N-Terminal Acetyltransferase B: An N-terminal acetyltransferase subtype that consists of the Naa20p catalytic subunit and the Naa25p auxiliary subunit. The structure of this enzyme is conserved between YEASTS and HUMAN. It has specificity for the N-terminal METHIONINE of peptides where the next amino acid in the chain is either ASPARTATE; GLUTAMATE; ASPARAGINE; OR GLUTAMINE.Xenopus laevis: The commonest and widest ranging species of the clawed "frog" (Xenopus) in Africa. This species is used extensively in research. There is now a significant population in California derived from escaped laboratory animals.Xenopus: An aquatic genus of the family, Pipidae, occurring in Africa and distinguished by having black horny claws on three inner hind toes.Databases, Genetic: Databases devoted to knowledge about specific genes and gene products.Cell Cycle: The complex series of phenomena, occurring between the end of one CELL DIVISION and the end of the next, by which cellular material is duplicated and then divided between two daughter cells. The cell cycle includes INTERPHASE, which includes G0 PHASE; G1 PHASE; S PHASE; and G2 PHASE, and CELL DIVISION PHASE.Xenopus Proteins: Proteins obtained from various species of Xenopus. Included here are proteins from the African clawed frog (XENOPUS LAEVIS). Many of these proteins have been the subject of scientific investigations in the area of MORPHOGENESIS and development.Methionyl Aminopeptidases: Aminopeptidases that remove METHIONINE from the amino-terminus of a peptide chain, such as the initiator METHIONINE found on nascent peptide chains.Candida tropicalis: A species of MITOSPORIC FUNGI that is a major cause of SEPTICEMIA and disseminated CANDIDIASIS, especially in patients with LYMPHOMA; LEUKEMIA; and DIABETES MELLITUS. It is also found as part of the normal human mucocutaneous flora.Methionine: A sulfur-containing essential L-amino acid that is important in many body functions.Actomyosin: A protein complex of actin and MYOSINS occurring in muscle. It is the essential contractile substance of muscle.Palmitoyl-CoA Hydrolase: Enzyme catalyzing reversibly the hydrolysis of palmitoyl-CoA or other long-chain acyl coenzyme A compounds to yield CoA and palmitate or other acyl esters. The enzyme is involved in the esterification of fatty acids to form triglycerides. EC 3.1.2.2.Thiolester HydrolasesAcetyl-CoA Hydrolase: An enzyme that catalyzes reversibly the hydrolysis of acetyl-CoA to yield CoA and acetate. The enzyme is involved in the oxidation of fatty acids. EC 3.1.2.1.Search Engine: Software used to locate data or information stored in machine-readable form locally or at a distance such as an INTERNET site.Peroxisomes: Microbodies which occur in animal and plant cells and in certain fungi and protozoa. They contain peroxidase, catalase, and allied enzymes. (From Singleton and Sainsbury, Dictionary of Microbiology and Molecular Biology, 2nd ed)Genome, Human: The complete genetic complement contained in the DNA of a set of CHROMOSOMES in a HUMAN. The length of the human genome is about 3 billion base pairs.Antibodies: Immunoglobulin molecules having a specific amino acid sequence by virtue of which they interact only with the ANTIGEN (or a very similar shape) that induced their synthesis in cells of the lymphoid series (especially PLASMA CELLS).Acyl Coenzyme A: S-Acyl coenzyme A. Fatty acid coenzyme A derivatives that are involved in the biosynthesis and oxidation of fatty acids as well as in ceramide formation.Diethylhexyl Phthalate: An ester of phthalic acid. It appears as a light-colored, odorless liquid and is used as a plasticizer for many resins and elastomers.Enterohemorrhagic Escherichia coli: Strains of ESCHERICHIA COLI that are a subgroup of SHIGA-TOXIGENIC ESCHERICHIA COLI. They cause non-bloody and bloody DIARRHEA; HEMOLYTIC UREMIC SYNDROME; and hemorrhagic COLITIS. An important member of this subgroup is ESCHERICHIA COLI O157-H7.Escherichia coli O157: A verocytotoxin-producing serogroup belonging to the O subfamily of Escherichia coli which has been shown to cause severe food-borne disease. A strain from this serogroup, serotype H7, which produces SHIGA TOXINS, has been linked to human disease outbreaks resulting from contamination of foods by E. coli O157 from bovine origin.Escherichia coli Infections: Infections with bacteria of the species ESCHERICHIA COLI.Escherichia coli Proteins: Proteins obtained from ESCHERICHIA COLI.Sequence Analysis, DNA: A multistage process that includes cloning, physical mapping, subcloning, determination of the DNA SEQUENCE, and information analysis.Shiga Toxin 2: A toxin produced by certain pathogenic strains of ESCHERICHIA COLI such as ESCHERICHIA COLI O157. It shares 50-60% homology with SHIGA TOXIN and SHIGA TOXIN 1.Galaxies: Large aggregates of CELESTIAL STARS; COSMIC DUST; and gas. (From McGraw Hill Dictionary of Scientific and Technical Terms, 6th ed)Sequence Analysis, RNA: A multistage process that includes cloning, physical mapping, subcloning, sequencing, and information analysis of an RNA SEQUENCE.High-Throughput Nucleotide Sequencing: Techniques of nucleotide sequence analysis that increase the range, complexity, sensitivity, and accuracy of results by greatly increasing the scale of operations and thus the number of nucleotides, and the number of copies of each nucleotide sequenced. The sequencing may be done by analysis of the synthesis or ligation products, hybridization to preexisting sequences, etc.Escherichia coli: A species of gram-negative, facultatively anaerobic, rod-shaped bacteria (GRAM-NEGATIVE FACULTATIVELY ANAEROBIC RODS) commonly found in the lower part of the intestine of warm-blooded animals. It is usually nonpathogenic, but some strains are known to produce DIARRHEA and pyogenic infections. Pathogenic strains (virotypes) are classified by their specific pathogenic mechanisms such as toxins (ENTEROTOXIGENIC ESCHERICHIA COLI), etc.EthylenediaminesMethanosarcina barkeri: A species of halophilic archaea whose organisms are nonmotile. Habitats include freshwater and marine mud, animal-waste lagoons, and the rumens of ungulates.Chelating Agents: Chemicals that bind to and remove ions from solutions. Many chelating agents function through the formation of COORDINATION COMPLEXES with METALS.Information Storage and Retrieval: Organized activities related to the storage, location, search, and retrieval of information.Semiconductors: Materials that have a limited and usually variable electrical conductivity. They are particularly useful for the production of solid-state electronic devices.Zinc: A metallic element of atomic number 30 and atomic weight 65.38. It is a necessary trace element in the diet, forming an essential part of many enzymes, and playing an important role in protein synthesis and in cell division. Zinc deficiency is associated with ANEMIA, short stature, HYPOGONADISM, impaired WOUND HEALING, and geophagia. It is known by the symbol Zn.Aspergillus oryzae: An imperfect fungus present on most agricultural seeds and often responsible for the spoilage of seeds in bulk storage. It is also used in the production of fermented food or drink, especially in Japan.Internet: A loose confederation of computer communication networks around the world. The networks that make up the Internet are connected through several backbone networks. The Internet grew out of the US Government ARPAnet project and was designed to facilitate information exchange.PubMed: A bibliographic database that includes MEDLINE as its primary subset. It is produced by the National Center for Biotechnology Information (NCBI), part of the NATIONAL LIBRARY OF MEDICINE. PubMed, which is searchable through NLM's Web site, also includes access to additional citations to selected life sciences journals not in MEDLINE, and links to other resources such as the full-text of articles at participating publishers' Web sites, NCBI's molecular biology databases, and PubMed Central.Pichia: Yeast-like ascomycetous fungi of the family Saccharomycetaceae, order SACCHAROMYCETALES isolated from exuded tree sap.Barth Syndrome: Rare congenital X-linked disorder of lipid metabolism. Barth syndrome is transmitted in an X-linked recessive pattern. The syndrome is characterized by muscular weakness, growth retardation, DILATED CARDIOMYOPATHY, variable NEUTROPENIA, 3-methylglutaconic aciduria (type II) and decreases in mitochondrial CARDIOLIPIN level. Other biochemical and morphological mitochondrial abnormalities also exist.Tripterygium: A plant genus of the family CELASTRACEAE that is a source of triterpenoids and diterpene epoxides such as triptolide.Medication Adherence: Voluntary cooperation of the patient in taking drugs or medicine as prescribed. This includes timing, dosage, and frequency.Mice, Inbred mdx: A strain of mice arising from a spontaneous MUTATION (mdx) in inbred C57BL mice. This mutation is X chromosome-linked and produces viable homozygous animals that lack the muscle protein DYSTROPHIN, have high serum levels of muscle ENZYMES, and possess histological lesions similar to human MUSCULAR DYSTROPHY. The histological features, linkage, and map position of mdx make these mice a worthy animal model of DUCHENNE MUSCULAR DYSTROPHY.User-Computer Interface: The portion of an interactive computer program that issues messages to and receives commands from a user.Cholestyramine Resin: A strongly basic anion exchange resin whose main constituent is polystyrene trimethylbenzylammonium Cl(-) anion.Allylamine: Possesses an unusual and selective cytotoxicity for VASCULAR SMOOTH MUSCLE cells in dogs and rats. Useful for experiments dealing with arterial injury, myocardial fibrosis or cardiac decompensation.Bile Acids and Salts: Steroid acids and salts. The primary bile acids are derived from cholesterol in the liver and usually conjugated with glycine or taurine. The secondary bile acids are further modified by bacteria in the intestine. They play an important role in the digestion and absorption of fat. They have also been used pharmacologically, especially in the treatment of gallstones.Glycosuria: The appearance of an abnormally large amount of GLUCOSE in the urine, such as more than 500 mg/day in adults. It can be due to HYPERGLYCEMIA or genetic defects in renal reabsorption (RENAL GLYCOSURIA).Diabetes Mellitus, Type 2: A subclass of DIABETES MELLITUS that is not INSULIN-responsive or dependent (NIDDM). It is characterized initially by INSULIN RESISTANCE and HYPERINSULINEMIA; and eventually by GLUCOSE INTOLERANCE; HYPERGLYCEMIA; and overt diabetes. Type II diabetes mellitus is no longer considered a disease exclusively found in adults. Patients seldom develop KETOSIS but often exhibit OBESITY.Sodium-Glucose Transporter 2: A sodium-glucose transporter that is expressed in the luminal membrane of the PROXIMAL KIDNEY TUBULES.Hemoglobin A, Glycosylated: Minor hemoglobin components of human erythrocytes designated A1a, A1b, and A1c. Hemoglobin A1c is most important since its sugar moiety is glucose covalently bound to the terminal amino acid of the beta chain. Since normal glycohemoglobin concentrations exclude marked blood glucose fluctuations over the preceding three to four weeks, the concentration of glycosylated hemoglobin A is a more reliable index of the blood sugar average over a long period of time.Cholesterol, LDL: Cholesterol which is contained in or bound to low density lipoproteins (LDL), including CHOLESTEROL ESTERS and free cholesterol.Blood Glucose: Glucose in blood.Insulin: A 51-amino acid pancreatic hormone that plays a major role in the regulation of glucose metabolism, directly by suppressing endogenous glucose production (GLYCOGENOLYSIS; GLUCONEOGENESIS) and indirectly by suppressing GLUCAGON secretion and LIPOLYSIS. Native insulin is a globular protein comprised of a zinc-coordinated hexamer. Each insulin monomer containing two chains, A (21 residues) and B (30 residues), linked by two disulfide bonds. Insulin is used as a drug to control insulin-dependent diabetes mellitus (DIABETES MELLITUS, TYPE 1).Acetyltransferases: Enzymes catalyzing the transfer of an acetyl group, usually from acetyl coenzyme A, to another compound. EC 2.3.1.Genetic Privacy: The protection of genetic information about an individual, family, or population group, from unauthorized disclosure.Histone Acetyltransferases: Enzymes that catalyze acyl group transfer from ACETYL-CoA to HISTONES forming CoA and acetyl-histones.Choline O-Acetyltransferase: An enzyme that catalyzes the formation of acetylcholine from acetyl-CoA and choline. EC 2.3.1.6.Chloramphenicol O-Acetyltransferase: An enzyme that catalyzes the acetylation of chloramphenicol to yield chloramphenicol 3-acetate. Since chloramphenicol 3-acetate does not bind to bacterial ribosomes and is not an inhibitor of peptidyltransferase, the enzyme is responsible for the naturally occurring chloramphenicol resistance in bacteria. The enzyme, for which variants are known, is found in both gram-negative and gram-positive bacteria. EC 2.3.1.28.Molecular Sequence Data: Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.Base Sequence: The sequence of PURINES and PYRIMIDINES in nucleic acids and polynucleotides. It is also called nucleotide sequence.Acetylation: Formation of an acetyl derivative. (Stedman, 25th ed)p300-CBP Transcription Factors: A family of histone acetyltransferases that is structurally-related to CREB-BINDING PROTEIN and to E1A-ASSOCIATED P300 PROTEIN. They function as transcriptional coactivators by bridging between DNA-binding TRANSCRIPTION FACTORS and the basal transcription machinery. They also modify transcription factors and CHROMATIN through ACETYLATION.Carnitine O-Acetyltransferase: An enzyme that catalyzes the formation of O-acetylcarnitine from acetyl-CoA plus carnitine. EC 2.3.1.7.Trehalase: An enzyme that catalyzes the conversion of alpha,alpha-trehalose and water to D-glucose. EC 3.2.1.28.TrehalosePatents as Topic: Exclusive legal rights or privileges applied to inventions, plants, etc.GlycogenSaccharomyces cerevisiae: A species of the genus SACCHAROMYCES, family Saccharomycetaceae, order Saccharomycetales, known as "baker's" or "brewer's" yeast. The dried form is used as a dietary supplement.Glycogen Synthase: An enzyme that catalyzes the transfer of D-glucose from UDPglucose into 1,4-alpha-D-glucosyl chains. EC 2.4.1.11.Inventions: A novel composition, device, or process, independently conceived de novo or derived from a pre-existing model.1,4-alpha-Glucan Branching Enzyme: In glycogen or amylopectin synthesis, the enzyme that catalyzes the transfer of a segment of a 1,4-alpha-glucan chain to a primary hydroxy group in a similar glucan chain. EC 2.4.1.18.Glucosyltransferases: Enzymes that catalyze the transfer of glucose from a nucleoside diphosphate glucose to an acceptor molecule which is frequently another carbohydrate. EC 2.4.1.-.Glycogen-Synthase-D Phosphatase: An enzyme that catalyzes the conversion of phosphorylated, inactive glycogen synthase D to active dephosphoglycogen synthase I. EC 3.1.3.42.Polymerase Chain Reaction: In vitro method for producing large amounts of specific DNA or RNA fragments of defined length and sequence from small amounts of short oligonucleotide flanking sequences (primers). The essential steps include thermal denaturation of the double-stranded target molecules, annealing of the primers to their complementary sequences, and extension of the annealed primers by enzymatic synthesis with DNA polymerase. The reaction is efficient, specific, and extremely sensitive. Uses for the reaction include disease diagnosis, detection of difficult-to-isolate pathogens, mutation analysis, genetic testing, DNA sequencing, and analyzing evolutionary relationships.Microfluidics: The study of fluid channels and chambers of tiny dimensions of tens to hundreds of micrometers and volumes of nanoliters or picoliters. This is of interest in biological MICROCIRCULATION and used in MICROCHEMISTRY and INVESTIGATIVE TECHNIQUES.DNA Primers: Short sequences (generally about 10 base pairs) of DNA that are complementary to sequences of messenger RNA and allow reverse transcriptases to start copying the adjacent sequences of mRNA. Primers are used extensively in genetic and molecular biology techniques.Microfluidic Analytical Techniques: Methods utilizing the principles of MICROFLUIDICS for sample handling, reagent mixing, and separation and detection of specific components in fluids.Prenatal Diagnosis: Determination of the nature of a pathological condition or disease in the postimplantation EMBRYO; FETUS; or pregnant female before birth.Sensitivity and Specificity: Binary classification measures to assess test results. Sensitivity or recall rate is the proportion of true positives. Specificity is the probability of correctly determining the absence of a condition. (From Last, Dictionary of Epidemiology, 2d ed)Arylamine N-Acetyltransferase: An enzyme that catalyzes the transfer of acetyl groups from ACETYL-COA to arylamines. It can also catalyze acetyl transfer between arylamines without COENZYME A and has a wide specificity for aromatic amines, including SEROTONIN. However, arylamine N-acetyltransferase should not be confused with the enzyme ARYLALKYLAMINE N-ACETYLTRANSFERASE which is also referred to as SEROTONIN ACETYLTRANSFERASE.Real-Time Polymerase Chain Reaction: Methods used for detecting the amplified DNA products from the polymerase chain reaction as they accumulate instead of at the end of the reaction.Reproducibility of Results: The statistical reproducibility of measurements (often in a clinical context), including the testing of instrumentation or techniques to obtain reproducible results. The concept includes reproducibility of physiological measurements, which may be used to develop rules to assess probability or prognosis, or response to a stimulus; reproducibility of occurrence of a condition; and reproducibility of experimental results.Reagent Kits, Diagnostic: Commercially prepared reagent sets, with accessory devices, containing all of the major components and literature necessary to perform one or more designated diagnostic tests or procedures. They may be for laboratory or personal use.Metabolic Detoxication, Drug: Reduction of pharmacologic activity or toxicity of a drug or other foreign substance by a living system, usually by enzymatic action. It includes those metabolic transformations that make the substance more soluble for faster renal excretion.Periodicals as Topic: A publication issued at stated, more or less regular, intervals.Insecticide Resistance: The development by insects of resistance to insecticides.Access to Information: Individual's rights to obtain and use information collected or generated by others.Molecular Biology: A discipline concerned with studying biological phenomena in terms of the chemical and physical interactions of molecules.Journal Impact Factor: A quantitative measure of the frequency on average with which articles in a journal have been cited in a given period of time.Bibliometrics: The use of statistical methods in the analysis of a body of literature to reveal the historical development of subject fields and patterns of authorship, publication, and use. Formerly called statistical bibliography. (from The ALA Glossary of Library and Information Science, 1983)Publishing: "The business or profession of the commercial production and issuance of literature" (Webster's 3d). It includes the publisher, publication processes, editing and editors. Production may be by conventional printing methods or by electronic publishing.Peer Review, Research: The evaluation by experts of the quality and pertinence of research or research proposals of other experts in the same field. Peer review is used by editors in deciding which submissions warrant publication, by granting agencies to determine which proposals should be funded, and by academic institutions in tenure decisions.Food: Any substances taken in by the body that provide nourishment.HLA-D Antigens: Human immune-response or Class II antigens found mainly, but not exclusively, on B-lymphocytes and produced from genes of the HLA-D locus. They are extremely polymorphic families of glycopeptides, each consisting of two chains, alpha and beta. This group of antigens includes the -DR, -DQ and -DP designations, of which HLA-DR is most studied; some of these glycoproteins are associated with certain diseases, possibly of immune etiology.Enzyme-Linked Immunosorbent Assay: An immunoassay utilizing an antibody labeled with an enzyme marker such as horseradish peroxidase. While either the enzyme or the antibody is bound to an immunosorbent substrate, they both retain their biologic activity; the change in enzyme activity as a result of the enzyme-antibody-antigen reaction is proportional to the concentration of the antigen and can be measured spectrophotometrically or with the naked eye. Many variations of the method have been developed.Reindeer: A genus of deer, Rangifer, that inhabits the northern parts of Europe, Asia, and America. Caribou is the North American name; reindeer, the European. They are often domesticated and used, especially in Lapland, for drawing sleds and as a source of food. Rangifer is the only genus of the deer family in which both sexes are antlered. Most caribou inhabit arctic tundra and surrounding arboreal coniferous forests and most have seasonal shifts in migration. They are hunted extensively for their meat, skin, antlers, and other parts. (From Webster, 3d ed; Walker's Mammals of the World, 5th ed, p1397)Alphaherpesvirinae: A subfamily of HERPESVIRIDAE characterized by a short replication cycle. The genera include: SIMPLEXVIRUS; VARICELLOVIRUS; MAREK'S DISEASE-LIKE VIRUSES; and ILTOVIRUS.Seroepidemiologic Studies: EPIDEMIOLOGIC STUDIES based on the detection through serological testing of characteristic change in the serum level of specific ANTIBODIES. Latent subclinical infections and carrier states can thus be detected in addition to clinically overt cases.Antibodies, Viral: Immunoglobulins produced in response to VIRAL ANTIGENS.Biological Markers: Measurable and quantifiable biological parameters (e.g., specific enzyme concentration, specific hormone concentration, specific gene phenotype distribution in a population, presence of biological substances) which serve as indices for health- and physiology-related assessments, such as disease risk, psychiatric disorders, environmental exposure and its effects, disease diagnosis, metabolic processes, substance abuse, pregnancy, cell line development, epidemiologic studies, etc.Immunoglobulin M: A class of immunoglobulin bearing mu chains (IMMUNOGLOBULIN MU-CHAINS). IgM can fix COMPLEMENT. The name comes from its high molecular weight and originally being called a macroglobulin.HLA-A2 Antigen: A specific HLA-A surface antigen subtype. Members of this subtype contain alpha chains that are encoded by the HLA-A*02 allele family.Period Circadian Proteins: Circadian rhythm signaling proteins that influence circadian clock by interacting with other circadian regulatory proteins and transporting them into the CELL NUCLEUS.Cryptochromes: Flavoproteins that function as circadian rhythm signaling proteins in ANIMALS and as blue-light photoreceptors in PLANTS. They are structurally-related to DNA PHOTOLYASES and it is believed that both classes of proteins may have originated from an earlier protein that played a role in protecting primitive organisms from the cyclical exposure to UV LIGHT.Interferon Inducers: Agents that promote the production and release of interferons. They include mitogens, lipopolysaccharides, and the synthetic polymers Poly A-U and Poly I-C. Viruses, bacteria, and protozoa have been also known to induce interferons.FlavoproteinsMaus Elberfeld virus: A strain of ENCEPHALOMYOCARDITIS VIRUS, a species of CARDIOVIRUS, usually causing an inapparent intestinal infection in mice. A small number of mice may show signs of flaccid paralysis.Adaptor Proteins, Signal Transducing: A broad category of carrier proteins that play a role in SIGNAL TRANSDUCTION. They generally contain several modular domains, each of which having its own binding activity, and act by forming complexes with other intracellular-signaling molecules. Signal-transducing adaptor proteins lack enzyme activity, however their activity can be modulated by other signal-transducing enzymesPhotoreceptor Cells, Invertebrate: Specialized cells in the invertebrates that detect and transduce light. They are predominantly rhabdomeric with an array of photosensitive microvilli. Illumination depolarizes invertebrate photoreceptors by stimulating Na+ influx across the plasma membrane.HLA-A Antigens: Polymorphic class I human histocompatibility (HLA) surface antigens present on almost all nucleated cells. At least 20 antigens have been identified which are encoded by the A locus of multiple alleles on chromosome 6. They serve as targets for T-cell cytolytic responses and are involved with acceptance or rejection of tissue/organ grafts.

A new yeast metabolon involving at least the two first enzymes of arginine biosynthesis: acetylglutamate synthase activity requires complex formation with acetylglutamate kinase. (1/65)

Open reading frame YJL071W of Saccharomyces cerevisiae was shown to be ARG2 and identified as the structural gene for acetylglutamate synthase, first step in arginine biosynthesis. The three Ascomycete acetylglutamate synthases characterized to date appear homologous, but unlike the other enzymes of the yeast arginine biosynthesis pathway, they showed no significant similarity to their prokaryotic equivalents. The measured synthase activity did not increase with the number of ARG2 gene copies unless the number of ARG5,6 gene copies was increased similarly. ARG5,6 encodes a precursor that is maturated in the mitochondria into acetylglutamate kinase and acetylglutamyl-phosphate reductase, catalyzing the second and third steps in the pathway. The results imply that the synthase must interact stoichiometrically in vivo with the kinase, the reductase, or both to be active. Results obtained with synthetic ARG5 and ARG6 genes suggested that both the kinase and the reductase could be needed. This situation, which has completely escaped notice in yeast until now, is reminiscent of the observation in Neurospora crassa that nonsense arg-6 kinase/reductase mutants lack synthase activity (Hinde, R. W., Jacobson, J. A., Weiss, R. L., and Davis, R. H. (1986) J. Biol. Chem. 261, 5848-5852). In immunoprecipitation experiments, hemagglutinin-tagged synthase coprecipitated with a protein proven by microsequencing to be the kinase. Western blot analyses showed that the synthase has reduced stability in the absence of the kinase/reductase. Our data demonstrate the existence of a new yeast arginine metabolon involving at least the first two, and possibly the first three, enzymes of the pathway. Hypotheses regarding the biological significance of this interaction are discussed.  (+info)

Identification, cloning and expression of the mouse N-acetylglutamate synthase gene. (2/65)

In ureotelic animals, N-acetylglutamate (NAG) is an essential allosteric activator of carbamylphosphate synthetase I (CPSI), the first enzyme in the urea cycle. NAG synthase (NAGS; EC 2.3.1.1) catalyses the formation of NAG from glutamate and acetyl-CoA in liver and intestinal mitochondria. This enzyme is supposed to regulate ureagenesis by producing variable amounts of NAG, thus modulating CPSI activity. Moreover, inherited deficiencies in NAGS have been associated with hyperammonaemia, probably due to the loss of CPSI activity. Although the existence of the NAGS protein in mammals has been known for decades, the gene has remained elusive. We identified the mouse (Mus musculus) and human NAGS genes using their similarity to the respective Neurospora crassa gene. NAGS was cloned from a mouse liver cDNA library and was found to encode a 2.3 kb message, highly expressed in liver and small intestine with lower expression levels in kidney, spleen and testis. The deduced amino acid sequence contains a putative mitochondrial targeting signal at the N-terminus. The cDNA sequence complements an argA (NAGS)-deficient Escherichia coli strain, reversing its arginine auxotrophy. His-tagged versions of the pre-protein and two putative mature proteins were each overexpressed in E. coli, and purified to apparent homogeneity by using a nickel-affinity column. The pre-protein and the two putative mature proteins catalysed the NAGS reaction but one of the putative mature enzymes had significantly higher activity than the pre-protein. The addition of l-arginine increased the catalytic activity of the purified recombinant NAGS enzymes by approx. 2-6-fold.  (+info)

The N-acetylglutamate synthase/N-acetylglutamate kinase metabolon of Saccharomyces cerevisiae allows co-ordinated feedback regulation of the first two steps in arginine biosynthesis. (3/65)

In Saccharomyces cerevisiae, which uses the nonlinear pathway of arginine biosynthesis, the first two enzymes, N-acetylglutamate synthase (NAGS) and N-acetylglutamate kinase (NAGK), are controlled by feedback inhibition. We have previously shown that NAGS and NAGK associate in a complex, essential to synthase activity and protein level [Abadjieva, A., Pauwels, K., Hilven, P. & Crabeel, M. (2001) J. Biol. Chem.276, 42869-42880]. The NAGKs of ascomycetes possess, in addition to the catalytic domain that is shared by all other NAGKs and whose structure has been determined, a C-terminal domain of unknown function and structure. Exploring the role of these two domains in the synthase/kinase interaction, we demonstrate that the ascomycete-specific domain is required to maintain synthase activity and protein level. Previous results had suggested a participation of the third enzyme of the pathway, N-acetylglutamylphosphate reductase, in the metabolon. Here, genetic analyses conducted in yeast at physiological level, or in a heterologous background, clearly demonstrate that the reductase is dispensable for synthase activity and protein level. Most importantly, we show that the arginine feedback regulation of the NAGS and NAGK enzymes is mutually interdependent. First, the kinase becomes less sensitive to arginine feedback inhibition in the absence of the synthase. Second, and as in Neurospora crassa, in a yeast kinase mutant resistant to arginine feedback inhibition, the synthase becomes feedback resistant concomitantly. We conclude that the NAGS/NAGK metabolon promotes the co-ordination of the catalytic activities and feedback regulation of the first two, flux controlling, enzymes of the arginine pathway.  (+info)

Mammalian N-acetylglutamate synthase. (4/65)

N-Acetylglutamate synthase (NAGS, E.C. 2.3.1.1) is a mitochondrial enzyme that catalyzes the formation of N-acetylglutamate (NAG), an essential allosteric activator of carbamylphosphate synthetase I (CPSI). The mouse and human NAGS genes have been identified based on similarity to regions of NAGS from Neurospora crassa and cloned from liver cDNA libraries. These genes were shown to complement an argA- (NAGS) deficient Escherichia coli strain, and enzymatic activity of the proteins was confirmed by a new stable isotope dilution assay. The deduced amino acid sequence of mammalian NAGS contains a putative mitochondrial-targeting signal at the N-terminus. The mouse NAGS preprotein was overexpressed in insect cells to determine post-translational modifications and two processed proteins with different N-terminal truncations have been identified. Sequence analysis using a hidden Markov model suggests that the vertebrate NAGS protein contains domains with a carbamate kinase fold and an acyl-CoA N-acyltransferase fold, and protein crystallization experiments are currently underway. Inherited NAGS deficiency results in hyperammonemia, presumably due to the loss of CPSI activity. We, and others, have recently identified mutations in families with neonatal and late-onset NAGS deficiency and the identification of the gene has now made carrier testing and prenatal diagnosis feasible. A structural analog of NAG, carbamylglutamate, has been shown to bind and activate CPSI, and several patients have been reported to respond favorably to this drug (Carbaglu).  (+info)

Functional characterization of a novel ArgA from Mycobacterium tuberculosis. (5/65)

The Mycobacterium tuberculosis gene Rv2747 encodes a novel 19-kDa ArgA that catalyzes the initial step in L-arginine biosynthesis, namely the conversion of L-glutamate to alpha-N-acetyl-L-glutamate. Initial velocity studies reveal that Rv2747 proceeds through a sequential kinetic mechanism, with K(m) values of 280 mM for L-glutamine and 150 microM for acetyl-coenzyme A and with a k(cat) value of 200 min(-1). Initial velocity studies with L-glutamate showed that even at concentrations of 600 mM, saturation was not observed. Therefore, only a k(cat)/K(m) value of 125 M(-1) min(-1) can be calculated. Inhibition studies reveal that the enzyme is strongly regulated by L-arginine, the end product of the pathway (50% inhibitory concentration, 26 microM). The enzyme was completely inhibited by 500 microM arginine, with a Hill coefficient of 0.60, indicating negatively cooperative binding of L-arginine.  (+info)

Identification of novel mutations of the human N-acetylglutamate synthase gene and their functional investigation by expression studies. (6/65)

The mitochondrial enzyme N-acetylglutamate synthase (NAGS) produces N-acetylglutamate serving as an allosteric activator of carbamylphosphate synthetase 1, the first enzyme of the urea cycle. Autosomal recessively inherited NAGS deficiency (NAGSD) leads to severe neonatal or late-onset hyperammonemia. To date few patients have been described and the gene involved was described only recently. In this study, another three families affected by NAGSD were analyzed for NAGS gene mutations resulting in the identification of three novel missense mutations (C200R [c.598T > C], S410P [c.1228T > C], A518T [c.1552G > A]). In order to investigate the effects of these three and two additional previously published missense mutations on enzyme activity, the mutated proteins were overexpressed in a bacterial expression system using the NAGS deficient E. coli strain NK5992. All mutated proteins showed a severe decrease in enzyme activity providing evidence for the disease-causing nature of the mutations. In addition, we expressed the full-length NAGS wild type protein including the mitochondrial leading sequence, the mature protein as well as a highly conserved core protein. NAGS activity was detected in all three recombinant proteins but varied regarding activity levels and response to stimulation by l-arginine. In conclusion, overexpression of wild type and mutated NAGS proteins in E. coli provides a suitable tool for functional analysis of NAGS deficiency.  (+info)

Translocation of a long amino-terminal domain through ER membrane by following signal-anchor sequence. (7/65)

Type I signal-anchor sequences mediate translocation of the N-terminal domain (N-domain) across the endoplasmic reticulum (ER) membrane. To examine the translocation in detail, dihydrofolate reductase (DHFR) was fused to the N-terminus of synaptotagmin II as a long N-domain. Translocation was arrested by the DHFR ligand methotrexate, which stabilizes the folding of the DHFR domain, and resumed after depletion of methotrexate. The targeting of the ribosome-nascent chain complex to the ER requires GTP, whereas N-domain translocation does not require any nucleotide triphosphates. Significant translocation was observed even in the absence of a lumenal hsp70 (BiP). When the nascent polypeptide was released from the ribosomes after the membrane targeting, the N-domain translocation was suppressed and the nascent chain was released from the translocon. Ribosomes have a crucial role in maintaining the translocation-intermediate state. The translocation of the DHFR domain was greatly impaired when it was separated from the signal-anchor sequence. Unfolding and translocation of the DHFR domain must be driven by the stroke of the signal-anchor sequence into translocon.  (+info)

Involvement of LuxR, a quorum sensing regulator in Vibrio harveyi, in the promotion of metabolic genes: argA, purM, lysE and rluA. (8/65)

Quorum sensing, involving signal transduction via the two-component response regulator LuxO to its downstream target LuxR, controls luminescence in the marine bacterium Vibrio harveyi. LuxR is a DNA binding protein that acts as both activator of the lux operon and repressor of its own gene. In order to determine if any other genes are affected by quorum sensing in V. harveyi, an assay for luxR-dependent promotion was devised using a genomic library maintained in a novel luxAB (luciferase) reporter. Screening in Escherichia coli DH-21 (lacI(sq)) entailed the addition of a second plasmid containing luxR under plac control. Four out of 5000 colonies showed luminescence stimulation upon IPTG induction of luxR. The four luxR-dependent promoters were upstream of argA, purM, lysE, and rluA, genes involved in arginine and purine biosyntheses, amino acid efflux, and pseudouridine synthesis, respectively. Based on analysis of luxR-dependent promoters, particularly that of argA, we describe a LuxR binding site, and implicate the coordination of LuxR with ArgR.  (+info)

*D-amino-acid N-acetyltransferase

... Other names in common use include D-amino acid acetyltransferase, and D-amino acid-alpha-N- ... a D-amino-acid N-acetyltransferase (EC 2.3.1.36) is an enzyme that catalyzes the chemical reaction acetyl-CoA + a D-amino acid ... an N-acetyl-D-amino acid Thus, the two substrates of this enzyme are acetyl-CoA and D-amino acid, whereas its two products are ... CoA and N-acetyl-D-amino acid. This enzyme belongs to the family of transferases, specifically those acyltransferases ...

*Choline acetyltransferase

"Conservation of amino acid sequences between human and porcine choline acetyltransferase". J. Neurochem. 51 (6): 1843-5. doi: ... Therefore, the amino acid sequence is very similar, however pChAT is missing parts of the sequence present in cChAT. The pChAT ... In humans, the choline acetyltransferase enzyme is encoded by the CHAT gene. Choline acetyltransferase was first described by ... Choline Acetyltransferase at the US National Library of Medicine Medical Subject Headings (MeSH) Molecular and Cellular Biology ...

*AGAS

Romania Antiglobalization activists in Syria Amino-acid N-acetyltransferase, an enzyme Neoabietadiene synthase, an enzyme Ralph ...

*Epigenomics

An example of the first mechanism occurs during the acetylation of lysine terminal tail amino acids, which is catalyzed by ... histone acetyltransferases (HATs). HATs are part of a multiprotein complex that is recruited to chromatin when activators bind ... phosphorylation and ubiquitination can be associated with different transcriptional states depending on the specific amino acid ... Nucleic Acids Research. 28 (8): E32. doi:10.1093/nar/28.8.e32. PMC 102836 . PMID 10734209. Russell 2010, pp. 552-3. van der ...

*Galactoside O-acetyltransferase

Its monomer consists of 202 amino acid residues. The protein has a molecular weight of 22,671. The amino terminus of the ... "The amino acid sequence of thiogalactoside transacetylase of Escherichia coli". Biochimie. 67 (1): 101-8. 1985. doi:10.1016/ ... Galactoside O-acetyltransferase (also known as thiogalactoside transacetylase) is an enzyme encoded by the lacA gene in E. coli ...

*Serine O-acetyltransferase

The amino-terminal alpha-helical domain particularly the amino acid residues His158 (histidine in position 158) and Asp143 ( ... This particular enzyme catalyses serine into cysteine which is eventually converted to the essential amino acid methionine. Of ... These transgenic plants would contain more essential sulphur amino acids meaning a healthier diet for humans and animals. ... Other names in common use include SATase, L-serine acetyltransferase, serine acetyltransferase, and serine transacetylase. This ...

*List of MeSH codes (D08)

... acetyl-CoA C-acetyltransferase MeSH D08.811.913.050.134.105 --- amino-acid n-acetyltransferase MeSH D08.811.913.050.134.150 ... amino acid oxidoreductases MeSH D08.811.682.664.500.062 --- alanine dehydrogenase MeSH D08.811.682.664.500.125 --- d-amino-acid ... l-amino acid oxidase MeSH D08.811.682.664.500.724 --- leucine dehydrogenase MeSH D08.811.682.664.500.772 --- nitric oxide ... aromatic-L-amino-acid decarboxylase MeSH D08.811.520.224.125.100.500 --- dopa decarboxylase MeSH D08.811.520.224.125.250 --- ...

*List of EC numbers (EC 2)

D-tryptophan N-acetyltransferase EC 2.3.1.35: glutamate N-acetyltransferase EC 2.3.1.36: D-amino-acid N-acetyltransferase EC ... amino-acid N-acetyltransferase EC 2.3.1.2: imidazole N-acetyltransferase EC 2.3.1.3: glucosamine N-acetyltransferase EC 2.3.1.4 ... bile acid-CoA:amino acid N-acyltransferase EC 2.3.1.66: leucine N-acetyltransferase EC 2.3.1.67: 1-alkylglycerophosphocholine O ... UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine N-acetyltransferase EC 2.3.1.203: UDP-4-amino-4,6-dideoxy-N-acetyl-alpha-D- ...

*NatB acetyltransferase

The subclasses of proteins with abundances of the amino acids aspartic acid, methionine specifically are acetylated.. ... NatB acetyltransferase is an enzyme in the Saccharomyces cerevisiae that functions to catalyze the dehydration synthesis of the ...

*Peptide alpha-N-acetyltransferase

... peptide acetyltransferase, protein N-terminal acetyltransferase, NAT, Nalpha-acetyltransferase, amino-terminal amino acid- ... Tsunasawa S, Kamitani K, Narita K (February 1980). "Partial purification and properties of the amino-terminal amino acid- ... In enzymology, a peptide alpha-N-acetyltransferase (EC 2.3.1.88) is an enzyme that catalyzes the chemical reaction acetyl-CoA ... The systematic name of this enzyme class is acetyl-CoA:peptide Nalpha-acetyltransferase. Other names in common use include beta ...

*Carnitine O-acetyltransferase

This occurs despite the fact that only 4% of the amino acids that comprise those peptide backbones corresponds to one another. ... Carnitine O-acetyltransferase also called carnitine acetyltransferase (CRAT, or CAT) (EC 2.3.1.7) is an enzyme that encoded by ... with the δ1 ring nitrogen hydrogen bonded to the carbonyl oxygen on the amino acid backbone. Due to the fact that CRAT binds ... "Crystal structure of carnitine acetyltransferase and implications for the catalytic mechanism and fatty acid transport". Cell. ...

*Botrydial

... and a BcBOT5 gene whose amino acid sequence showed high homology to known acetyl transferases. This brought Pinedo et al. to ... Additionally, aggressive strains of the fungus secrets polyketides such as botcinic acid that exhibit phytotoxic and antifungal ...

*Aralkylamine N-acetyltransferase

Arylkylamine N-acetyltransferase is a monomeric polypeptide with a length of 207 amino acid residues, and with a molecular ... Molecular modeling and structure-activity relationship studies made it possible to pinpoint the amino acid residue of the ... Peptide combinatorial libraries of tri-, tetra-, and pentapeptides with various amino acid compositions were screened as ... The N-acetyltransferase reaction has been suggested to be the rate-determining step, and thus Serotonin N-acetyltransferase has ...

*Histone acetyltransferase

Histone acetyltransferases (HATs) are enzymes that acetylate conserved lysine amino acids on histone proteins by transferring ... Some HAT transcriptional co-activators contain a bromodomain, a 110-amino acid module that recognizes acetylated lysine ... RNA polymerase control by chromatin structure Acetyltransferase Lee KK, Workman JL (April 2007). "Histone acetyltransferase ... Moreover, a general acid or base have not yet been identified for this HAT. The structures of several HAT domains bound to ...

*Epigenetics in learning and memory

HATs are enzymes responsible for the acetylation of amino acids. HATs acetylate by converting the lysine side group of amino ... Swank, M. W.; Sweatt, J. D. (2001). "Increased Histone Acetyltransferase and Lysine Acetyltransferase Activity and Biphasic ... the amino acid that is modified, and the number of methyl groups added. In the case of lysine methylation, three types of ... "Spatial Memory Consolidation is Associated with Induction of Several Lysine-Acetyltransferase (Histone Acetyltransferase) ...

*FAM135B

The protein encoded on FAM135 is 1406 amino acids long. The protein contains a region called DUF676, believed to be a putative ... FAM135B has shown to interact with KAT5, a gene that encodes for a histone acetyltransferase through yeast two-hybrid ...

*Formate C-acetyltransferase

The active site of the enzyme, elucidated by x-ray crystallography, holds three essential amino acids that perform catalysis ( ... The systematic name of this enzyme class is acetyl-CoA:formate C-acetyltransferase. Other names in common use include pyruvate ... Plaga, W., Wielhaber, G., Wallach, J., Knappe, J. Modification of Cys-418 of pyruvate formate-lyase by methacrylic acid, based ... In enzymology, formate C-acetyltransferase (pyruvate formate lyase, PFL) (EC 2.3.1.54) is an enzyme. Pyruvate formate lyase is ...

*Coiled-coil domain-containing 37 (FLJ40083)

This protein in 611 amino acids in length and has a molecular weight of 71.1 kilodaltons and an isoelectric point of pI=6.7. ... It also contains a possible substrate of N-acetyltransferase A at Ser2. CCDC37 has a predicted nuclear localization via ... CCDC37 contains a DUF4200 region located from amino acid 151 to 269. There is no known frunction for DUF4200. CCDC37 also ... It contains four possible PEST sequence at amino acids 17-36, 293-304, 337-360, and 360-395. ...

*TAF7l

... amino acids 1170-1226 of TAF1) that TAF7 binds to and inactivates TAF1's acetyltransferase (AT) function. Thus, it is likely ...

*Protein O-GlcNAcase

200 amino acids in OGA have homology with some proteins such as hyaluronidase, a putative acetyltransferase, eukaryotic ...

*Acetylation

Each of these different enzyme complexes is specific for different amino acids or amino acid sequences which is shown in the ... A tubulin acetyltransferase is located in the axoneme, and acetylates the α-tubulin subunit in an assembled microtubule. Once ... to the α-amino group of the first amino acid residue of the protein. Different NATs are responsible for the acetylation of ... These amino acids are more frequently expressed in the N-terminal of proteins in eukaryotes, so NatA is the major NAT ...

*Histone H2B

... is a lightweight structural protein made of 126 amino acids. Many of these amino acids have a positive charge at ... Acetylation relies on specific histone acetyltransferases that work at gene promoters during transcriptional activation. Adding ... All variants of histone H2B contain the same number of amino acids, and the variations in sequence are few in number. Only two ... Histone H2B's amino acid sequence is highly evolutionarily conserved. Even distantly related species have extremely similar ...

*CSRP3

Cysteine and glycine-rich protein 3 gene codes for the Muscle LIM Protein (MLP) or CSRP3, a small 194 amino acid protein, which ... by acetyltransferase (PCAF) and histone deacetylase 4 (HDAC4), respectively. In myocytes, MLP has the ability to oligomerize, ... Furthermore, MLP carries a nuclear localization signal at amino acid positions 64-69 MLP can be acetylated/deacetylated at the ...

*Histone acetylation and deacetylation

Lysine is an amino acid with a positive charge when unmodified. Lysines on the amino terminal tails of histones have a tendency ... Histone Acetyltransferases, also known as HATs, are a family of enzymes that acetylate the histone tails of the nucleosome. ... The mechanism for acetylation and deacetylation takes place on the NH3+ groups of Lysine amino acid residues. These residues ... Chemical modifications of histone proteins often occur on particular amino acids. This specific addition of single or multiple ...

*Huntington's disease

Furthermore, the amino acids that form CBP include a strip of 18 glutamines. Thus, the glutamines on CBP interact directly with ... Specifically, CBP contains an acetyltransferase domain to which HTT binds through its polyglutamine-containing domain. ... CAG is the 3-letter genetic code (codon) for the amino acid glutamine, so a series of them results in the production of a chain ... and myoclonic hyperkinesia can be treated with valproic acid. Psychiatric symptoms can be treated with medications similar to ...

*Susan K. Gilmour

Amino Acids. 2014 Mar;46(3):543-52. Epub 2013 Jul 25. http://www.limr.org/doc/Page.asp?PageID=DOC004139 http://www. ... Hobbs, CA; Gilmour, SK (2000). "High levels of intracellular polyamines promote histone acetyltransferase activity resulting in ... Hobbs, CA; Paul, BA; Gilmour, SK (2002). "Deregulation of polyamine biosynthesis alters intrinsic histone acetyltransferase and ...
Novel bifunctional N-acetylglutamate synthase/kinases (NAGS/K) that catalyze the first two steps of arginine biosynthesis and are homologous to vertebrate N-acetylglutamate synthase (NAGS), an essential cofactor-producing enzyme in the urea cycle, were identified in Maricaulis maris and several other bacteria. Arginine is an allosteric inhibitor of NAGS but not NAGK activity. The crystal structure of M. maris NAGS/K (mmNAGS/K) at 2.7 Å resolution indicates that it is a tetramer, in contrast to the hexameric structure of Neisseria gonorrhoeae NAGS. The quaternary structure of crystalline NAGS/K from Xanthomonas campestris (xcNAGS/K) is similar, and cross-linking experiments indicate that both mmNAGS/K and xcNAGS are tetramers in solution. Each subunit has an amino acid kinase (AAK) domain, which is likely responsible for N-acetylglutamate kinase (NAGK) activity and has a putative arginine binding site, and an N-acetyltransferase (NAT) domain that contains the putative NAGS active site. These structures
We examined the distribution of NAGS and NAGK across the three domains of life. Although NAGK is found in archaea, eubacteria and eukaryotes, such as plants, algae and fungi, initially, we were only able to find sequences similar to either E. coli or mammalian NAGS in beta-proteobacteria, gamma-proteobacteria and three species of alpha-proteobacteria [48-50]. The three alpha-proteobacteria, M. maris, O. alexandrii and P. bermudensis, also appear to harbor acetylornithine transcarbamylase (argF) genes suggesting that their arginine biosynthesis pathway is similar to the one in X. campestris [7]. Identification of the alpha-proteobacterial NAGS genes that are closely related to the corresponding vertebrate, fungal and algal genes and to fungal NAGK is intriguing because mitochondria are thought to have arisen by endosymbiosis between proto-eukaryotic cell and an alpha-proteobacteria. Current thought suggests that the alpha-proteobacteria of the order Rickettsiales are the extant relatives of the ...
3B8G: The crystal structure of N-acetyl-L-glutamate synthase from Neisseria gonorrhoeae provides insights into mechanisms of catalysis and regulation.
In the linear pathway (Figure 1A), GLU is converted to acetylglutamate (Ac-GLU) by N-acetylglutamate synthase (NAGS, encoded by argA) which is inhibited by ARG through negative feedback regulation [36],[39]. Sequential catalytic reactions catalyzed by the next three enzymes, N-acetylglutamate kinase (NAGK, encoded by argB), N-acetylglutamate semialdehyde dehydrogenase (encoded by argC) and N-acetylornithine transaminase (encoded by argD), which are common in the three pathways (Figure 1), yield N-acetylornithine (Ac-ORN) [34]. The next step, which distinguishes the linear pathway from the other two pathways, is deacetylation of Ac-ORN by AOase to yield ORN [40],[41]. The next and final steps are carried out by ornithine carbamoyltransferase (OTC or OTCase, encoded by argF), argininosuccinate synthase (encoded by argG) and argininosuccinate lyase (encoded by argH), which finally yield ARG [35]. This pathway has been found in a few species such as Myxococcus xanthus [41] and E. coli [36].. In many ...
Neurology news, research and treatment studies for epilepsy, neurodegenerative disorders, patients with MS and other brain and central nervous system disorders and diseases.
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
Jag såg en bok hos en kompis som handlade om arga lappar, och den var faktiskt riktigt rolig. På framsidan var det ett foto på en lapp som någon hade satt inne i någon tvättstuga där det stod "den som inte tar bort luddet ska dö!" Jättekul, snacka om att folk kan bli arga för triviala saker. Hela boken var en samling av fotografier på lappar som folk hade skickat in till den här författaren, och så samlade han ihop dem i den här boken. Jag skriver lappar eller meddelanden ibland, men inte så arga som dessa.. Posted by inomecoiniuro on Oct. 28, 2015, 9:02 p.m. ...
Faragó, A. and Dénes, G. (1967). „Mechanism of arginine biosynthesis in Chlamydomonas reinhardti. II. Purification and properties of N-acetylglutamate 5-phosphotransferase, the allosteric enzyme of the pathway". Biochim. Biophys. Acta. 136: 6-18. PMID 6040410 ...
Quaternary structure and interface interactions of ngNAGS and mmNAGS/K. Simplified model of the hexamer architecture of ngNAGS (A) and the tetrameric architectu
食品、飲料與營養保健品 (AAK AB) | 食品、飲料與營養保健品一站式進行配方,數據表,物質安全數據表搜索,產品特性和樣品申請 -- 免費使用
A reactor at Dominion Virginia Powers nuclear power plant remains inactive two days after it was automatically shut down due to the failure of an electrical power supply on Tuesday morning. The
1OHA: The Course of Phosphorus in the Reaction of N-Acetyl-L-Glutamate Kinase, Determined from the Structures of Crystalline Complexes, Including a Complex with an Alf(4)(-) Transition State Mimic
Metabolon, Inc., a world leader in metabolomics-based diagnostic tests and research services, announced today that it has raised $15 million in a Seri
A free platform for explaining your research in plain language, and managing how you communicate around it - so you can understand how best to increase its impact.
AAK1 - Aak1 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector shRNA available for purchase from OriGene - Your Gene Company.
Hyperammonemia, which can cause brain damage, occurs in many different kinds of inborn errors of metabolism. The investigators propose to determine if short-term (3 day) treatment with N-carbamylglutamate can diminish hyperammonemia by enhancing ureagenesis in these patients. The investigators propose here a short-term (3 day) trial. If it succeeds, the investigators would consider more extensive long-term studies of the drug ...
Hyperammonemia, which can cause brain damage, occurs in many different kinds of inborn errors of metabolism. The investigators propose to determine if short-term (3 day) treatment with N-carbamylglutamate can diminish hyperammonemia by enhancing ureagenesis in these patients. The investigators propose here a short-term (3 day) trial. If it succeeds, the investigators would consider more extensive long-term studies of the drug ...
RESEARCH TRIANGLE PARK, N.C., Jan. 26, 2017-- Metabolon, Inc., the global leader in metabolomics, announced changes today to its executive team. Prior to joining Metabolon, he was the Managing Director of Klaipeda Health, a healthcare and life sciences advisory company. He has held a variety of commercial, medical, scientific, informatics and technology leadership...
We post blogs on all things metabolomics - from the latest publications to precision medicine. Visit the page to view recent posts from Metabolon.
We post blogs on all things metabolomics - from the latest publications to precision medicine. Visit the page to view recent posts from Metabolon.
US Patent 8,131,473. Data analysis methods for locating entities of interest within large, multivariable datasets. Inventors: Marie Coffin, Keith Allen, Brian Bullard, Alan Higgins. Assignee: Metabolon
Glutamate 5-kinase (G5K) makes the highly unstable product glutamyl 5-phosphate (G5P) in the initial, controlling step of proline/ornithine synthesis, being feedback-inhibited by proline or ornithine, and causing, when defective, clinical hyperammonaemia. We determined two crystal structures of G5K from Escherichia coli, at 2.9 A and 2.5 A resolution, complexed with glutamate and sulphate, or with G5P, sulphate and the proline analogue 5-oxoproline. E. coli G5K presents a novel tetrameric (dimer of dimers) architecture. Each subunit contains a 257 residue AAK domain, typical of acylphosphate-forming enzymes, with characteristic alpha(3)beta(8)alpha(4) sandwich topology. This domain is responsible for catalysis and proline inhibition, and has a crater on the beta sheet C-edge that hosts the active centre and bound 5-oxoproline. Each subunit contains a 93 residue C-terminal PUA domain, typical of RNA-modifying enzymes, which presents the characteristic beta(5)beta(4) sandwich fold and three alpha ...
Technology Networks is an internationally recognised publisher that provides access to the latest scientific news, products, research, videos and posters.
This is the list of the students who participate in this workshop Group 1 Nadhira Rizki Suci Harlen Olivia Mayer Group 2 Lana Syahbani Dara Azilya Satria Perdana Group 3 Tristia Risnawati Yosie Sesbania Gewap Yolanda Niagara Group 4 Puji Maharani Hera Khaerani Naluri Bella Wati Group 5 Aldo Fenalosa Bayu Arga Ramadhan Mardika Agung…
function nag_correg_robustm_corr_user_example indm = int64(1); x = [3.4, 6.9, 12.2; 6.4, 2.5, 15.1; 4.9, 5.5, 14.2; 7.3, 1.9, 18.2; 8.8, 3.6, 11.7; 8.4, 1.3, 17.9; 5.3, 3.1, 15; 2.7, 8.1, 7.7; 6.1, 3, 21.9; 5.3, 2.2, 13.9]; a = [1; 0; 1; 0; 0; 1]; theta = [0; 0; 0]; user = [4, 2]; [user, covar, aOut, wt, thetaOut, nit, ifail] = ... nag_correg_robustm_corr_user(@ucv, indm, x, a, theta, user, user) function [userp, u, w] = ucv(t, userp) cu = userp(1); u = 1.0; if (t ~= 0) t2 = t*t; if (t2 , cu) u = cu/t2; end end % w function and derivative cw = userp(2); if (t , cw) w = cw/t; else w = 1.0; end ...
22ο Πανελλήνιο Ουρολογικό Συνέδριο 16-19 Οκτωβρίου 2014 Ξενοδοχείο Creta Maris, Χερσόνησος,Ηράκλειο Κρήτης ...
In molecular biology, the amino acid kinase domain is a protein domain. It is found in protein kinases with various specificities, including the aspartate, glutamate and uridylate kinase families. In prokaryotes and plants the synthesis of the essential amino acids lysine and threonine is predominantly regulated by feed-back inhibition of aspartate kinase (AK) and dihydrodipicolinate synthase (DHPS). In Escherichia coli, thrA, metLM, and lysC encode aspartokinase isozymes that show feedback inhibition by threonine, methionine, and lysine, respectively. The lysine-sensitive isoenzyme of aspartate kinase from spinach leaves has a subunit composition of 4 large and 4 small subunits. In plants although the control of carbon fixation and nitrogen assimilation has been studied in detail, relatively little is known about the regulation of carbon and nitrogen flow into amino acids. The metabolic regulation of expression of an Arabidopsis thaliana aspartate kinase/homoserine dehydrogenase (AK/HSD) gene, ...
Photosynthetic organisms can store nitrogen by synthesizing arginine, and, therefore, feedback inhibition of arginine synthesis must be relieved in these organisms when nitrogen is abundant. This relief is accomplished by the binding of the PII signal transduction protein to acetylglutamate kinase (NAGK), the controlling enzyme of arginine synthesis. Here, we describe the crystal structure of the complex between NAGK and PII of Synechococcus elongatus, at 2.75-Å resolution. We prove the physiological relevance of the observed interactions by site-directed mutagenesis and functional studies. The complex consists of two polar PII trimers sandwiching one ring-like hexameric NAGK (a trimer of dimers) with the threefold axes of these molecules aligned. The binding of PII favors a narrow ring conformation of the NAGK hexamer that is associated with arginine sites having low affinity for this inhibitor. Each PII subunit contacts one NAGK subunit only. The contacts map in the inner circumference of the ...
Thousand-and-one amino acid kinases (TAOK) 1 and 2 are activated catalytically during mitosis and can contribute to mitotic cell rounding and spindle positioning. Here, we characterize a compound that inhibits TAOK1 and TAOK2 activity with IC50 values of 11 to 15 nmol/L, is ATP-competitive, and targets these kinases selectively. TAOK inhibition or depletion in centrosome-amplified SKBR3 or BT549 breast cancer cell models increases the mitotic population, the percentages of mitotic cells displaying amplified centrosomes and multipolar spindles, induces cell death, and inhibits cell growth. In contrast, nontumorigenic and dividing bipolar MCF-10A breast cells appear less dependent on TAOK activity and can complete mitosis and proliferate in the presence of the TAOK inhibitor. We demonstrate that TAOK1 and TAOK2 localize to the cytoplasm and centrosomes respectively during mitosis. Live cell imaging shows that the TAOK inhibitor prolongs the duration of mitosis in SKBR3 cells, increases mitotic ...
Xu, Y. , Liang, Z. , Legrain, C. , Rüger, H. J. and Glansdorff, N. (2000): Evolution of arginine biosynthesis in the bacterial domain: Novel gene-enzyme relationships from psychrophilic Moritella strains (Vibrionaceae) and evolutionary significance of N-a-acetyl ornithinase , Journal of Bacteriology ...
ASS Cardio Spirig is a medicine available in a number of countries worldwide. A list of US medications equivalent to ASS Cardio Spirig is available on the Drugs.com website.
Majandusuudiste veeb. riuudised Eestist ja v lismaalt, uurivad artiklid, b rsiuudised, fotod, videod, kommentaarid, investeerimine.
Achetez à petit prix Pieds Zirconal Poudre Assèchante anti Transpirante Addax, 75 G dans la gamme Soin des pieds sur la Parapaharmacie MonCoinSanté
Figure 5 An approach to diagnosis of hyperammonemia in older children OA: organic acidurias, FAO: fatty acid oxidation defects, PC: pyruvate carboxylase deficiency, PDH: pyruvate dehydrogenase deficiency, ASA: argininosuccinic acid, AS: argininosuccinic aciduria, NAGS: N-acetylglutamate synthetase deficiency, CPS I: carbamoyl phosphate synthetase I deficiency, OTC: ornithine transcarbamoylase deficiency, HHH: hyperornithinemia hyperammonemia homocitrullinuria syndrome, LPI: lysinuric protein intolerance. (Click image to enlarge) ...
... DAVIS, Calif., July 14, 2003 - SoftIntegration, Inc. and the Numerical Algorithms Group (NAG) announce the release of Ch NAG Statistics Package version 1.0. Designed to meet the needs of a wide range of researchers seeking rapid statistical application development, the Ch NAG Statistics Package makes a set of the robust NAG statistical routines available to users of Ch, an embeddable C/C++ interpreter for cross-platform scripting, shell programming, 2D/3D plotting, numerical computing, and embedded scripting. Ch NAG Statistics Package makes the rigorously tested statistical routines in the NAG C library available to Ch users without traditional coding and linking. This comprehensive selection of statistical routines can readily use the 2D/3D graphical plotting capabilities of Ch. In addition, with SoftIntegrations free Ch ODBC and Ch CGI toolkit, it is easy to integrate with databases and create web-based applications for statistical ...
Expression of AAK1 (DKFZp686K16132, KIAA1048) in soft tissue tissue. Antibody staining with HPA017931 and HPA020289 in immunohistochemistry.
Pamplona: Capital of both the provincia (province) and the comunidad autónoma (autonomous community) of Navarra, northeastern Spain. It lies on the western bank of the Arga River in the...
nag_regsn_mult_linear_tran_model (g02dkc) is intended for use in situations in which dummy (0-1) variables have been used such as in the analysis of designed experiments when you do not wish to change the arguments of the model to give a full rank model. The function is not intended for situations in which the relationships between the independent variables are only approximate ...
Detail waterproofing system with fiber reinforced liquid polyurethane for use on roofs with complex shapes and penetrations. Contact us for free sample.
First ah Emmah comes.....Then ah I comes .....then ah 2 asses come..then I ah comes again ...then then ah two asses come again.... then ah I comes again...then then ah Pee 2 times..... and then I comes one final time ...
First ah Emmah comes.....Then ah I comes .....then ah 2 asses come..then I ah comes again ...then then ah two asses come again.... then ah I comes again...then then ah Pee 2 times..... and then I comes one final time ...
Sulfonamides constitute a vital and diverse class of therapeutic agents hence the development of convenient and straightforward synthetic routes to such species is a valuable endeavour. This thesis describes an exploration into the reactivity of the novel bifunctional acceptor pentafluorophenyl vinylsulfonate in the formation of biologically interesting sulfonamide species. A variety of transformations were carried out effectively at the electron-deficient olefinic portion of pentafluorophenyl vinylsulfonate to provide functionalized pentafluorophenyl esters. Subsequent displacement of the pentafluorophenyl moiety via an established aminolysis procedure then delivered the corresponding sulfonamide products. During the course of this investigation, it was established that both radical and cycloaddition routes were successful in furnishing desirable compounds. It was found that intermolecular radical addition of alkyl halides occurred readily and permitted the formation of a number of sulfonamide ...
Radikal Therapeutics (RTX) is developing a novel bifunctional small molecule, R-503, intended for the prevention of lung ischemia-reperfusion injury (LIRI) asso...
blowings Merino reharness Pantagruelism upkindle antiparliamentary neobotanist yardwand underprize Ancylostoma interpubic metabolon leucemic zoothome gamekeeping codbank squamosozygomatic Noemi djasakid tintage [email protected] ...
The Apocryphon of John, trans. Frederik Wisse, from The Nag Hammadi Library. This site includes the entire Nag Hammadi Library, as well as a large collection of other primary Gnostic scriptures and documents.
February 17, 2015 - Will Hawkes The way Robin Appel tells it, Maris Otter was lucky to make it to 30, let alone 50. "Fewer and fewer farmers were growing it," Appel, a grain merchant, says of the famous barleys plight in 1990. "No one was encouraging them to. I asked Paul Robertshaw, production director at Wolverhampton & Dudley Breweries, if... View Article ...
Premium liquid-applied Polyurethane Waterproofing Systems for use on Flat Roofs, Sloping Roofs and Roofs with Inverted Insulation. Contact us for free sample.
First of all, if you wouldnt wanna tap Cherokees fat ass it better be cause youre scared of catching something case any other reason would make you a gay ass
Im looking for pictures of asses. I love a good ass hole, but Im IN LOVE with just a regular shot, butt cheeks in all. Anyone willing to post? 1105347
http://www.sobadass.me/wp-content/uploads/2015/09/sobadasslogo.png 0 0 sam http://www.sobadass.me/wp-content/uploads/2015/09/sobadasslogo.png sam2013-09-13 08:41:372013-09-13 08:41:37Be bad ass every day ...
Pursuant to JGLs strategy to focus on business development in clusters/territories where it can make a significant impact, the ASEAN region is in the…
Reviews for Wonderfalls - Season 1, Episode 8: Lovesick Ass: As Jaye and Eric verbally spar over their relationship, or more precisely, lack of one, they encounter and help a ...
Reviews for Wonderfalls - Season 1, Episode 8: Lovesick Ass: As Jaye and Eric verbally spar over their relationship, or more precisely, lack of one, they encounter and help a ...
MSSDAEMAIFGEAAPYLRKPEKERIEAQNRPFDSKKACFVADNKEMYVKGMIQTRENDKVIVKTLDDRML 1 - 70 TLNNDQVFPMNPPKFDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYKPEVV 71 - 140 AAYRGKKRQEAPPHIFSISDNAYQFMLTDRDNQSILITGESGAGKTVNTKRVIQYFATIAVTGDKKKETQ 141 - 210 PGKMQGTLEDQIIQANPLLEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVTFQLS 211 - 280 SERSYHIFYQIMSNKKPELIDLLLISTNPFDFPFVSQGEVTVASIDDSEELLATDNAIDILGFSSEEKVG 281 - 350 IYKLTGAVMHYGNMKFKQKQREEQAEPDGTEVADKAGYLMGLNSAEMLKGLCCPRVKVGNEYVTKGQNVQ 351 - 420 QVTNSVGALAKAVYEKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLCINFTNEKLQQF 421 - 490 FNHHMFVLEQEEYKKEGIEWEFIDFGMDLAACIELIEKPMGIFSILEEECMFPKATDTSFKNKLYDQHLG 491 - 560 KSNNFQKPKPAKGKAEAHFSLVHYAGTVDYNIAGWLDKNKDPLNETVVGLYQKSSLKLLSFLFSNYAGAE 561 - 630 TGDSGGSKKGGKKKGSSFQTVSAVFRENLNKLMTNLRSTHPHFVRCLIPNETKTPGVMDHYLVMHQLRCN 631 - 700 GVLEGIRICRKGFPSRILYADFKQRYRILNASAIPEGQFIDSKNASEKLLNSIDVDREQFRFGNTKVFFK 701 - 770 AGLLGLLEEMRDEKLVTLMTSTQAVCRGYLMRVEFKKMMERRDSIFCIQYNIRSFMNVKHWPWMNLFFKI 771 - 840 ...
... - HIPOTERMIA TERAPEUTYCZNA PO NAGŁYM ZATRZYMANIU KRĄŻENIA. - ZALETY przeciwwskazania oraz korzyści ze stosowania hipotermii. W ramach Programu stosowane są
What exactly is the difference between between being insulin resistant and having diabetes. And apparently from reading the post you can have both. An
AP2-associated protein kinase 1 (Aak1) is a member of the Ark1/Prk1 subfamily of Ser/Thr protein kinases that are thought to regulate endocytosis by phosphorylating the accessory endocytic components. Aak1 interacts with and phosphorylates the mu2 subunit of the AP-2 complex, which promotes binding of the AP-2 to tyrosine based (Yxxf) internalization motif-containing receptors and subsequent receptor endocytosis. At least two isoforms of Aak1 are known to exist; the longer isoform contains an extended carboxy-terminus that contains an additional clathrin-binding domain. Overexpression of this long isoform or Aak1 depletion by RNA interference impairs transferrin recycling from the early/sorting endosome, suggesting that Aak1 functions at multiple steps of the endosomal pathway by regulating transferrin internalization and its recycling back to the plasma membrane. ...
NAGK Converts endogenous N-acetylglucosamine (GlcNAc), a major component of complex carbohydrates, from lysosomal degradation or nutritional sources into GlcNAc 6-phosphate. Also has ManNAc kinase activity. Belongs to the eukaryotic-type N-acetylglucosamine kinase family. Note: This description may include information from UniProtKB ...
If you wish to reuse any or all of this article please use the link below which will take you to the Copyright Clearance Centers RightsLink service. You will be able to get a quick price and instant permission to reuse the content in many different ways.. ...
Rabbit polyclonal antibody raised against synthetic peptide of AAK1. A synthetic peptide corresponding to N-terminus 20 amino acids of human AAK1. (PAB16581) - Products - Abnova
Fast delivery of AAK1 knockout Human Cell Lines for the study of gene function. Created by CRISPR/Cas9 genome editing. Includes matched wildtype control.
ASS AL TAH is a medicine available in a number of countries worldwide. A list of US medications equivalent to ASS AL TAH is available on the Drugs.com website.
iframe title=Hotties in Fishnets Get Fucked in Ass scrolling=no width=600 height=476 src=http://www.youjizz.net/youjizz/embed/75220 frameborder=0,,/iframe,,br /,,a href=http://www.youjizz.net/youjizz/75220 target=_blank,Hotties in Fishnets Get Fucked in Ass,/a,. Provided by ,a href=http://www.youjizz.net target=_blank,youjizz.net,/a ...
Nathaniel Fenton Numerical Algorithms Group, August 2009 Abstract This report gives detailed instructions on how to call routines in the NAG C and Fortran Libraries from the Scilab programming environment.
Get up to date with the latest news and stories about the person Maris Piper at The Irish Times. Breaking News at IrishTimes.com.
Streaming the best Ass fucking videos on xxlgaytube. We have the Best Gay sex tube on the net that gives you the hottest Ass fucking recent videos.
Definition of urea cycle disorders, inborn in the Definitions.net dictionary. Meaning of urea cycle disorders, inborn. What does urea cycle disorders, inborn mean? Information and translations of urea cycle disorders, inborn in the most comprehensive dictionary definitions resource on the web.
[70 Pages Report] Check for Discount on Urea Cycle Disorders - Market Insights, Epidemiology and Market Forecast - 2025 report by Delve Insight. DelveInsight s Urea Cycle Disorders - Market Insights, Epidemiology and Market...
Autor: Molla-Morales, A. et al.; Genre: Zeitschriftenartikel; Im Druck veröffentlicht: 2011; Keywords: mesophyll growth|br/|carbamoyl phosphate synthetase|br/|reticulate leaves|br/|amino acid biosynthesis|br/|carbamoyl-phosphate synthetase|br/|phosphoenolpyruvate/phosphate-translocator|br/|chloroplast biogenesis|br/|mutational analysis|br/|shikimate pathway|br/|gene-expression|br/|bundle-sheath|br/|nitric-oxide|br/|thaliana|br/|leaves; Titel: Analysis of ven3 and ven6 reticulate mutants reveals the importance of arginine biosynthesis in Arabidopsis leaf development
l-Ornithine, a non-essential amino acid, has enormous industrial applications in food, pharmaceutical, and chemical industries. Currently, l-ornithine production is focused on microorganism fermentation using Escherichia coli or Corynebacterium glutamicum. In C. glutamicum, development of high l-ornithine producing C. glutamicum was achieved by deletion of argF, but was accompanied by growth deficiency and arginine auxotrophy. l-Arginine has been routinely added to solve this problem; however, this increases production cost and causes feedback inhibition of N-acetyl-l-glutamate kinase activity. To avoid the drawbacks of growth disturbance due to disruption of ArgF, strategies were adopted to attenuate its expression. Firstly, ribosome binding site substitution and start codon replacement were introduced to construct recombinant C. glutamiucm strains, which resulted in an undesirable l-ornithine production titer. Then, we inserted a terminator (rrnB) between argD and argF, which significantly improved l
Cytonet announced today that new research on its investigational liver cell therapy (LCT) was presented on July 27, 2014 at the 2014 World Transplant
Aak Plant: Aak (Hindi) Plant / Flower / Aak Fruit (Dodi) or Calotropis plant (English) is found in Rajasthan or Western Part of India mostly apart from most parts of the world in dry, sandy and alkaline soils and warm climate. Even aak plant is found in all part of India from Punjab and Rajasthan to Assam and Kanyakumari but It grows abundantly in Rajasthan. It is found in its waste lands and grows as a weed in agricultural lands ...
1-Phosphatidylinositol-4,5-bisphosphate phosphodiesterase epsilon-1 is an enzyme that in humans is encoded by the PLCE1 gene. PLCE1 belongs to the phospholipase family that catalyzes the hydrolysis of polyphosphoinositides such as phosphatidylinositol-4,5-bisphosphate (PtdIns(4,5)P2) to generate the second messengers Ins(1,4,5)P3 and diacylglycerol. These products initiate a cascade of intracellular responses that result in cell growth and differentiation and gene expression.[supplied by OMIM] GRCh38: Ensembl release 89: ENSG00000138193 - Ensembl, May 2017 GRCm38: Ensembl release 89: ENSMUSG00000024998 - Ensembl, May 2017 "Human PubMed Reference:". "Mouse PubMed Reference:". Lopez I, Mak EC, Ding J, Hamm HE, Lomasney JW (May 2001). "A novel bifunctional phospholipase c that is regulated by Galpha 12 and stimulates the Ras/mitogen-activated protein kinase pathway". J Biol Chem. 276 (4): 2758-65. doi:10.1074/jbc.M008119200. PMID 11022047. Song C, Hu CD, Masago M, Kariyai K, Yamawaki-Kataoka Y, ...
8 Bedrooms (8 Masters) Oceanfront in Nags Head Milepost 16 5 Kings, 3 Queens, 1 Double Bunk, 2 Trundles Discounted Green Fees at Nags Head Golf Links (just 1.5 miles away) and Kilmarlic Club Elevator 2 Dogs Welcome ...
Due to security restrictions on help files, it is not possible to browse the Help file directly from the internet, however if you save the file locally (choose save rather than open if prompted by your browser) to a Microsoft Windows system, opening the help file for the NAG Library for .NET from the local file system should open the file in Windows help. You will need to unblock help files copied from the internet before the first use. Select the local copy of the file using the right button. Select the properties tab and click the "unblock" button.. The known issues document reflects all reported and resolved issues that affect various releases of the NAG Library for .NET, along with suggested workarounds where possible.. ...
Immigrant cleaning hes arse and drinking from public tap in Italy., Cleaning your arse INQUISITION Adult Content!, CLEANING OUT - For Anal Sex, CLEANING, CLEANING MY ARSE, Got BUTT HAIR? Grooming Options (Cheeks and Crack)
My whore has to take a new cock today, longer and especially thicker that any I shoved up his ass before. Strapped to a bench, he has cant avoid this extreme penetration, but a pair of clamps on his nipples will make sure he is more obedient and willing to please. First I stretch his man-pussy with My hands, easily placing 6 or even 8 fingers in it at a time. I like that My whore has such a loose man-pussy, but I am going to stretch it even more with My huge black cock. I will fuck him hard with it until his ass cant take no more, and then Ill maybe go grab a bigger one.. Category: STRAP-ON. Related Categories: PEGGING, FEMDOM, FEMALE DOMINATION, DILDO FUCKING, ANAL Keywords: ezada. File Name : Mistress Ezada Sinn - Whore ass ...
This is Kristen Bells ass on the set of When In Rome. I dont mean to brag, but my ass is much tighter. Better luck next time Kristen.
I took i nice little shit on this bag,but what will i do next rub my ass cheeks in my nice warm shit ,and twerk my sexy shitty ass just for you. (187). All of the following downloads are included when you purchase: ...
Cute little Bunny swallowed up that dick as if she needed it more than oxygen! She sucked on his hard rod to get him fully erect to stuff in her asshole. He probed Bunny deeply in the shitter as she spread her cheeks apart and took him up the ass. He plowed into her for quite awhile and then she sucked the cock that was in her ass as she swallowed his cum and was left gaping! ...
Watch Big Titted Girl Gets Ass Fucked online on YouPorn.com. YouPorn is the biggest Anal porn video site with the hottest movies!
Watch Open Wide Cunt & Hairy Ass from Behind video on xHamster, the best sex tube site with tons of free Unique Sexy Girls & From Behind porn movies!
This time I wrote to you a video in which I fill my panties plenty of shit , and sit on a chair and begin ass to push shit that is in my shorts . The result of all my white panties and ass shit .. (207). ...
The National Urea Cycle Disorders Foundation is lifeline of information and support for all those affected by urea cycle disorders. NUCDF is nonprofit organization committed to saving the lives of children and adults with urea cycle disorder. NUCDF is the leader in the identification, treatment and cure of urea cycle disorders; raising awareness, supporting urea cycle disorder research and creating a caring community for patients and families.
Urea cycle disorders are inherited metabolic disorders makes it hard for your body to break down proteins. Learn more about symptoms, emergency treatment, and long-term management.
Biochemistry. 1999 May 25;38(21):6781-90. Research Support, Non-U.S. Govt; Research Support, U.S. Govt, Non-P.H.S.; Research Support, U.S. Govt, P.H.S.
Converts endogenous N-acetylglucosamine (GlcNAc), a major component of complex carbohydrates, from lysosomal degradation or nutritional sources into GlcNAc 6-phosphate. Involved in the N-glycolylneuraminic acid (Neu5Gc) degradation pathway: although human is not able to catalyze formation of Neu5Gc due to the inactive CMAHP enzyme, Neu5Gc is present in food and must be degraded. Also has ManNAc kinase activity.
VitaDigest offer NAG 750 120 Capsules , Product Review For Jarrow Formulas Formula and Information, Exclusive Reivews for NAG 750 120 Capsules Jarrow Formulas
Xem phim video clip Tigerr Benson got her big ass fucked, tuyển chọn bộ phim sex không che miễn phí hay nhất, tải phim Tigerr Benson got her big ass fucked miễn phí Full DVD, phim heo, phim người lớn 18+.
Gorgeous Lilly has sexy pale skin and long legs! She also has a very talented mouth for sucking dick! Lilly opened wide to get that big member stuffed down her throat. And then she spread her cheeks open as he shoved it right up her tight ass too! Lillys pooper was fucked until she couldnt see straight and then he fed her his cock that was covered in ass juice! ...
Roswitha (NOTW), (dbdoty), (coiro), (karish), (mcb), (needtono), (arse), Renee (NOTW), (smash). Somehow, (chrys) got left out of the picture. (And, yes, there is some wierdness due to the panorama.) ...
Looking for seminars events in Newcastle? Whether youre a local, new in town, or just passing through, youll be sure to find something on Eventbrite that piques your interest.

Mouse N-acetyltransferase type 2, the homologue of human N-acetyltransferase type 1. - Oxford NeuroscienceMouse N-acetyltransferase type 2, the homologue of human N-acetyltransferase type 1. - Oxford Neuroscience

There is increasing evidence that human arylamine N-acetyltransferase type 1 (NAT1, EC 2.3.1.5), although first identified as a ... Amino Acid, Substrate Specificity ... Mouse N-acetyltransferase type 2, the homologue of human N- ... Mouse N-acetyltransferase type 2, the homologue of human N-acetyltransferase type 1. ... There is increasing evidence that human arylamine N-acetyltransferase type 1 (NAT1, EC 2.3.1.5), although first identified as a ...
more infohttps://www.neuroscience.ox.ac.uk/publications/100011

Acyl-CoA thioester hydrolase/bile acid-CoA amino acid N-acetyltransferase (IPR006862) | InterPro | EMBL-EBIAcyl-CoA thioester hydrolase/bile acid-CoA amino acid N-acetyltransferase (IPR006862) | InterPro | EMBL-EBI

Acyl-CoA thioester hydrolase/bile acid-CoA amino acid N-acetyltransferase (IPR006862). Short name: Thio_Ohase/aa_AcTrfase ... This entry presents the N-termini of acyl-CoA thioester hydrolase and bile acid-CoA:amino acid N-acetyltransferase (BAAT) [PMID ...
more infohttp://www.ebi.ac.uk/interpro/entry/IPR006862

D-amino-acid N-acetyltransferase - WikipediaD-amino-acid N-acetyltransferase - Wikipedia

D-amino-acid N-acetyltransferase. Other names in common use include D-amino acid acetyltransferase, and D-amino acid-alpha-N- ... a D-amino-acid N-acetyltransferase (EC 2.3.1.36) is an enzyme that catalyzes the chemical reaction acetyl-CoA + a D-amino acid ... an N-acetyl-D-amino acid Thus, the two substrates of this enzyme are acetyl-CoA and D-amino acid, whereas its two products are ... CoA and N-acetyl-D-amino acid. This enzyme belongs to the family of transferases, specifically those acyltransferases ...
more infohttps://en.wikipedia.org/wiki/D-amino-acid_N-acetyltransferase

Modulating substrate specificity of histone acetyltransferase with unnatural amino acids<...Modulating substrate specificity of histone acetyltransferase with unnatural amino acids<...

Modulating substrate specificity of histone acetyltransferase with unnatural amino acids. Kinjal Rajesh Mehta, Ching Yao Yang, ... Modulating substrate specificity of histone acetyltransferase with unnatural amino acids. Molecular BioSystems. 2011 Nov 1;7(11 ... Modulating substrate specificity of histone acetyltransferase with unnatural amino acids. In: Molecular BioSystems. 2011 ; Vol ... Modulating substrate specificity of histone acetyltransferase with unnatural amino acids. / Mehta, Kinjal Rajesh; Yang, Ching ...
more infohttps://nyu-staging.pure.elsevier.com/en/publications/modulating-substrate-specificity-of-histone-acetyltransferase-wit

Proteins matched: GNAT (PS51186) | InterPro | EMBL-EBIProteins matched: GNAT (PS51186) | InterPro | EMBL-EBI

Amino-acid acetyltransferase. Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081). Loading... ... Amino-acid acetyltransferase. Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / ... tRNA(Met) cytidine acetyltransferase TmcA. Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081). ... Acetyltransferase YE1169. Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081). Loading... ...
more infohttp://www.ebi.ac.uk/interpro/ISignatureProteins?sig=PS51186&query=M

KEGG BRITE: KEGG Orthology (KO) - Mycobacterium tuberculosis HaarlemKEGG BRITE: KEGG Orthology (KO) - Mycobacterium tuberculosis Haarlem

... amino-acid N-acetyltransferase [EC:2.3.1.1] K00620 argJ; glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3 ... TBHG_02933 ketol-acid reductoisomerase IlvC TBHG_00189 dihydroxy-acid dehydratase IlvD TBHG_02162 branched-chain-amino-acid ... dihydroxy-acid dehydratase [EC:4.2.1.9] K00826 E2.6.1.42; branched-chain amino acid aminotransferase [EC:2.6.1.42] K14260 alaA ... TBHG_01615 glutamate N-acetyltransferase ArgJ TBHG_00424 N-acetyltransferase TBHG_01616 acetylglutamate kinase ArgB TBHG_01614 ...
more infohttp://www.genome.jp/kegg-bin/get_htext?mtul00001+TBHG_00332

KEGG BRITE: Enzymes - Mycobacterium tuberculosis H37RvKEGG BRITE: Enzymes - Mycobacterium tuberculosis H37Rv

2.3.1.254 N-terminal methionine Nalpha-acetyltransferase NatB 2.3.1.255 N-terminal amino-acid Nalpha-acetyltransferase NatA ... 2.3.1.202 UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine N-acetyltransferase ... 2.3.1.197 dTDP-3-amino-3,6-dideoxy-alpha-D-galactopyranose 3-N-acetyltransferase ... 2.3.1.201 UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase ...
more infohttp://www.genome.jp/kegg-bin/get_htext?mtu01000+Rv2243

naa20 Summary [species: Xenopus laevis and  Xenopus tropicalis] - Xenbase Gene Catalog
	naa20 Summary [species: Xenopus laevis and Xenopus tropicalis] - Xenbase Gene Catalog

amino-acid N-acetyltransferase PANTHER. naa20 KEGG Pathways. K17972 K17972 KOG. [R] Acetyltransferase, (GNAT) family ... Gene Name: N(alpha)-acetyltransferase 20, NatB catalytic subunit Synonyms: nat3 , nat5 Add Xenopus synonyms , Nomenclature ... Gene Function: Acetyltransferase, (GNAT) family Protein Function. : Catalytic subunit of the NatB complex which catalyzes ... NM_001087177,Xenopus laevis N(alpha)-acetyltransferase 20, NatB catalytic subunit S homeolog (naa20.S), mRNA ...
more infohttp://www.xenbase.org/gene/showgene.do?method=display&geneId=969862&

Schmitt JH[au] - PubMed - NCBISchmitt JH[au] - PubMed - NCBI

Purification and properties of acetyl-CoA: D-amino acid-alpha-N-acetyltransferase from yeast]. ...
more infohttps://www.ncbi.nlm.nih.gov/pubmed?cmd=search&term=Schmitt+JH%5Bau%5D&dispmax=50

ACOT2 Gene - GeneCards | ACOT2 Protein | ACOT2 AntibodyACOT2 Gene - GeneCards | ACOT2 Protein | ACOT2 Antibody

Acyl-CoA thioester hydrolase/bile acid-CoA amino acid N-acetyltransferase ProtoNet:. * P49753 ... 483 amino acids. Molecular mass:. 53218 Da. Quaternary structure:. *Monomer.. SequenceCaution:. *Sequence=AAC42007.1; Type= ... very long-chain fatty acid metabolic process. IDA. 16940157. GO:0001676. long-chain fatty acid metabolic process. IDA. 16940157 ... Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A ( ...
more infohttp://www.genecards.org/cgi-bin/carddisp.pl?gc_id=ACOT2

Strand-specific transcriptomes of Enterohemorrhagic Escherichia coli in response to interactions with ground beef microbiota:...Strand-specific transcriptomes of Enterohemorrhagic Escherichia coli in response to interactions with ground beef microbiota:...

... and is decreased in glucose minimal media enriched with amino acids [44]. The repression of genes involved in amino acid ... Genes involved in amino acid transport and biosynthesis. For O2621765, 31 of the 97 genes known, in E. coli, to encode the ... Moreover, their annotation is based on the presence of conserved amino acid motifs and structural features or limited homology. ... Fused acetylglutamate kinase homolog (inactive); amino acid N-acetyltransferase. 530,066. lysA 568 ...
more infohttps://bmcgenomics.biomedcentral.com/articles/10.1186/s12864-017-3957-2

MIP 1alpha rat recombinant - Gentaur.comMIP 1alpha rat recombinant - Gentaur.com

Recombinant Phaeosphaeria nodorum Amino-acid acetyltransferase, mitochondrial (ARG2), partial. Supplier:MyBioSource. Price:0.00 ...
more infohttps://gentaur.com/prod/mip-1alpha-rat-recombinant/biovision/4201947680

Genetic Transformation of Potato to Enhance Nutritional Value and Confer Disease Resistance | Springer for Research &...Genetic Transformation of Potato to Enhance Nutritional Value and Confer Disease Resistance | Springer for Research &...

Hairy Root Genetic Transformation Essential Amino Acid Chloramphenicol Acetyl Transferase Antibacterial Protein These keywords ... Engstrom A, Xanthopoulos K, Boman HG, Bennich H (1985) Amino acid and cDNA sequences of lysozyme from Hyalophora cecropia. EMBO ... The expression of synthetic genes encoding proteins rich in essential amino acids, along with normal protein production within ... Construction and expression of synthetic DNA fragments coding for polypeptides with elevated levels of essential amino acids. ...
more infohttps://rd.springer.com/chapter/10.1007/978-3-7091-9108-8_2

Frontiers | A Computational Model of Inferior Colliculus Responses to Amplitude Modulated Sounds in Young and Aged Rats |...Frontiers | A Computational Model of Inferior Colliculus Responses to Amplitude Modulated Sounds in Young and Aged Rats |...

Adams, J. C., and Wenthold, R. J. (1979). Distribution of putative amino-acid transmitters, choline-acetyltransferase and ... Heterogeneous expression of gamma-aminobutyric acid and gamma-aminobutyric acid-associated receptors and transporters in the ...
more infohttps://www.frontiersin.org/articles/10.3389/fncir.2012.00077/full

NAA35 / MAK10 antibody | acris-antibodies.comNAA35 / MAK10 antibody | acris-antibodies.com

The MAK10 gene encodes a 733-amino acid protein with several regions of similarity to T cell receptor alpha-subunit V (variable ... Lenti ORF particles, Naa35 (Myc-DDK-tagged ORF) - Rat MAK10 homolog, amino-acid N-acetyltransferase subunit, (S. cerevisiae) ( ... Lenti ORF particles, Naa35 (GFP-tagged ORF) - Rat MAK10 homolog, amino-acid N-acetyltransferase subunit, (S. cerevisiae) (Mak10 ... The MAK10 gene encodes a 733-amino acid protein with several regions of similarity to T cell receptor alpha-subunit V (variable ...
more infohttps://www.acris-antibodies.com/target/naa35-antibody-mak10-antibody.htm

rice.txtrice.txt

Glutamate N-acetyltransferase (EC 2.3.1.35) (GAT) (Ornithine acetyltransferase) (OATase) (Ornithine transacetylase); Amino-acid ... Indole-3-acetic acid-amido synthetase GH3.3) (Jasmonate-amino acid synthetase JAR1) (Protein JASMONATE RESISTANT 2) (OsJAR2) [ ... Indole-3-acetic acid-amido synthetase GH3.5) (Jasmonate-amino acid synthetase JAR1) (Protein JASMONATE RESISTANT 1) (OsJAR1) [ ... ORYSJ IAA-amino acid hydrolase ILR1-like 7 precursor (EC 3.5.1.-) [ILL7] [LOC_Os07g14590] [P0021G06.114] Os07g0249800 Q8H3C8 ...
more infohttp://www.uniprot.org/docs/rice

KEGG SSDB Best Search Result: tpe:Tpen 1227KEGG SSDB Best Search Result: tpe:Tpen 1227

aql:BXU06_04140 amino-acid N-acetyltransferase K14682 437 101 ( -) 29 0.305 105 ,-, 1 arz:AUT26_03495 pyridoxal-dependent ... sbb:Sbal175_1945 aromatic amino acid transporter K03834 395 107 ( -) 30 0.302 96 ,-, 1 sbl:Sbal_2433 aromatic amino acid ... sbn:Sbal195_2544 aromatic amino acid transporter K03834 395 107 ( -) 30 0.302 96 ,-, 1 sbs:Sbal117_2569 aromatic amino acid ... cbw:RR42_s3256 D-amino-acid oxidase K21061 389 108 ( 6) 30 0.308 133 -, 2 ccar:109100830 LOW QUALITY PROTEIN: titin-like K12567 ...
more infohttp://www.kegg.jp/ssdb-bin/ssdb_best?org_gene=tpe:Tpen_1227

KEGG SSDB Best Search Result: smi:BN406 06279KEGG SSDB Best Search Result: smi:BN406 06279

nda:Ndas_3060 Amino-acid N-acetyltransferase K00620 256 105 ( 1) 30 0.344 90 -, 2 pci:PCH70_41460 YD repeat-containing protein ... sall:SAZ_31255 amino acid permease K03294 529 118 ( 10) 33 0.302 159 -, 4 serj:SGUI_3113 Phosphomannomutase K01840 562 117 ( 4 ... age:AA314_03670 Branched-chain amino acid ABC transport K20276 1497 101 ( 1) 29 0.390 59 -, 2 agy:ATC03_18490 hypothetical ... lha:LHA_0033 Uncharacterized amino acid permease YhdG K03294 460 104 ( -) 30 0.312 128 -, 1 meta:Y590_08390 aminoglycoside ...
more infohttp://www.kegg.jp/ssdb-bin/ssdb_best?org_gene=smi:BN406_06279

Genome-Wide Characterization of cis-Acting DNA Targets Reveals the Transcriptional Regulatory Framework of Opaque2 in Maize |...Genome-Wide Characterization of cis-Acting DNA Targets Reveals the Transcriptional Regulatory Framework of Opaque2 in Maize |...

2001). Genetic analysis of amino acid accumulation in opaque-2 maize endosperm. Plant Physiol. 125: 1766-1777. ... serine acetyltransferase (SAT; GRMZM2G048740), which is involved in cysteine biosynthesis, was upregulated by 3.67-fold; the ... O2 not only directly activates genes associated with nutrient storage and enzymes involved in carbon and amino acid metabolism ... O2 directly regulates two transcription factors, genes linked to carbon and amino acid metabolism and abiotic stress resistance ...
more infohttp://www.plantcell.org/content/27/3/532.long

Neuroscience/Cellular Neurobiology/Neurotransmitters - Wikibooks, open books for an open worldNeuroscience/Cellular Neurobiology/Neurotransmitters - Wikibooks, open books for an open world

The precursors are Acetyl CoA and choline (an amino acid), and it is synthesized by acetyl transferase. After release, it is ... Gamma-amino butyric acid, or GABA, is an inhibitory amino acid. Its synthesis occurs from glutamate via glutamic acid ... but the basic transmitters are the amino acid neurotransmitters: glutamate, GABA (gamma-amino butyric acid) and glycine. In ... The precursor is tyrosine, which is an amino acid, and the chemical DOPA is synthesized from tyrosine by tyrosine hydroxylase. ...
more infohttps://en.wikibooks.org/wiki/Neuroscience/Cellular_Neurobiology/Neurotransmitters

Plus itPlus it

1978) Distribution of glutamate decarboxylase, choline acetyl-transferase and aromatic amino acid decarboxylase in the basal ... 1971) γ-Aminobutyric acid and a caudato-nigral inhibition. Can J Physiol Pharmacol 49:1113-1115. ... A combination of choline acetyltransferase immunocytochemistry, Golgi-impregnation and electron microscopy. Neuroscience 12:711 ... 1985) Immunocytochemical localization of choline acetyltransferase within the rat neostriatum: a correlated light and electron ...
more infohttp://www.jneurosci.org/content/21/19/7804

Anti-HSAN Antibody Products from Thermo Fisher Scientific | Biocompare.comAnti-HSAN Antibody Products from Thermo Fisher Scientific | Biocompare.com

The 169-amino acid protein is a member of the Acetyltransferase family, GNAT subfamily. The cellular localization is predicted ... HSAN is a reported alias name for the human gene NAA50, or N(alpha)-acetyltransferase 50, NatE catalytic subunit. ...
more infohttps://www.biocompare.com/pfu/110447/soids/154629/Antibodies/HSAN?vids=100011

PathWhizPathWhiz

Amino-acid. acetyltransferase. Gamma-. glutamyltranspeptidase. Glutamine. transport. ATP-binding. protein glnQ. Glutamine. ... acid. NH. 3. Oxoglutaric. acid. NADPH. Ammonium. H. +. H. 2. O. NADP. Acetyl-CoA. N-Acetyl-L-. alanine. CoA. H. +. N-. ... acid. 3-Cyano-L-. alanine. H. 2. O. γ-Glutamyl-β-. cyanoalanine. L-Glutamine. ATP. H. 2. O. ADP. P. i. H. +. L-Glutamine. TCA ... acid. Ammonia. Oxoglutaric. acid. NADPH. Ammonium. Hydrogen Ion. Water. NADP. Acetyl-CoA. N-Acetyl-L-. alanine. Coenzyme A. ...
more infohttp://smpdb.ca/pathwhiz/pathways/PW001886?image_type=greyscale

Influence of Age and Strain on Striatal Dopamine Loss in a Genetic Mouse Model of Lesch-Nyhan Disease - Jinnah - 1999 - Journal...Influence of Age and Strain on Striatal Dopamine Loss in a Genetic Mouse Model of Lesch-Nyhan Disease - Jinnah - 1999 - Journal...

Abbreviations used : AADC, aromatic amino acid decarboxylase ; ChAT, choline acetyltransferase ; HPRT, hypoxanthine-guanine ... Tyrosine hydroxylase and aromatic amino acid decarboxylase, two enzymes responsible for the synthesis of dopamine, were reduced ...
more infohttp://onlinelibrary.wiley.com/doi/10.1046/j.1471-4159.1999.0720225.x/abstract

NAT8 - ddPCR Primer Pair - EvaGreen - Digital PCR | PrimePCR | Bio-RadNAT8 - ddPCR Primer Pair - EvaGreen - Digital PCR | PrimePCR | Bio-Rad

The encoded protein shows amino acid sequence similarity to N-acetyltransferases. A similar protein in Xenopus affects cell ...
more infohttp://www.bio-rad.com/en-us/prime-pcr-assays/assay/dhsaeg5009744-primepcr-ddpcr-expression-evagreen-assay-nat8-human
  • There is increasing evidence that human arylamine N-acetyltransferase type 1 (NAT1, EC 2.3.1.5), although first identified as a homologue of a drug-metabolising enzyme, appears to be a marker in human oestrogen receptor positive breast cancer. (ox.ac.uk)
  • Recently it was demonstrated that different modifications of the amino acid sequences of the AAC(6′) proteins may influence their enzymatic activities ( 4 , 27 , 30 ) or the levels of resistance ( 11 ). (asm.org)
  • As a consequence, the acetyltransferase genes are transcribed from the integron-borne promoters P ant or P ant /P 2 ( 14 , 28 ), and the enzymes are subject to N-terminal sequence variations due to sequence rearrangements that may occur during integration at the attI1 site ( 4 , 5 , 8 , 16 ). (asm.org)
  • Two 6′- N -acetyltransferase isoenzymes have been reported, AAC(6′)-I and AAC(6′)-II, which modify the same amino group but differ in their substrate specificities ( 27 , 34 ). (asm.org)
  • 27 ) identified the amino acid at position 119 as the one responsible for influencing the substrate specificity, where leucine was correlated with amikacin resistance and serine was correlated with gentamicin resistance. (asm.org)
  • Tyrosine hydroxylase and aromatic amino acid decarboxylase, two enzymes responsible for the synthesis of dopamine, were reduced by 22.4-37.3 and 22.2-43.1%, respectively. (wiley.com)