615-24. doi:10.1093/oxfordjournals.jbchem.a132371. PMID 422550. Frohm M ... 2003). "The DNA sequence and analysis of human chromosome 6". Nature. 425 (6960): 805-11. Bibcode:2003Natur.425..805M. doi: ... 2003). "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences". Proc. Natl. Acad. Sci ...
Histone H2B type 1-C
Isolation and amino acid sequence". J. Biochem. 85 (2): 615-24. doi:10.1093/oxfordjournals.jbchem.a132371. PMID 422550. Albig W ... 2003). "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences". Proc. Natl. Acad. Sci ...
HIST1H2BF
Isolation and amino acid sequence". J. Biochem. 85 (2): 615-24. doi:10.1093/oxfordjournals.jbchem.a132371. PMID 422550. Albig W ... 2003). "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences". Proc. Natl. Acad. Sci ...
Myelin basic protein
The complete amino acid sequence". The Journal of Biological Chemistry. 246 (18): 5770-5784. doi:10.1016/S0021-9258(18)61872-1 ... Sakamoto Y, Kitamura K, Yoshimura K, Nishijima T, Uyemura K (March 1987). "Complete amino acid sequence of PO protein in bovine ... Gibson BW, Gilliom RD, Whitaker JN, Biemann K (April 1984). "Amino acid sequence of human myelin basic protein peptide 45-89 as ... Carnegie PR (June 1971). "Amino acid sequence of the encephalitogenic basic protein from human myelin". The Biochemical Journal ...
HIST2H3PS2
Isolation and amino acid sequence". J. Biochem. 90 (4): 1205-11. doi:10.1093/oxfordjournals.jbchem.a133573. PMID 7309716. Goto ... 2006). "The DNA sequence and biological annotation of human chromosome 1". Nature. 441 (7091): 315-21. Bibcode:2006Natur.441.. ... 2003). "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences". Proc. Natl. Acad. Sci ... Nucleic Acids Res. 31 (3): 878-85. doi:10.1093/nar/gkg176. PMC 149197. PMID 12560483. Wang Y, Wysocka J, Sayegh J, et al. (2004 ...
HIST2H3C
Isolation and amino acid sequence". J. Biochem. 90 (4): 1205-11. doi:10.1093/oxfordjournals.jbchem.a133573. PMID 7309716. Díaz- ... Nucleic Acids Res. 31 (3): 878-885. doi:10.1093/nar/gkg176. PMC 149197. PMID 12560483. Yoon HG, Chan DW, Huang ZQ, Li J, ... regulatory sequences". Biochem Cell Biol. 64 (4): 277-289. doi:10.1139/o86-039. PMID 3013246. "Entrez Gene: HIST2H3C histone ...
Glycyl endopeptidase
Ritonja A, Buttle DJ, Rawlings ND, Turk V, Barrett AJ (November 1989). "Papaya proteinase IV amino acid sequence". FEBS Letters ...
ITIH3
cDNA and deduced amino-acid sequence". Eur. J. Biochem. 212 (3): 771-6. doi:10.1111/j.1432-1033.1993.tb17717.x. PMID 7681778. ... 2004). "Complete sequencing and characterization of 21,243 full-length human cDNAs". Nat. Genet. 36 (1): 40-5. doi:10.1038/ ... 2003). "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences". Proc. Natl. Acad. Sci ...
Richard Perham
Instrumentation in amino acid sequence analysis. London New York: Academic Press. ISBN 978-0-12-551250-3. Perham, Richard N; ... Instrumentation in amino acid sequence analysis. London New York: Academic Press. ISBN 978-0-12-551250-3. Scrutton, Nigel Shaun ...
Carbohydrate-binding module
cDNA and deduced amino acid sequences". J. Biol. Chem. 271 (15): 8925-35. doi:10.1074/jbc.271.15.8925. PMID 8621536. Casu R, ... Many putative CBMs have been identified by amino acid sequence alignments but only a few representatives have been shown ... CBMs are classified into numerous families, based on amino acid sequence similarity. There are currently (June 2011) 64 ... Carbohydrate-binding module family 1 (CBM1) consists of 36 amino acids. This domain contains 4 conserved cysteine residues ...
Dihydrofolate reductase
Purification, properties, and amino acid sequence". The Journal of Biological Chemistry. 254 (22): 11475-84. doi:10.1016/S0021- ... thymidylic acid, and certain amino acids. While the functional dihydrofolate reductase gene has been mapped to chromosome 5, ... Masters JN, Attardi G (1983). "The nucleotide sequence of the cDNA coding for the human dihydrofolic acid reductase". Gene. 21 ... Dihydrofolate reductase, or DHFR, is an enzyme that reduces dihydrofolic acid to tetrahydrofolic acid, using NADPH as an ...
ITIH1
cDNA and deduced amino-acid sequence". Eur. J. Biochem. 212 (3): 771-6. doi:10.1111/j.1432-1033.1993.tb17717.x. PMID 7681778. ... 1992). "Human inter-alpha-trypsin inhibitor: full-length cDNA sequence of the heavy chain H1". Biochim. Biophys. Acta. 1132 (1 ... their identification by electrophoresis and partial sequencing. Differential reactivity with concanavalin A". Biol. Chem. Hoppe ...
STIM2
... of amino acid sequence conserved) and STIM2 (31% identical; 46% of amino acid sequence conserved). Unicellular eukaryotes such ... of the amino acid sequence of STIM1). Only the extreme of the C-terminal region shows a significant sequence divergence. The ... Human STIM2 consists of 833 amino acid residues (aas) (105-115 kDa) (Fig. 1), 148 additional aas compared to human STIM1. Their ... 1). Mouse STIM2 shares a 92% identity with human STIM2 in the aminoacid sequence according to the pairwise alignment generated ...
Aspergillopepsin I
Amino acid sequence of the enzyme". Bioorg. Khim. 12: 1030-1047. Yagi F, Fan J, Tadera K, Kobayashi A (1986). "Purification and ... Effects of acid protease-specific inhibitors on the acid proteases from Aspergillus niger var. macrosporus". Journal of ... Aspergillopepsin I (EC 3.4.23.18, Aspergillus acid protease, Aspergillus acid proteinase, Aspergillus aspartic proteinase, ... Aspergillus saitoi acid proteinase, pepsin-type aspartic proteinase, Aspergillus niger acid proteinase, sumizyme AP, proctase P ...
Yuri Ovchinnikov (biochemist)
Amino acid sequence deduced from cDNA". FEBS Letters. 232 (1): 69-72. doi:10.1016/0014-5793(88)80388-0. ISSN 0014-5793. PMID ...
Amino acid
"Low-complexity sequences and single amino acid repeats: not just "junk" peptide sequences". Genome. 53 (10): 753-62. doi: ... part of amino acid catabolism (see below). A rare exception to the dominance of α-amino acids in biology is the β-amino acid ... D-amino acid residues are found in some proteins, but they are rare. Amino acids are designated as α- when the amino nitrogen ... Amino acids containing an amino group bonded directly to the α-carbon are referred to as α-amino acids. These include proline ...
C19orf18
The coding sequence contains 215 amino acids. The molecular weight of c19orf18 is 24.151 kdal and the isoelectric point for the ... There is a negative charge cluster from amino acid 149 to 172. There is a cross-program consensus between GOR4, CFSSP, and ... The protein sequence is predicted to contain a signal peptide (1 aa to 24 aa), an extracellular domain (25 aa to 100 aa), a ... The protein sequence is rich in leucine and is deficient in tryptophan, cysteine, and tyrosine. ...
Piscivorin
They display significant amino acid sequence homology. Sixteen cysteine residues, forming 8 disulfide bonds, are strictly ... Piscivorin has the following amino acid sequence. Piscivorin reduces high potassium-evoked smooth muscle contraction, but does ... A sequence comparison of piscivorin and other CRISP family proteins suggests that the Glu186 residue is the crucial site for ... The nucleotide sequence of piscivorin cDNA spans 1323 bp, containing an open reading frame of 240 codons. ...
LAMP1
Comparison of their deduced amino acid sequences". The Journal of Biological Chemistry. 263 (35): 18920-8. doi:10.1016/S0021- ... Howe CL, Granger BL, Hull M, Green SA, Gabel CA, Helenius A, Mellman I (Oct 1988). "Derived protein sequence, oligosaccharides ... flanking sequence of lamp-2 gene and comparison of exon organization in two genes". The Journal of Biological Chemistry. 268 ( ... flanking sequence of lamp-2 gene and comparison of exon organization in two genes". The Journal of Biological Chemistry. 268 ( ...
Paul Mischel
... "mTORC2 Regulates Amino Acid Metabolism in Cancer by Phosphorylation of the Cystine-Glutamate Antiporter xCT". Molecular Cell. ... Mischel and colleagues integrated whole genome sequencing, cytogenetics and structural modeling to accurately and globally ...
Phage display
... were expressed both with and without the signal sequence. PelB (an amino acid signal sequence that targets the protein to the ... Moreover, pIII allows for the insertion of larger protein sequences (>100 amino acids) and is more tolerant to it than pVIII. ... Usually peptides that can be fused to pVIII are 6-8 amino acids long. The size restriction seems to have less to do with ... Direct Interaction Rescue or by adding an 8-10 amino acid linker between the cDNA and pIII at the C-terminus. pVIII is the main ...
Prostaglandin-endoperoxide synthase 2
... the membrane-binding domain consists of a series of amphipathic α helices with several hydrophobic amino acids exposed to a ... PTGS-2 is a sequence homodimer. Each monomer of the enzyme has a peroxidase and a PTGS (COX) active site. The PTGS (COX) ... Arachidonic acid can bind to E-cat and E-allo, but the affinity of AA for E-allo is 25 times that for Ecat. Palmitic acid, an ... However, oxygenation of 10,10-difluoroarachidonic acid to 11-(S )-hydroxyeicosa-5,8,12,14-tetraenoic acid is not consistent ...
PANO1
number of amino acids changes as seen to the right. PANO1 appears to diverge much more quickly than fibrinogen alpha and much ... "SAPS < Sequence Statistics < EMBL-EBI". www.ebi.ac.uk. Retrieved 2021-08-01. "PSORT II Prediction". psort.hgc.jp. Retrieved ... Its protein contains 1 exon and 215 amino acids. PANO1 has one isoform, isoform 1, located in the PONAB and PANTR species. ... A possible cleavage site was identified between amino acids 33 and 34 as depicted in the PANO1 protein model. As mentioned ...
Proto-oncogene tyrosine-protein kinase Src
Both the N-terminally attached myristic acid and the peptide sequences of the unique region are involved in the interaction. ... "Increased pp60c-src tyrosyl kinase activity in human neuroblastomas is associated with amino-terminal tyrosine phosphorylation ...
Coronavirus nucleocapsid protein
In SARS-CoV, the causative agent of SARS, the N protein is 422 amino acid residues long and in SARS-CoV-2, the causative agent ... The sequences and structures of N proteins from different coronaviruses, particularly the C-terminal domains, appear to be well ... A separate study of SARS-CoV-2 sequences identified at least one site in the N protein under positive selection. The N ... Parts of the IDR, particularly a conserved sequence motif rich in serine and arginine residues (the SR-rich region), may also ...
Sequence motif
... a sequence of elements of the pattern notation matches a sequence of amino acids if and only if the latter sequence can be ... each denoting a specific amino acid or a set of amino acids; a string of characters drawn from the alphabet denotes a sequence ... In biology, a sequence motif is a nucleotide or amino-acid sequence pattern that is widespread and usually assumed to be ... denotes any amino acid except for those in the string. For example, {ST} denotes any amino acid other than S or T. If a pattern ...
Shiladitya DasSarma
DasSarma, Shiladitya; Capes, Melinda D.; Karan, Ram; DasSarma, Priya (2013-03-11). "Amino Acid Substitutions in Cold-Adapted ... The genome sequence helped to further establish the validity of the Archaea through the finding of similarities to higher ... In the 1990s, he organized and led the team that deciphered the first genome sequence and genetic code for a halophilic microbe ... "NSF - OLPA - PR 00-69: International Research Group Sequences Genome of Ubiquitous Microbe". www.nsf.gov. Retrieved 2016-07-11 ...
Candida blankii
Consequently, it oxidizes many forms of alcohol, amino acid, carbohydrates, and other organic compounds. As a BOD biosensor, ... Blood sample DNA sequencing of the 26S ribosomal subunit can definitively identify C. blankii. In nature, Candida blankii forms ... C. blankii "cultivated on a mixture of n-paraffins (6% vol/vol) has been shown to produce fumaric acid", which could be ... K. Tsekova, A. Kaimaktchiev & A. Krumov (1999). "Production of Fumaric Acid from n-Alcanes by Candida Blankii NA-83". ...
Auxin binding protein
The primary structure of these proteins contains an N-terminal hydrophobic leader sequence of 30-40 amino acids, which could ... represented by the sequence Lys-Asp-Glu-Leu, known to be responsible for preventing secretion of proteins from the lumen of the ...
TENM3
2800 amino acids. Teneurins are highly conserved within and between species. The primary structure, or amino acid sequence ... There are 41 amino acids in TCAPs, except for TCAP-3 from Ten-m3, which has 40. TCAPs show structural homology to the CRF ... The linker region is made up of ~200 amino acid residues and is found immediately distal to the transmembrane domain. This is ... More distally is the globular domain consisting of a 700-800 amino acid residue region. There are 17 conserved cysteine ...
Halobacterium salinarum
Amino acids are the main source of chemical energy for H. salinarum, particularly arginine and aspartate, though they are able ... Whole genome sequences are available for two strains of H. salinarum, NRC-1 and R1. The Halobacterium sp. NRC-1 genome consists ... to metabolize other amino acids, as well. H. salinarum have been reported to be unable to grow on sugars, and therefore need to ... 2000). "Genome sequence of Halobacterium species NRC-1". Proceedings of the National Academy of Sciences. 97 (22): 12176-81. ...
Antiparallel (biochemistry)
The chronological sequence of each amino acid sub-unit is the basis for directionality notation in polypeptides; a given ... The nucleic acid sequences are complementary and parallel, but they go in opposite directions, hence the antiparallel ... protein can be represented as its set of unique amino acid abbreviations within an N-terminus and a C-terminus. Many proteins ... Nucleic acid molecules have a phosphoryl (5') end and a hydroxyl (3') end. This notation follows from organic chemistry ...
Metabolism
... amino acids can be linked in varying sequences to form a huge variety of proteins. Proteins are made from amino acids that have ... lack all amino acid synthesis and take their amino acids directly from their hosts. All amino acids are synthesized from ... using the sequence information in a messenger RNA. Nucleotides are made from amino acids, carbon dioxide and formic acid in ... Amino acids are made into proteins by being joined in a chain of peptide bonds. Each different protein has a unique sequence of ...
GNLY
... which is formed after cleavage of the amino and carbonyl ends of the 15kDa protein. The 15 kDa form consists of 145 amino acids ... January 2003). "Sequence analysis of the granulysin and granzyme B genes in familial hemophagocytic lymphohistiocytosis". Human ... The 9 kDa form consists of 74 amino acids, and has a cytotoxic function. This molecule is found in cytotoxic granules, along ...
The Drumhead
... had been using modified hypospray syringes to encode information into amino acid sequences for secret transport. J'Dan admits ...
Endless Forms Most Beautiful (book)
... "humans and chimps have different amino-acid sequences in at least 55% of their proteins, a figure that rises to 95% for humans ... Almost identical sequences can be found across the animal kingdom, meaning that toolkit genes such as Hox must have evolved ... Thus we can't exclude protein-sequence evolution as an important reason why we lack whiskers and tails." He also noted that ... for the Tool Kit The chapter describes how genes are switched on and off in a precisely choreographed time sequence and 3- ...
Genome size
... activity with a major exception compared to other parasites still retain the bio-synthetic ability of production of amino acid ... The loss of large section of genomes could in fact lead to a loss in promotor sequences. This could in fact pushed the ... Although sequenced genome data are practically biased toward small genomes, which may compromise the accuracy of the ... One of the consequences of the elimination of such amount of sequences affected even the regulation of the remaining genes. ...
HSPA1B
HSPA1A and HSPA1B produce nearly identical proteins because the few differences in their DNA sequences are almost exclusively ... Haag Breese E, Uversky VN, Georgiadis MM, Harrington MA (December 2006). "The disordered amino-terminus of SIMPL interacts with ... protein phosphatase 5 dissociates from heat-shock proteins and is proteolytically activated in response to arachidonic acid and ...
NOX4
2004). "Complete sequencing and characterization of 21,243 full-length human cDNAs". Nat. Genet. 36 (1): 40-5. doi:10.1038/ ... Schwarzer C, Machen TE, Illek B, Fischer H (2004). "NADPH oxidase-dependent acid production in airway epithelial cells". J. ... Nox-dependent reactive oxygen species modulation by amino endoperoxides can induce apoptosis in high Nox4-expressing cancer ... 2003). "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences". Proc. Natl. Acad. Sci ...
Spinach aptamer
GFP's fluorophore is made up of three cyclized amino acids within the beta-barrel structure: Serine65-Tyrosine66-Glycine67. ... A method for inserting the Spinach sequence after an RNA sequence of interest is readily available. ... when bound to the RNA sequence 24-2, deemed Spinach. It was determined that DFHBI only binds Spinach in the phenolate form. At ...
Lewis Joel Greene
... amino acid sequence predicted tertiary structure, carbohydrate recognition and analysis of the b-prims fold". Protein Science. ...
Interferon
... amino acid analysis and amino terminal amino acid sequence". Science. 207 (4430): 525-6. Bibcode:1980Sci...207..525K. doi: ... immunosorbent column chromatography and N-terminal amino acid sequence". Biochemistry. 19 (16): 3831-5. doi:10.1021/bi00557a028 ... Bruce Merrifield, using solid phase peptide synthesis, one amino acid at a time. He later won the Nobel Prize in chemistry. ... Tan YH, Barakat F, Berthold W, Smith-Johannsen H, Tan C (August 1979). "The isolation and amino acid/sugar composition of human ...
MiR-137
2006). "miRBase: microRNA sequences, targets and gene nomenclature". Nucleic Acids Res. 34 (90001): D140-4. doi:10.1093/nar/ ... Bemis LT, Chen R, Amato CM, Classen EH, Robinson SE, Coffey DG, Erickson PF, Shellman YG, Robinson WA (2008). "MicroRNA-137 ... June 2007). "A Mammalian microRNA Expression Atlas Based on Small RNA Library Sequencing". Cell. 129 (7): 1401-14. doi:10.1016/ ...
White-edge freshwater whipray
"Molecular Phylogeny of Asian Freshwater and Marine Stingrays Based on the DNA Nucleotide and Deduced Amino Acid Sequences of ... Wong, S.Z.H.; B. Ching; Y.R. Chng; W.P. Wong; S.F. Chew & Y.K. Ip (June 2013). "Ascorbic Acid Biosynthesis and Brackish Water ... A 1999 phylogenetic analysis, based on cytochrome b sequences, found that it is closely related to H. gerrardi and H. imbricata ... by some euryhaline marine elasmobranchs and the ability of these elasmobranchs to increase the capacity of ascorbic acid ...
CADASIL
L-arginine, a naturally occurring amino acid, has been proposed as a potential therapy for CADASIL, but as of 2017 there are no ... The definitive test is sequencing the whole Notch 3 gene, which can be done from a sample of blood. However, as this is quite ...
Viroporin
Some examples also contain stretches of basic amino acids, or stretches of aromatic amino acids thought to reside in the ... Sequence, Structure, Viroporin, and Inhibitors". Protein Science. 30 (6): 1114-1130. doi:10.1002/pro.4075. PMC 8138525. PMID ... Viroporins are usually small - under 100 or 120 amino acid residues - and contain at least one region capable of folding into ...
CD34
"Structural and partial amino acid sequence analysis of the human hemopoietic progenitor cell antigen CD34". Leukemia. 2 (12): ... September 1996). "Generation and analysis of 280,000 human expressed sequence tags". Genome Research. 6 (9): 807-828. doi: ...
FAM178B
... spans 110,720 base pairs, and contains 827 amino acids. There are two isoforms of the gene transcript that exist by ... It is also known by the aliases Family with Sequence Similarity 178, Member B, and HSPC234. In total there are 24 exons in the ... "Clustal Omega < Multiple Sequence Alignment < EMBL-EBI". www.ebi.ac.uk. Retrieved 2019-04-29. "ExPASy: SIB Bioinformatics ... "SAPS < Sequence Statistics < EMBL-EBI". www.ebi.ac.uk. Retrieved 2019-04-21. Gene: FAM178B (ENSG00000168754) - Splice variants ...
Echinoderm and flatworm mitochondrial code
Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid ... H. T. Jacobs; D. J. Elliott; V. B. Math; A. Farquharson (20 July 1988). "Nucleotide sequence and gene organization of sea ... P. Cantatore; M. Roberti; G. Rainaldi; M. N. Gadaleta; C. Saccone (5 July 1989). "The complete nucleotide sequence, gene ...
What is the amino acid sequence Trypsin-ultra? | NEB
The amino acid sequence of bovine trypsin is: ,br /, ,br /, IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEG , ... Home FAQs What is the amino acid sequence Trypsin-ultra? FAQ: What is the amino acid sequence Trypsin-ultra?. The amino acid ... enables high throughput workflows for real-time detection of SARS-CoV-2 nucleic acid using hydrolysis probes. For simple, ... SARS-CoV-2 Rapid Colorimetric LAMP Assay Kit includes a color-changing pH indicator for detection of SARS-CoV-2 nucleic acid ...
Use of Predicted Amino Acid Sequence of Envelope-Nonstructural Protein 1 Region to Study Molecular Evolution of Epidemic...
Amino acid changes in a unique sequence of bacteriophage T7 DNA polymerase alter the processivity of nucleotide polymerization
... and a 76-amino acid sequence (residues 258-334), unique to gene 5 protein, has been implicated in this interaction. We have ... examined the effect of amino acid substitution(s) in this region on T7 pha … ... Amino acid changes in a unique sequence of bacteriophage T7 DNA polymerase alter the processivity of nucleotide polymerization ... and a 76-amino acid sequence (residues 258-334), unique to gene 5 protein, has been implicated in this interaction. We have ...
Peptide Mass Fingerprinting and N-Terminal Amino Acid Sequencing of Glycosylated Cysteine Protease of Euphorbia nivulia Buch....
This is the first paper to characterize a Nivulian-II of ,i,E. nivulia,/i, latex with respect to amino acid sequencing. ... The N-terminal sequence (DFPPNTCCCICC) showed partial homology with those of other cysteine proteinases of biological origin. ... were recorded in sequenced peptides. A total of 171 amino acids were sequenced from Nivulian-II protein. The content of serine ... N-terminal amino acid sequence and tryptic digestion profile of nivulian infer the exclusive nature of enzyme and it may be a ...
Greater simplicity and reliability in the determination of amino acid sequences
... overlay of multiple chromatograms and automatic estimation of amino acid sequences, which are required for sequence analysis. ... For amino acid sequences, the PPSQ 51A / 53 A protein sequencer series and the LabSolutions PPSQ software create user benefits ... This improves baseline stability and allows high-sensitivity analysis of PTH-amino acids. Isocratic sequence analysis provides ... Greater simplicity and reliability in the determination of amino acid sequences. .social-ris-container { display: flex; justify ...
Soil amino acid composition across a boreal forest successional sequence - LTER
Use of Predicted Amino Acid Sequence of Envelope-Nonstructural Protein 1 Region to Study Molecular Evolution of Epidemic...
Partial amino acid sequence of osteocalcin from an extinct species of ratite bird | Garvan Institute of Medical Research
The sequence of the N-terminal region of moa osteocalcin was determined using gas phase N-terminal sequencing. The N-terminal ... Alignment of the N-terminal sequence of osteocalcin from the extinct moa against the osteocalcins of the extant ostrich, rhea ... Osteocalcin the major gamma carboxyglutamic acid containing protein of vertebrate bone has been purified from the bones of a ... sequences of the ostrich and rhea osteocalcins were also determined. ...
AA amyloidosis in chinese shar-pei dogs: Immunohistochemical and amino acid sequence analyses<...
AA amyloidosis in chinese shar-pei dogs : Immunohistochemical and amino acid sequence analyses. In: Amyloid. 1995 ; Vol. 2, No ... keywords = "Aa amyloid, Amino acid sequence, Amyloid, Chinese Shar-Pei, Imuunohistochemistry",. author = "Johnson, {Kenneth H ... Dive into the research topics of AA amyloidosis in chinese shar-pei dogs: Immunohistochemical and amino acid sequence analyses ... AA amyloidosis in chinese shar-pei dogs : Immunohistochemical and amino acid sequence analyses. / Johnson, Kenneth H.; Sletten ...
4 To 5 Amino Acid Residues In Defined Sequence Patents and Patent Applications (Class 530/330) - Justia Patents Search
Search for 4 To 5 Amino Acid Residues In Defined Sequence Patents and Patent Applications (Class 530/330) Filed with the USPTO ... Products Thereof Patents Peptides Of 3 To 100 Amino Acid Residues Patents 4 To 5 Amino Acid Residues In Defined Sequence ... 4 To 5 Amino Acid Residues In Defined Sequence Patents (Class 530/330) ... Benzoic acid, benzoic acid derivatives and heteroaryl carboxylic acid conjugates of oxycodone, prodrugs, methods of making and ...
37 C.F.R. 1.824: Form and format for nucleotide and/or amino acid sequence submissions in computer readable form, June 2020 ...
Form and format for nucleotide and/or amino acid sequence submissions in computer readable form. Taken from the 9th Edition of ... 37 CFR 1.824: Form and format for nucleotide and/or amino acid sequence submissions in computer readable form Taken from the ... 1.824 Form and format for nucleotide and/or amino acid sequence submissions in computer readable form. * (a) The computer ... 3) The computer readable form may be created by any means, such as word processors, nucleotide/amino acid sequence editors or ...
Formats: Text / Subjects: Amino Acid Sequence and Base Sequence / Titles: Hox-1.11 and Hox-4.9 Homeobox Genes / Languages:...
Amino Acid Sequence ✖Remove constraint Subjects: Amino Acid Sequence Subjects Base Sequence ✖Remove constraint Subjects: Base ... Amino Acid Sequence. Base Sequence. Genes, Homeobox. Molecular Sequence Data Archival Collection: The Marshall W. Nirenberg ... Sequence Titles Hox-1.11 and Hox-4.9 Homeobox Genes ✖Remove constraint Titles: Hox-1.11 and Hox-4.9 Homeobox Genes Languages ...
DI-fusion Holdings: Role of the amino acid sequences in domain swapping...
Amino acid sequence of progesterone-induced rabbit uteroglobin - Wikidata
Amino acid sequence of penicillopepsin. I. Isolation and characterization of the chymotryptic peptides<...
Amino acid sequence of penicillopepsin. I. Isolation and characterization of the chymotryptic peptides. / Kurosky, A.; Hofmann ... Kurosky A, Hofmann T. Amino acid sequence of penicillopepsin. I. Isolation and characterization of the chymotryptic peptides. ... title = "Amino acid sequence of penicillopepsin. I. Isolation and characterization of the chymotryptic peptides", ... Amino acid sequence of penicillopepsin. I. Isolation and characterization of the chymotryptic peptides. ...
Reference amino acid sequence of Glucocerebrosidase - Bioinformatikpedia
Reference amino acid sequence of Glucocerebrosidase. From Bioinformatikpedia. Revision as of 16:49, 13 May 2011 by Braunt. ( ... Retrieved from "https://i12r-studfilesrv.informatik.tu-muenchen.de/wiki/index.php?title=Reference_amino_acid_sequence_of_ ... Fasta Sequence. ,sp,P04062,GLCM_HUMAN Glucosylceramidase OS=Homo sapiens GN=GBA PE=1 SV=3 ...
Protecting amino acid and nucleic acid sequence variants | ZBM Patents & Trademarks
Amplification, cloning, and sequence comparison of the growth hormone gene for carp (Cyprinus carpio) by the polymerase chain...
... base pairs which code for a polypeptide of 210 amino acids including 22 amino acids of the signal peptide and 188 amino acids ... Nucleotide sequence and amino acid sequence of our carp growth hormone gene are the same as Korens carp GH cDNA in the coded ... Compared with Chaos carp GH cDNA, the homology of nucleotide sequence and amino acid sequence for our carp growth hormone gene ... Amplification, cloning, and sequence comparison of the growth hormone gene for carp (Cyprinus carpio) by the polymerase chain ...
Organizing the bacterial annotation space with amino acid sequence embeddings - BioTech Mag
ll👉FREE Essay | A primary structure is the distinctive sequence of amino Acids
A primary structure is the distinctive sequence of amino acids which make up a protein This sequence is also known as a ... This happens in the r groups of amino acids in the chain 6 Each amino acid consists of a central atom with an amino acid group ... polypeptide chain of amino acids Amino acids are attached together via the peptide bonds Then they make chains of amino acid ... A primary structure is the distinctive sequence of amino acids which make up a protein This sequence is also known as a ...
Part 2 Chapter 9 Tables|HuGE|Books|Resources|Genomics|CDC
Convert amino acid sequence from integer to letter representation - MATLAB int2aa
- MathWorks América Latina
... a row vector of integers specifying an amino acid sequence, to SeqChar, a character vector or string of single-letter codes ... Row vector of integers specifying an amino acid sequence. For valid integers, see the table Mapping Amino Acid Integers to ... acid sequence, to SeqChar. , a character vector or string of single-letter codes specifying the same amino acid sequence. For ... Amino acid sequence specified by a character vector of single-letter codes. ...
Structural Bioinformatics Library: T Default amino acid seqan sequence converter| Dummy | Class Template Reference
... acid_seqan_sequence_converter, Dummy ,. Default converter that justs returns the input name as the seqan amino acid name, and ... T_Default_amino_acid_seqan_sequence_converter. *Generated on Thu Oct 6 2022 19:58:13 for Structural Bioinformatics Library by ... T_Default_amino_acid_seqan_sequence_converter, Dummy , Class Template Reference. Reference Manuals » Alignment_engines ... to_seqan_sequence_unit() [1/2]. char to_seqan_sequence_unit (. char name. ). const. ...
HK1 Enzyme Human Recombinant | Hexokinase 1 Protein | ProSpec
... polypeptide chain encoding the sequence of 937 amino acids. ... 20 amino acids His tag at the N-terminal encoding the sequence ... Amino acid sequence. MGSSHHHHHH SSGLVPRGSH MIAAQLLAYY FTELKDDQVK KIDKYLYAMR LSDETLIDIM TRFRKEMKNG LSRDFNPTAT VKMLPTFVRS ... of 937 amino acids and having a molecular mass of 104.6 kDa. ...
NdPASA: A novel pairwise protein sequence alignment algorithm that incorporates neighbor-dependent amino acid propensities<...
NdPASA: A novel pairwise protein sequence alignment algorithm that incorporates neighbor-dependent amino acid propensities. ... NdPASA : A novel pairwise protein sequence alignment algorithm that incorporates neighbor-dependent amino acid propensities. / ... NdPASA : A novel pairwise protein sequence alignment algorithm that incorporates neighbor-dependent amino acid propensities. In ... NdPASA: A novel pairwise protein sequence alignment algorithm that incorporates neighbor-dependent amino acid propensities. ...
Tracing outbreaks with machine learning | Nature Reviews Microbiology
AmPEP: Sequence-based prediction of antimicrobial peptides using distribution patterns of amino acid properties and random ... The routine use of whole-genome sequencing for the surveillance of food-borne illness is extending to more organizations1, ... Practical value of food pathogen traceability through building a whole-genome sequencing network and database. J. Clin. ...
Folding Revolution | Harvard Medical School
These AI approaches, however, do not predict structures based solely on a proteins amino acid sequence. Thus, they are limited ... For each amino acid, the model predicts the most likely angle of the chemical bonds that connect the amino acid with its ... of artificial intelligence known as deep learning to predict the 3D structure of a protein based on its amino acid sequence. ... A visual simulation of how the model calculates the angles of the bonds between amino acids, and angle of rotation around those ...
NUCLEIC ACID AND AMINO ACID SEQUENCES RELATING TO STREPTOCOCCUS PNEUMONIAE FOR DIAGNOSTICS AND THERAPEUTICS - Patent application
... by amino acid substitution, addition or deletion of at least one amino acid residue) in amino acid sequence at 1, 2, 3, 5, 10 ... the amino acid sequence which differs in sequence identity by about 7% to about 8% from the S. pneumoniae amino acid sequences ... Additionally, D-amino acids, non-natural amino acids, or non-amino acid analogs can be substituted or added to produce a ... of an amino acid sequence of the invention contained in the Sequence Listing; fused, in reading frame, to additional amino acid ...
ProteinsResiduesGenomeGenesSimilarityGeneHomologyAccessionThousands of amino acidsNucleotide sequencePhylogeneticPartialEncodesAlignmentPolypeptide chainAlignmentsHomologous sequencesVariantsEnzymeNucleic acidsGeneticRecombinantBovineCHOLIC ACIDTRNAPeptidesReactive-siteIdenticalPutativeAnalysisGenomicHydrophobicFASTA2020FattyAbstractPolypeptidesGenBankExonsProtein structureQuery sequenceGlutamic acidInterestinglySelectivityGrowth hormonePatternsStrainsResidue
Proteins17
- The genes encode proteins of 210 amino acids and show considerable similarity to growth hormones characterized in other salmonids and fishes. (rdproductions-events.com)
- All these proteins consist of 47 residues, contain eight cysteine residues forming four disulphide bridges, and show the presence of two clusters of basic amino acids located at both ends of the polypeptide chain. (elsevier.com)
- Existing sequence alignment methods can produce reliable alignments for homologous proteins sharing a high percentage of sequence identity. (elsevier.com)
- Wang, J & Feng, JA 2005, ' NdPASA: A novel pairwise protein sequence alignment algorithm that incorporates neighbor-dependent amino acid propensities ', Proteins: Structure, Function and Genetics , vol. 58, no. 3, pp. 628-637. (elsevier.com)
- Composed of long chains of amino acids, proteins perform these myriad tasks by folding themselves into precise 3D structures that govern how they interact with other molecules. (harvard.edu)
- In recent years, computational methods have made significant strides in predicting how proteins fold based on knowledge of their amino acid sequence. (harvard.edu)
- Proteins are built from a library of 20 different amino acids. (harvard.edu)
- Many proteins are thousands of amino acids long, and the complexity quickly exceeds the capacity of human intuition or even the most powerful computers. (harvard.edu)
- This strongly suggests functional reasons for the amino acid sequences of human and ape proteins, and shows their similarities can be explained as being due to functional requirements. (evolutionnews.org)
- Although mammals do not produce chitin, they have two functional chitinases, Chitotriosidase (CHIT1) and acidic mammalian chitinase (AMCase), as well as chitinase-like proteins (such as YKL-40 ) that have high sequence similarity but lack chitinase activity. (wikipedia.org)
- BLAT on proteins finds sequences of 80% and greater similarity of length 20 amino acids or more. (ucsc.edu)
- The ARFs are a family of 21,000 M(r) proteins with biological roles in constitutive secretion and activation of phospholipase D. The structure of ARF-1 complexed to GDP determined from two crystal forms reveals a topology that is similar to that of the protein p21 ras with two differences: an additional amino-terminal helix and an extra beta-strand. (embl.de)
- Fatty acid-binding proteins (FABPs) are a family of fatty acid-binding small proteins essential for lipid trafficking, energy storage and gene regulation. (nottingham.ac.uk)
- Although they have 20 to 70% amino acid sequence identity, these proteins share a conserved tertiary structure comprised of ten beta sheets and two alpha helixes. (nottingham.ac.uk)
- Precursor ion scanning for fragment ions of oxidized amino acid residues was investigated as a label-free MS approach to mapping specific oxPTMs in a complex mixture of proteins. (aston.ac.uk)
- ps_scan will be run with your sequence against profiles specific for Proteins described elsewhere . (inra.fr)
- Using phylogenetic analysis and amino acid sequence alignments of the spike and replicase (NSP12) proteins, we searched for possible targets for vaccine coverage or potential therapeutic agents. (bvsalud.org)
Residues9
- T7 gene 5 DNA polymerase forms a complex with Escherichia coli thioredoxin (its processivity factor), and a 76-amino acid sequence (residues 258-334), unique to gene 5 protein, has been implicated in this interaction. (nih.gov)
- An insert of eight amino acids (represented by positions 69-76) was confirmed between residues corresponding to positions 69 and 70 of human protein AA, which is consistent with the previously reported sequence in non-Shar-pei breeds. (umn.edu)
- While there were no significant differences between glutamic and aspartic acid residues, serine-containing peptides were 4-fold better substrates than threonine. (nih.gov)
- Unlike beta-ARK, RK preferred acid residues localized to the carboxyl-terminal side of the serine. (nih.gov)
- Human growth hormone has a molecular mass of 22,005 and contains 191 amino acid residues with 2 disulfide bridges (niall et al. (rdproductions-events.com)
- In addition, the D-polymer gave more inhibition than the L, which would indicate a specificity of the antibody for D-glutamic acid residues. (ias.ac.in)
- Eleven of the amino terminal 14 amino acid residues have been assigned in the Β chain of the murine I-C d subregion molecule. (elsevier.com)
- In particular, the intronless FABP genes, in most of which the key residues involved in fatty acid binding varied, were common in five phyla. (nottingham.ac.uk)
- For each profile, the multiple sequence alignments contain annotations of residues conserved in the whole family, plus residues specific to the subfamily. (inra.fr)
Genome12
- The routine use of whole-genome sequencing for the surveillance of food-borne illness is extending to more organizations 1 , which provides an opportunity to leverage the data to better attribute cases of food poisoning. (nature.com)
- Whole genome sequence analysis of serum amino acid levels. (bvsalud.org)
- Whole genome sequence analysis of amino acid levels may establish a paradigm for analyzing quantitative risk factors . (bvsalud.org)
- The results also help establish a paradigm for whole genome sequence analysis of quantitative traits. (bvsalud.org)
- Paste in a query sequence to find its location in the the genome. (ucsc.edu)
- The Human Genome Variation Society (HGVS) has established a sequence variant nomenclature , an international standard used to report variation in genomic, transcript and protein sequences. (ucsc.edu)
- Full-length genome sequence of this putative novel Usutu virus strain, designated Usutu-BONN, was successfully attained. (cdc.gov)
- In conclusion, the authors detected and genetically characterized a putative novel Usutu virus strain (Usutu-BONN) by determining its complete genome sequence and comparing it with Usutu virus strains for which complete polyprotein-encoding sequences are available. (cdc.gov)
- We compared the results from 3 diagnostic pipelines in patients with ID/NDD: genome sequencing (GS) first (N = 100), GS as a secondary test (N = 129), or chromosomal microarray (CMA) with or without FMR1 analysis (N = 421). (cdc.gov)
- By offering empowerment and control, companies convince consumers to sequence their genome by granting the company access to their genetic data in exchange to results that are not always accurate. (bvsalud.org)
- Thus, it is crucial to compare COVID-19 genome sequences from the African continent with sequences from COVID-19 hotspots (including China, Brazil, Italy, United State of America and the United Kingdom). (bvsalud.org)
- Enterovirus genotyping was performed by partial sequencing of the VP1 region of the enterovirus genome. (who.int)
Genes9
- In this paper we present the nucleotide sequences of the thymidine kinase (TK) genes of two avian herpesviruses: a highly oncogenic strain of Marek's disease virus (MDV strain RB1B) and its serologically related vaccine virus, the herpesvirus of turkeys (HVT strain Fc-126). (kent.ac.uk)
- The predicted coding regions of the two genes are 1029 and 1050 nucleotides respectively, corresponding to polypeptides of 343 and 350 amino acids in length. (kent.ac.uk)
- Examining amino acid sequences for each of these genes will give more specific information on possible antigen binding. (cdc.gov)
- Target genes for PPARalpha include many enzymes involved in the oxidation of fatty acids in mitochondria and peroxisomes. (avhandlingar.se)
- We have now cloned and characterized a family of acyl-CoA thioesterase genes in mouse and human, which show a high degree of sequence similarity. (avhandlingar.se)
- Genes involucrados en la amelogénesis imperfecta. (bvsalud.org)
- involucrados en la AI no sindrómica, las proteínas codificas por estos genes y sus funciones, de acuerdo amelogénesis a la evidencia científica actual. (bvsalud.org)
- Las futuras investigaciones abordadas desde la visión translacional ayudarán estética dental, a identificar nuevas mutaciones o nuevos genes, lo cual contribuirá a la evolución en la manera de clasificar, genes. (bvsalud.org)
- In addition, IGS sequencing (e.g., sequencing of intergenic regions between the 16S and 23S rRNA genes) has been used to taxonomy studies, while partial sequencing of the gene gtfB , which encodes the enzyme glucosyltransferase B, has been used to investigate enzymatic activity and virulence 11-12 . (bvsalud.org)
Similarity7
- Sequential analysis of the first 17 amino acids from the amino-terminus of human placental lactogen reveals similarity to the sequence of human growth. (rdproductions-events.com)
- The amino acid sequences of the α-amylase inhibitors share a high degree of similarity with the related plant γ-thionins. (elsevier.com)
- Sequence similarity showed that the 3 Northeast Thai strains were closest to the DSS isolate (H) followed by the DHF isolate (D) identified in Bangkok in 1980. (who.int)
- Hall, L. A 23 kDa protein from rat sperm plasma membranes shows sequence similarity and phospholipid binding properties to a bovine brain cytosolic protein. (cnr.it)
- BLAT on DNA is designed to quickly find sequences of 95% and greater similarity of length 25 bases or more. (ucsc.edu)
- These acyl-CoA thioesterases showed sequence similarity only to the bile acid-CoA:amino acid N- acyltransferase involved in conjugation of bile acids to glycine or taurine. (avhandlingar.se)
- Based on the genetic similarity of the isolates and pattern of amino acid variations identified by partial sequencing of the gtfB gene, base-pair changes were identified and correlated with different virulence patterns among the isolates. (bvsalud.org)
Gene17
- Blood levels of amino acids are important biomarkers of disease and are influenced by synthesis, protein degradation , and gene-environment interactions . (bvsalud.org)
- Over all four analysis strategies , 14 gene - amino acid associations were identified and replicated. (bvsalud.org)
- IMSEAR at SEARO: Comparative nucleotide and deduced amino acid sequence of the envelope glycoprotein gene among three dengue virus type 2 strains isolated from patients with different disease severities in Maha Sarakham, northeast Thailand. (who.int)
- Duangchanda S, Tanaka M, Morita K, Rojanasuphot S, Igarashi A. Comparative nucleotide and deduced amino acid sequence of the envelope glycoprotein gene among three dengue virus type 2 strains isolated from patients with different disease severities in Maha Sarakham, northeast Thailand. (who.int)
- The nucleotide (nt) sequence of the envelope glycoprotein (E) gene of dengue virus type 2 was determined by the primer-extension dideoxy chain-termination method for 3 dengue virus type 2 (D2) strains which had been isolated from patients with dengue fever (DF), dengue hemorrhagic fever (DHF), and dengue shock syndrome (DSS), in Maha Sarakham, Northeast Thailand, in 1986-1987. (who.int)
- Most CSF1R gene mutations in ALSP change single protein building blocks (amino acids) in the CSF-1 receptor. (medlineplus.gov)
- Expression is mediated by the NPR1 gene and the salicylic acid pathway, both involved in resistance to fungal and insect attack. (wikipedia.org)
- And as the gene sequences of the chitinases were known, they were further classified into six classes based on their sequences. (wikipedia.org)
- Adiponectin, also referred to as Acrp30, AdipoQ and GBP-28, is a recently discovered 244 aminoacid protein, the product of the apM1 gene, which is physiologically active and specifically and highly expressed in adipose cells. (biovendor.com)
- less studied has been the relationship between having a glutamic acid at position 71(E71) of the HLA-DRB1 gene in conjunction with E69 carriage and risk of CBD or BeS. (cdc.gov)
- Genomic analysis revealed several unique amino acid substitutions among the polyprotein gene. (cdc.gov)
- Myers MW, Lazzarini RA, Lee VM, Schlaepfer WW, Nelson DL: The human mid-size neurofilament subunit: a repeated protein sequence and the relationship of its gene to the intermediate filament gene family. (t3db.ca)
- The partial amino acid sequencing in 226 region of the E1 gene was carried out for detection of A226V mutation with primers developed by TIB MOLBIOL (Genbank accession number AF369024). (who.int)
- Human DNA gene sequencing has long been known for Chromosome 8, commonly known as the God Gene for its specific effect on Human Behaviors (see definition in next section). (ethealing.com)
- The PCR test template (gene sequence) for the "lab test" also is the same as that found on Chromosome 8, and it has also been found in Swabs used to collect nasal cell samples. (ethealing.com)
- Next, the isolates were differentiated by sequencing a specific region of the gene encoding the enzyme glucosyltransferase B ( gtfB ). (bvsalud.org)
- Conclusions: The partial sequencing of the gtfB gene can be a useful tool for elucidating the colonization patterns of S. mutans . (bvsalud.org)
Homology6
- The N-terminal sequence (DFPPNTCCCICC) showed partial homology with those of other cysteine proteinases of biological origin. (hindawi.com)
- Alignment of the N-terminal sequence of osteocalcin from the extinct moa against the osteocalcins of the extant ostrich, rhea and emu reveals the homology amongst the ratite species is greater than the homology with the chicken osteocalcin. (garvan.org.au)
- Comparison with other available herpesvirus TK sequences reveals a greater homology to those of the alphaherpesviruses than to those of the gammaherpesviruses. (kent.ac.uk)
- No overall homology was found when compared with the chicken cytoplasmic TK sequence. (kent.ac.uk)
- If you need to get more sequences with lower homology score, increase the "expect" value. (nbrp.jp)
- If you need only sequences with very high homology scores, decrease the value. (nbrp.jp)
Accession5
- diagrams show the sequence numbers from your A of the translation initiation codon, based on mRNA (accession quantity "type":"entrez-nucleotide","attrs":"text":"Abdominal004550″,"term_id":"2924554″Abdominal004550). (cancer-ecosystem.com)
- These 3 sequences were deposited in the GenBank database under accession nos. (cdc.gov)
- PDF 44 KB) Additional file 7: Alignment of sequences mapping with the same reference sequence with identical accession number in the Greengenes database, and resulting in different digital T-RFs. (mdm2signaling.com)
- 10 It showed 99% amino acid identity to EV-C105 with sequence coverage of 100% (GenBank accession number: AFG25720), an EV-C105 strain that was identified in Cyprus in 2012. (who.int)
- The next closest genotype was EV-109 with 89% amino acid identity (GenBank accession number: ADK22861), another group C enterovirus. (who.int)
Thousands of amino acids1
- Proteases are enzymes which potentially hydrolyze anything that contains peptide bond, from a dipeptide up to a large protein, containing thousands of amino acids and, thus, it comprises a group of hydrolases that are the most relevant in technological terms. (hindawi.com)
Nucleotide sequence2
Phylogenetic2
- The possibility of an African origin of this virus strain is strengthened by the fact that phylogenetic analysis of complete polyprotein sequence established a separate basal lineage for the Usutu-BONN strain in a sister relationship with the African Usutu virus strains. (cdc.gov)
- Next-generation sequencing and phylogenetic analysis identified the virus as a novel member of the genus Thogotovirus . (cdc.gov)
Partial1
- 6 A partial VP1 sequence was then obtained by amplification and sequencing of a 375bp region. (who.int)
Encodes4
- The human gh cdna encodes a 217 amino acid (aa) residue precursor protein with a 26 aa putative signal peptide. (rdproductions-events.com)
- 9. An isolated nucleic acid having at least 80% identity to SEQ ID NO: 449, wherein the isolated nucleic acid encodes a S. pneumoniae surface protein. (patentsencyclopedia.com)
- andc) an RNA of a) or b), wherein U is substituted for T;wherein the isolated nucleic acid encodes a S. pneumoniae surface protein. (patentsencyclopedia.com)
- It encodes a protein of about 68 kDa that consists of eight 68-amino acid repeats separated by linking sequences of variable lengths. (creativebiomart.net)
Alignment7
- Sequence alignment has become one of the essential bioinformatics tools in biomedical research. (elsevier.com)
- We report here a new method, NdPASA, for pairwise sequence alignment. (elsevier.com)
- This method employs neighbor-dependent propensities of amino acids as a unique parameter for alignment. (elsevier.com)
- NdPASA optimizes alignment by evaluating the likelihood of a residue pair in the query sequence matching against a corresponding residue pair adopting a particular secondary structure in the template sequence. (elsevier.com)
- Statistical analyses of the performance of NdPASA indicate that the introduction of sequence patterns of secondary structure derived from neighbor-dependent sequence analysis clearly improves alignment performance for sequence pairs sharing less than 20% sequence identity. (elsevier.com)
- There is an optional add-on bioinformatics activity where students use DNA sequence alignment data to confirm or modify their tree. (edu.au)
- The tree was computed from amino acid sequence alignment using maximum likelihood (ML) method with PhyML software and was plotted and edited in FigTree graphical viewer. (cdc.gov)
Polypeptide chain3
- HK1 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain fused to a 20 amino acids His tag at the N-terminal encoding the sequence of 937 amino acids and having a molecular mass of 104.6 kDa. (prospecbio.com)
- SEPX1 Human Recombinant fused with a 20 amino acid His tag at N-terminus produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 136 amino acids (1-116 a.a.) and having a molecular mass of 14.8kDa. (angioproteomie.com)
- The order of amino acids as they occur in a polypeptide chain. (bvsalud.org)
Alignments1
- It may miss more divergent or shorter sequence alignments. (ucsc.edu)
Homologous sequences2
Variants1
- Indentification of dna sequence variants for amino acid residue 127 of bovine growth hormone using the polymerase chain reaction method. (rdproductions-events.com)
Enzyme4
- This specificity and hydrolysis conditions (pH, temperature, hydrolysis time, and enzyme dosage) affect peptide chain size, amino acid sequence and the amount of free amino acid, thus affecting the biological activity of the hydrolysate ( 6 ). (frontiersin.org)
- Petroselinic acid was a topoisomerase inhibitor of the cleavable complex-nonforming type and acted directly on the enzyme molecule in a noncompetitive manner without DNA intercalation. (semanticscholar.org)
- Characteristics that determined the classes of chitinases were the N -terminal sequence, localization of the enzyme, isoelectric pH , signal peptide , and inducers . (wikipedia.org)
- They used the Align, Clustal V, and FASTA programs to compare the amino acid sequences and exploited overseas protein sequence databases to study the molecular evolution of a nuclease, an enzyme that splits nucleic acids. (nkeconwatch.com)
Nucleic acids1
- Nucleic Acids Res. (pseudomonas.com)
Genetic4
- These results suggest that there may be substantial genetic effects on amino acid levels in the general population that may underlie inborn errors of metabolism . (bvsalud.org)
- These data provide insights into genetic influences on circulating amino acid levels by integrating -omic technologies in a multi-ethnic population . (bvsalud.org)
- Genetic sequencing was performed on HIV strains from 29 of the 92 seropositive patients from the practices of three HCWs. (cdc.gov)
- After publication of the severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) genetic sequence on January 11, 2020, research and collaboration among scientists and biopharmaceutical manufacturers quickly followed. (medscape.com)
Recombinant4
- Overview no studies on the interactions with other drugs have been performed since recombinant somatropin has the same amino acid sequence as. (rdproductions-events.com)
- 2. A recombinant expression vector comprising the nucleic acid of claim 1 operably linked to a transcription regulatory element. (patentsencyclopedia.com)
- 18. A recombinant expression vector comprising the nucleic acid of claim 17 operably linked to a transcription regulatory element. (patentsencyclopedia.com)
- Recombinant full length protein, corresponding to amino acids 1-673 of Human Annexin VI with an N terminal His tag. (creativebiomart.net)
Bovine1
- Bovine and human IGF-1 share exactly the same amino acid sequence," Danby wrote in the article. (thedartmouth.com)
CHOLIC ACID1
- The sterol 12alpha-hydroxylase is involved in bile acid synthesis, and results in the production of cholic acid. (avhandlingar.se)
TRNA1
- Translation or protein synthesis is a multi-step process that requires a lot of molecules including transfer RNAs (tRNA), amino acids, ATP, GTP and other cofactors to transfer information from mRNA to protein in ribosomes. (bostonmolecules.com)
Peptides3
- A family of peptides was synthesized to further study the role of acidic amino acids in peptide substrates of beta-ARK. (nih.gov)
- The cystine-containing peptides of horse growth hormone were isolated and their amino acid sequences determined. (rdproductions-events.com)
- The amino acid composition, sequence, length, total charge, and hydrophobicity of bioactive peptides will affect their activities ( 7 ). (frontiersin.org)
Reactive-site1
- The amino acid sequence around the reactive site of API-2 (b and c) was very similar to that of S-SI (Streptomyces subtilisin inhibitor) with the exception of the isoleucine residue in place of valine residue i. (semanticscholar.org)
Identical6
- This has identical 191-amino acid sequence to the endogenous hormone. (rdproductions-events.com)
- The amino acid sequence of the product is identical to that of the natural human growth hormone. (rdproductions-events.com)
- Therefore, these 3 strains possessed identical deduced amino acid (AA) sequences in their E protein. (who.int)
- For the most part, scientists have been able to study many identical molecules folding together en masse . (bionity.com)
- Sequencing results showed that all samples, except one blackbird-derived Usutu virus sequence, were identical and originated from southwest Germany. (cdc.gov)
- This protein has the identical amino acid coding (sequence) found in Human DNA-Chromosome 8. (ethealing.com)
Putative1
- Putative nucleotide- and nucleoside-binding sites have been identified within the two predicted amino acid sequences. (kent.ac.uk)
Analysis6
- This improves baseline stability and allows high-sensitivity analysis of PTH-amino acids. (pharmtech.com)
- Isocratic sequence analysis provides more stable retention times, so peaks detected in previous cycles can be cancelled using subtraction chromatogram processing, making it easier to identify sequences. (pharmtech.com)
- Specialized protein sequencer software makes it simple to perform reprocessing of chromatograms, overlay of multiple chromatograms and automatic estimation of amino acid sequences, which are required for sequence analysis. (pharmtech.com)
- The amyloid protein had a blocked N-terminus but deblocking and sequence analysis ofpeptides obtained after cyanogen bromide and BNPS-skctole cleavage provided an amino acid sequence conforming to positions 1 through 91 of dog SAA. (umn.edu)
- Histones, confirmed by sequence analysis, were present in several SDS-PAGE bands (molecular masses of approximately 18.5, 17.5, and 13 kDa) from purified renal medullary amyloid of one Shar-pei dog. (umn.edu)
- Also, an analysis is performed by means of statistical and artificial neural network methods from which it is concluded that the folding properties can be predicted to a certain degree given the binary numbers characterizing the sequences. (lu.se)
Genomic1
- For the first time there is evidence that polymerase theta has the ability for reverse-transcription, that is mRNA products with sequencing complimentary to the DNA template can replace and encode genomic DNA strands permanently into newly formed cells. (ethealing.com)
Hydrophobic1
- Folding properties of a two-dimensional toy protein model containing only two amino acid types, hydrophobic and hydrophilic, respectively, are analyzed. (lu.se)
FASTA1
- The Input data for PeroxiScan are Protein sequences in fasta format. (inra.fr)
20201
- A primary structure is the distinctive sequence of amino Acids08-May-2020. (noplag.com)
Fatty2
- The inhibitory effects of various fatty acids on three hyaluronidases and four chondroitinases were examined, and their structure-activity relationships and mechanism of action were studied. (semanticscholar.org)
- Our work involves characterization of a group of acyl-CoA thioesterase enzymes, that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH). (avhandlingar.se)
Abstract1
- abstract = "The complete primary structure of a new α-amylase inhibitor from Sorghum bicolor belonging to the γ-thionin family has heen determined and the amino acid sequences of two components of the family already elucidated have been corrected by combining the classical Edman degradation with advanced mass spectrometric procedures. (elsevier.com)
Polypeptides1
- Polypeptides with known repeating sequences of amino acids. (ias.ac.in)
GenBank1
- 9 The sequence was compared to known VP1 sequences in GenBank using tblastx (which searches a translated nucleotide database using a translated nucleotide query). (who.int)
Exons1
- In a discovery cohort of 1872 African Americans and a replication cohort of 1552 European Americans we sequenced exons and whole genomes and measured serum levels of 70 amino acids . (bvsalud.org)
Protein structure1
- The most advanced algorithms calculate protein structure by running on supercomputers-or crowd-sourced computing power in the case of projects such as [email protected] and [email protected] simulate the complex physics of amino acid interactions through brute force. (harvard.edu)
Query sequence3
- blastp - Comparing an amino acid query sequence against a protein sequence database. (nbrp.jp)
- blastx - Comparing a nucleotide query sequence translated in all reading frames aginst a protein sequence database. (nbrp.jp)
- The server filters your query sequence for low compositional complexity regions by default. (nbrp.jp)
Glutamic acid1
- Are they associated with increases in hepatic drug and bile salt export pump (bsep) is exclusively expressed on of the prolongation has been carried out following the formulation most ready-to-use liquid preparations shampoos and sary, for instance 171i-sodium iodide (pain palliation of estrogens physical differences of arithmetic means are used to treat exhibits no selectivity for ascii tropic glutamic acid and secretin. (sdchirogroup.com)
Interestingly1
- Interestingly, deletion of 11 amino-terminal amino acids unique to Ral GTPases, which abolished the ability of RalA to precipitate PLD activity, prevented the association between RalA and Arf. (embl.de)
Selectivity1
- Using a double quadrupole linear ion trap mass spectrometer, precursor ion scanning was combined with detection of MS(3) fragment ions from the immonium ions and collisionally-activated decomposition peptide sequencing to achieve selectivity for the oxPTMs. (aston.ac.uk)
Growth hormone3
- Somatotropin amino acid sequence, growth hormone. (rdproductions-events.com)
- The major isoform of the human growth hormone is a protein of 191 amino acids and a molecular weight of 22,124 daltons. (rdproductions-events.com)
- Parent-primary structure (amino acid sequence) of growth hormone. (rdproductions-events.com)
Patterns1
- With these criteria sequence patterns that fold well are isolated. (lu.se)
Strains2
Residue1
- By kinetic analyses of the phosphorylation reactions, beta-ARK exhibited a marked preference for negatively charged amino acids localized to the NH2-terminal side of a serine or threonine residue. (nih.gov)