One of the three major groups of endogenous opioid peptides. They are large peptides derived from the PRO-OPIOMELANOCORTIN precursor. The known members of this group are alpha-, beta-, and gamma-endorphin. The term endorphin is also sometimes used to refer to all opioid peptides, but the narrower sense is used here; OPIOID PEPTIDES is used for the broader group.
A 31-amino acid peptide that is the C-terminal fragment of BETA-LIPOTROPIN. It acts on OPIOID RECEPTORS and is an analgesic. Its first four amino acids at the N-terminal are identical to the tetrapeptide sequence of METHIONINE ENKEPHALIN and LEUCINE ENKEPHALIN.
A 90-amino acid peptide derived from post-translational processing of pro-opiomelanocortin (POMC) in the PITUITARY GLAND and the HYPOTHALAMUS. It is the C-terminal fragment of POMC with lipid-mobilizing activities, such as LIPOLYSIS and steroidogenesis. Depending on the species and the tissue sites, beta-LPH may be further processed to yield active peptides including GAMMA-LIPOTROPIN; BETA-MSH; and ENDORPHINS.
An anterior pituitary hormone that stimulates the ADRENAL CORTEX and its production of CORTICOSTEROIDS. ACTH is a 39-amino acid polypeptide of which the N-terminal 24-amino acid segment is identical in all species and contains the adrenocorticotrophic activity. Upon further tissue-specific processing, ACTH can yield ALPHA-MSH and corticotrophin-like intermediate lobe peptide (CLIP).
Peptides with the ability to stimulate pigmented cells MELANOCYTES in mammals and MELANOPHORES in lower vertebrates. By stimulating the synthesis and distribution of MELANIN in these pigmented cells, they increase coloration of skin and other tissue. MSHs, derived from pro-opiomelanocortin (POMC), are produced by MELANOTROPHS in the INTERMEDIATE LOBE OF PITUITARY; CORTICOTROPHS in the ANTERIOR LOBE OF PITUITARY, and the hypothalamic neurons in the ARCUATE NUCLEUS OF HYPOTHALAMUS.
Hormones secreted by the adenohypophysis (PITUITARY GLAND, ANTERIOR). Structurally, they include polypeptide, protein, and glycoprotein molecules.
A 30-kDa protein synthesized primarily in the ANTERIOR PITUITARY GLAND and the HYPOTHALAMUS. It is also found in the skin and other peripheral tissues. Depending on species and tissues, POMC is cleaved by PROHORMONE CONVERTASES yielding various active peptides including ACTH; BETA-LIPOTROPIN; ENDORPHINS; MELANOCYTE-STIMULATING HORMONES; and others (GAMMA-LPH; CORTICOTROPIN-LIKE INTERMEDIATE LOBE PEPTIDE; N-terminal peptide of POMC or NPP).
Enzymes that catalyze the transfer of an acetyl group, usually from ACETYL COENZYME A, to the N-terminus of a peptide chain.
A small, unpaired gland situated in the SELLA TURCICA. It is connected to the HYPOTHALAMUS by a short stalk which is called the INFUNDIBULUM.
One of the three major families of endogenous opioid peptides. The enkephalins are pentapeptides that are widespread in the central and peripheral nervous systems and in the adrenal medulla.
A specific opiate antagonist that has no agonist activity. It is a competitive antagonist at mu, delta, and kappa opioid receptors.
Classic quantitative assay for detection of antigen-antibody reactions using a radioactively labeled substance (radioligand) either directly or indirectly to measure the binding of the unlabeled substance to a specific antibody or other receptor system. Non-immunogenic substances (e.g., haptens) can be measured if coupled to larger carrier proteins (e.g., bovine gamma-globulin or human serum albumin) capable of inducing antibody formation.
Plasma glycoprotein member of the serpin superfamily which inhibits TRYPSIN; NEUTROPHIL ELASTASE; and other PROTEOLYTIC ENZYMES.
One of the two major pharmacological subdivisions of adrenergic receptors that were originally defined by the relative potencies of various adrenergic compounds. The alpha receptors were initially described as excitatory receptors that post-junctionally stimulate SMOOTH MUSCLE contraction. However, further analysis has revealed a more complex picture involving several alpha receptor subtypes and their involvement in feedback regulation.
Hypoxia-inducible factor 1, alpha subunit is a basic helix-loop-helix transcription factor that is regulated by OXYGEN availability and is targeted for degradation by VHL TUMOR SUPPRESSOR PROTEIN.
A member of the NICOTINIC ACETYLCHOLINE RECEPTOR subfamily of the LIGAND-GATED ION CHANNEL family. It consists entirely of pentameric a7 subunits expressed in the CNS, autonomic nervous system, vascular system, lymphocytes and spleen.
Cell surface receptor for LAMININ, epiligrin, FIBRONECTINS, entactin, and COLLAGEN. Integrin alpha3beta1 is the major integrin present in EPITHELIAL CELLS, where it plays a role in the assembly of BASEMENT MEMBRANE as well as in cell migration, and may regulate the functions of other integrins. Two alternatively spliced isoforms of the alpha subunit (INTEGRIN ALPHA3), are differentially expressed in different cell types.
An integrin alpha subunit that is unique in that it does not contain an I domain, and its proteolytic cleavage site is near the middle of the extracellular portion of the polypeptide rather than close to the membrane as in other integrin alpha subunits.
An integrin alpha subunit that primarily associates with INTEGRIN BETA1 or INTEGRIN BETA4 to form laminin-binding heterodimers. Integrin alpha6 has two alternatively spliced isoforms: integrin alpha6A and integrin alpha6B, which differ in their cytoplasmic domains and are regulated in a tissue-specific and developmental stage-specific manner.
An integrin found in FIBROBLASTS; PLATELETS; MONOCYTES, and LYMPHOCYTES. Integrin alpha5beta1 is the classical receptor for FIBRONECTIN, but it also functions as a receptor for LAMININ and several other EXTRACELLULAR MATRIX PROTEINS.
Integrin alpha4beta1 is a FIBRONECTIN and VCAM-1 receptor present on LYMPHOCYTES; MONOCYTES; EOSINOPHILS; NK CELLS and thymocytes. It is involved in both cell-cell and cell- EXTRACELLULAR MATRIX adhesion and plays a role in INFLAMMATION, hematopoietic cell homing and immune function, and has been implicated in skeletal MYOGENESIS; NEURAL CREST migration and proliferation, lymphocyte maturation and morphogenesis of the PLACENTA and HEART.
An interleukin-1 subtype that occurs as a membrane-bound pro-protein form that is cleaved by proteases to form a secreted mature form. Unlike INTERLEUKIN-1BETA both membrane-bound and secreted forms of interleukin-1alpha are biologically active.
An integrin found on fibroblasts, platelets, endothelial and epithelial cells, and lymphocytes where it functions as a receptor for COLLAGEN and LAMININ. Although originally referred to as the collagen receptor, it is one of several receptors for collagen. Ligand binding to integrin alpha2beta1 triggers a cascade of intracellular signaling, including activation of p38 MAP kinase.
A subclass of alpha-adrenergic receptors that mediate contraction of SMOOTH MUSCLE in a variety of tissues such as ARTERIOLES; VEINS; and the UTERUS. They are usually found on postsynaptic membranes and signal through GQ-G11 G-PROTEINS.
This integrin alpha subunit combines with INTEGRIN BETA1 to form a receptor (INTEGRIN ALPHA5BETA1) that binds FIBRONECTIN and LAMININ. It undergoes posttranslational cleavage into a heavy and a light chain that are connected by disulfide bonds.
Integrin alpha1beta1 functions as a receptor for LAMININ and COLLAGEN. It is widely expressed during development, but in the adult is the predominant laminin receptor (RECEPTORS, LAMININ) in mature SMOOTH MUSCLE CELLS, where it is important for maintenance of the differentiated phenotype of these cells. Integrin alpha1beta1 is also found in LYMPHOCYTES and microvascular endothelial cells, and may play a role in angiogenesis. In SCHWANN CELLS and neural crest cells, it is involved in cell migration. Integrin alpha1beta1 is also known as VLA-1 and CD49a-CD29.
A subclass of alpha-adrenergic receptors found on both presynaptic and postsynaptic membranes where they signal through Gi-Go G-PROTEINS. While postsynaptic alpha-2 receptors play a traditional role in mediating the effects of ADRENERGIC AGONISTS, the subset of alpha-2 receptors found on presynaptic membranes signal the feedback inhibition of NEUROTRANSMITTER release.
A cell surface receptor mediating cell adhesion to the EXTRACELLULAR MATRIX and to other cells via binding to LAMININ. It is involved in cell migration, embryonic development, leukocyte activation and tumor cell invasiveness. Integrin alpha6beta1 is the major laminin receptor on PLATELETS; LEUKOCYTES; and many EPITHELIAL CELLS, and ligand binding may activate a number of signal transduction pathways. Alternative splicing of the cytoplasmic domain of the alpha6 subunit (INTEGRIN ALPHA6) results in the formation of A and B isoforms of the heterodimer, which are expressed in a tissue-specific manner.
The sequence of PURINES and PYRIMIDINES in nucleic acids and polynucleotides. It is also called nucleotide sequence.
This intrgrin is a key component of HEMIDESMOSOMES and is required for their formation and maintenance in epithelial cells. Integrin alpha6beta4 is also found on thymocytes, fibroblasts, and Schwann cells, where it functions as a laminin receptor (RECEPTORS, LAMININ) and is involved in wound healing, cell migration, and tumor invasiveness.
The alpha subunits of integrin heterodimers (INTEGRINS), which mediate ligand specificity. There are approximately 18 different alpha chains, exhibiting great sequence diversity; several chains are also spliced into alternative isoforms. They possess a long extracellular portion (1200 amino acids) containing a MIDAS (metal ion-dependent adhesion site) motif, and seven 60-amino acid tandem repeats, the last 4 of which form EF HAND MOTIFS. The intracellular portion is short with the exception of INTEGRIN ALPHA4.
A family of transmembrane glycoproteins (MEMBRANE GLYCOPROTEINS) consisting of noncovalent heterodimers. They interact with a wide variety of ligands including EXTRACELLULAR MATRIX PROTEINS; COMPLEMENT, and other cells, while their intracellular domains interact with the CYTOSKELETON. The integrins consist of at least three identified families: the cytoadhesin receptors(RECEPTORS, CYTOADHESIN), the leukocyte adhesion receptors (RECEPTORS, LEUKOCYTE ADHESION), and the VERY LATE ANTIGEN RECEPTORS. Each family contains a common beta-subunit (INTEGRIN BETA CHAINS) combined with one or more distinct alpha-subunits (INTEGRIN ALPHA CHAINS). These receptors participate in cell-matrix and cell-cell adhesion in many physiologically important processes, including embryological development; HEMOSTASIS; THROMBOSIS; WOUND HEALING; immune and nonimmune defense mechanisms; and oncogenic transformation.
An integrin alpha subunit that binds COLLAGEN and LAMININ though its I domain. It combines with INTEGRIN BETA1 to form the heterodimer INTEGRIN ALPHA1BETA1.
Brain waves characterized by a relatively high voltage or amplitude and a frequency of 8-13 Hz. They constitute the majority of waves recorded by EEG registering the activity of the parietal and occipital lobes when the individual is awake, but relaxed with the eyes closed.
An integrin alpha subunit that occurs as alternatively spliced isoforms. The isoforms are differentially expressed in specific cell types and at specific developmental stages. Integrin alpha3 combines with INTEGRIN BETA1 to form INTEGRIN ALPHA3BETA1 which is a heterodimer found primarily in epithelial cells.
Deficiency of the protease inhibitor ALPHA 1-ANTITRYPSIN that manifests primarily as PULMONARY EMPHYSEMA and LIVER CIRRHOSIS.
The process in which substances, either endogenous or exogenous, bind to proteins, peptides, enzymes, protein precursors, or allied compounds. Specific protein-binding measures are often used as assays in diagnostic assessments.
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
One of the two major classes of cholinergic receptors. Nicotinic receptors were originally distinguished by their preference for NICOTINE over MUSCARINE. They are generally divided into muscle-type and neuronal-type (previously ganglionic) based on pharmacology, and subunit composition of the receptors.
Drugs that selectively bind to and activate alpha adrenergic receptors.
A nuclear transcription factor. Heterodimerization with RETINOID X RECEPTOR GAMMA is important to metabolism of LIPIDS. It is the target of FIBRATES to control HYPERLIPIDEMIAS.
A naturally occurring prostaglandin that has oxytocic, luteolytic, and abortifacient activities. Due to its vasocontractile properties, the compound has a variety of other biological actions.
Drugs that bind to but do not activate alpha-adrenergic receptors thereby blocking the actions of endogenous or exogenous adrenergic agonists. Adrenergic alpha-antagonists are used in the treatment of hypertension, vasospasm, peripheral vascular disease, shock, and pheochromocytoma.
Proteins prepared by recombinant DNA technology.
Hepatocyte nuclear factor 1-alpha is a transcription factor found in the LIVER; PANCREAS; and KIDNEY that regulates HOMEOSTASIS of GLUCOSE.
The parts of a macromolecule that directly participate in its specific combination with another molecule.
The uptake of naked or purified DNA by CELLS, usually meaning the process as it occurs in eukaryotic cells. It is analogous to bacterial transformation (TRANSFORMATION, BACTERIAL) and both are routinely employed in GENE TRANSFER TECHNIQUES.
Glycoprotein found in alpha(1)-globulin region in human serum. It inhibits chymotrypsin-like proteinases in vivo and has cytotoxic killer-cell activity in vitro. The protein also has a role as an acute-phase protein and is active in the control of immunologic and inflammatory processes, and as a tumor marker. It is a member of the serpin superfamily.
An EPIDERMAL GROWTH FACTOR related protein that is found in a variety of tissues including EPITHELIUM, and maternal DECIDUA. It is synthesized as a transmembrane protein which can be cleaved to release a soluble active form which binds to the EGF RECEPTOR.
The intracellular transfer of information (biological activation/inhibition) through a signal pathway. In each signal transduction system, an activation/inhibition signal from a biologically active molecule (hormone, neurotransmitter) is mediated via the coupling of a receptor/enzyme to a second messenger system or to an ion channel. Signal transduction plays an important role in activating cellular functions, cell differentiation, and cell proliferation. Examples of signal transduction systems are the GAMMA-AMINOBUTYRIC ACID-postsynaptic receptor-calcium ion channel system, the receptor-mediated T-cell activation pathway, and the receptor-mediated activation of phospholipases. Those coupled to membrane depolarization or intracellular release of calcium include the receptor-mediated activation of cytotoxic functions in granulocytes and the synaptic potentiation of protein kinase activation. Some signal transduction pathways may be part of larger signal transduction pathways; for example, protein kinase activation is part of the platelet activation signal pathway.
Any of the processes by which nuclear, cytoplasmic, or intercellular factors influence the differential control (induction or repression) of gene action at the level of transcription or translation.
The rate dynamics in chemical or physical systems.
Endogenous substances, usually proteins, which are effective in the initiation, stimulation, or termination of the genetic transcription process.
Drugs that bind to and block the activation of ADRENERGIC ALPHA-1 RECEPTORS.
Nucleocytoplasmic transport molecules that bind to the NUCLEAR LOCALIZATION SIGNALS of cytoplasmic molecules destined to be imported into the CELL NUCLEUS. Once attached to their cargo they bind to BETA KARYOPHERINS and are transported through the NUCLEAR PORE COMPLEX. Inside the CELL NUCLEUS alpha karyopherins dissociate from beta karypherins and their cargo. They then form a complex with CELLULAR APOPTOSIS SUSCEPTIBILITY PROTEIN and RAN GTP-BINDING PROTEIN which is exported to the CYTOPLASM.
Compounds and molecular complexes that consist of very large numbers of atoms and are generally over 500 kDa in size. In biological systems macromolecular substances usually can be visualized using ELECTRON MICROSCOPY and are distinguished from ORGANELLES by the lack of a membrane structure.
Serum glycoprotein produced by activated MACROPHAGES and other mammalian MONONUCLEAR LEUKOCYTES. It has necrotizing activity against tumor cell lines and increases ability to reject tumor transplants. Also known as TNF-alpha, it is only 30% homologous to TNF-beta (LYMPHOTOXIN), but they share TNF RECEPTORS.

Application of ELISA for assessment of antiserum immunoreactivity in endocrine immunocytochemical studies. (1/6)

An indirect method of an enzyme-linked immunosorbent assay (ELISA) is described to assess the reactivity of antisera used for the identification of peptide hormone producing cells by immunocytochemistry. Compared with radioimmunoassay and immunodiffusion, the ELISA method has the advantages of simplicity and sensitivity and represents with the hormone adsorbed to a matrix a situation more or less comparable to that in tissue sections. It is concluded that specificity testing of antisera applied in endocrine immunocytochemical studies can best be achieved by application of the ELISA method in combination with appropriate tissue controls.  (+info)

Isolation and characterization of alpha-endorphin and gamma-endorphin from single human pituitary glands. (2/6)

alpha-Endorphin and gamma-endorphin, two closely related peptides of the pro-opiomelanocortin family with characteristic biological activities, were purified to homogeneity from single human pituitary glands and chemically identified. Isolation of the peptides was based on size fractionation by Sephadex G-75 chromatography followed by two HPLC steps using reverse-phase and paired-ion reverse-phase systems and was monitored by radioimmunoassay. During the isolation procedure alpha- and gamma-endorphin-sized material behaved chromatographically and immunologically indistinguishably from synthetic alpha- and gamma-endorphin. The amino acid composition and NH2-terminus of isolated peptides demonstrated their identity as authentic alpha-endorphin and gamma-endorphin. Acetylated forms were absent. In addition, evidence is provided that large forms with alpha- and gamma-endorphin immunoreactivity detected during gel filtration are human lipotropin-(1-74) and -(1-75), respectively. The data substantiate that alpha-endorphin and gamma-endorphin exist as endogenous peptides in the human pituitary gland.  (+info)

Enhancement of murine bone marrow macrophage differentiation by beta-endorphin. (3/6)

The present study was performed to investigate the effect of beta-endorphin on macrophage colony-stimulating factor (M-CSF)-induced differentiation of macrophages from bone marrow cells in a semisolid culture system. beta-endorphin increased the number of macrophage colonies when bone marrow cells were cultured in the presence of M-CSF plus lipopolysaccharide (LPS). This was not the case with LPS-unresponsive C3H/HeJ mouse bone marrow cells. alpha-endorphin and gamma-endorphin were as effective as beta-endorphin in enhancing the colony formation. Exogenous interleukin-1 (IL-1), but neither IL-6 nor tumor necrosis factor (TNF), collaborated with beta-endorphin even in the absence of LPS, suggesting that IL-1 is a primary mediator of the effect of LPS. Indeed, anti-IL-1 antibody abolished the collaborative effect of beta-endorphin with LPS. Moreover, IL-1 was effective even for C3H/HeJ mouse bone marrow cells. Naloxone, an antagonist of endorphins for opioid-receptors, completely abrogated the effect of beta-endorphin. In a single-cell culture system, the collaboration between beta-endorphin and IL-1 was revealed by the increase in number and size of macrophage colonies, but collaboration between beta-endorphin and LPS did not occur. These results indicate that, in mixed cell culture, beta-endorphin acts in concert with paracrinal IL-1 induced by LPS to enhance M-CSF-dependent macrophage differentiation from immature precursor cells.  (+info)

Mimics of the binding sites of opioid receptors obtained by molecular imprinting of enkephalin and morphine. (4/6)

Molecular imprinting of morphine and the endogenous neuropeptide [Leu5]enkephalin (Leu-enkephalin) in methacrylic acid-ethylene glycol dimethacrylate copolymers is described. Such molecular imprints possess the capacity to mimic the binding activity of opioid receptors. The recognition properties of the resultant imprints were analyzed by radioactive ligand binding analysis. We demonstrate that imprinted polymers also show high binding affinity and selectivity in aqueous buffers. This is a major breakthrough for molecular imprinting technology, since the binding reaction occurs under conditions relevant to biological systems. The antimorphine imprints showed high binding affinity for morphine, with Kd values as low as 10(-7) M, and levels of selectivity similar to those of antibodies. Preparation of imprints against Leu-enkephalin was greatly facilitated by the use of the anilide derivative rather than the free peptide as the print molecule, due to improved solubility in the polymerization mixture. Free Leu-enkephalin was efficiently recognized by this polymer (Kd values as low as 10(-7) M were observed). Four tetra- and pentapeptides, with unrelated amino acid sequences, were not bound. The imprints showed only weak affinity for two D-amino acid-containing analogues of Leu-enkephalin. Enantioselective recognition of the L-enantiomer of phenylalanylglycine anilide, a truncated analogue of the N-terminal end of enkephalin, was observed.  (+info)

High-efficiency synthesis of human alpha-endorphin and magainin in the erythrocytes of transgenic mice: a production system for therapeutic peptides. (5/6)

Chemical synthesis of peptides, though feasible, is hindered by considerations of cost, purity, and efficiency of synthesizing longer chains. Here we describe a transgenic system for producing peptides of therapeutic interest as fusion proteins at low cost and high purity. Transgenic hemoglobin expression technology using the locus control region was employed to produce fusion hemoglobins in the erythrocytes of mice. The fusion hemoglobin contains the desired peptides as an extension at the C end of human alpha-globin. A protein cleavage site is inserted between the C end of the alpha-globin chain and the N-terminal residue of the desired peptide. The peptide is recovered after cleavage of the fusion protein with enzymes that recognize this cleavage signal as their substrate. Due to the selective compartmentalization of hemoglobin in the erythrocytes, purification of the fusion hemoglobin is easy and efficient. Because of its compact and highly ordered structure, the internal sites of hemoglobin are resistant to protease digestion and the desired peptide is efficiently released and recovered. The applicability of this approach was established by producing a 16-mer alpha-endorphin peptide and a 26-mer magainin peptide in transgenic mice. Transgenic animals and their progeny expressing these fusion proteins remain health, even when the fusion protein is expressed at > 25% of the total hemoglobin in the erythrocytes. Additional applications and potential improvements of this methodology are discussed.  (+info)

Specific cleavage of amino side chains of serine and threonine in peptides and proteins with S-ethyltrifluorothioacetate vapor. (6/6)

A vapor of S-ethyltrifluorothioacetate was found to specifically cleave the amino side of serine and threonine peptide bonds. The cleavage reactions were carried out at 50 degrees C for 6 h-24 h or at 30 degrees C for 24 h. When vapors were generated in a solution containing several conventional organic solvents, the cleavage reactions were reduced or stopped, or modification took place. When the reagent vapor was made in an aqueous solution, the cleavage reaction at glycine residues was enhanced. This reagent did not oxidize any amino acid residues, such as methionine, cysteine and tryptophan. The cleavage was also effective on proteins on membranes blotted or electroblotted from polyacrylamide gels. This method therefore may be used for the peptide mass fingerprinting [Patterson, S. D. (1995) Electrophoresis 16, 1104-1114] after two-dimensional electrophoresis.  (+info)

An endogenous opioid peptide derived from BETA-LIPOTROPIN of the pro-opiomelanocortin (POMC) system. It is the 16-amino acid sequence of the N-terminal of BETA-ENDORPHIN and differs from GAMMA-ENDORPHIN by one amino acid (beta-endorphin 1-17 ...
α-Endorphin is an endogenous opioid peptide with a length of 16 amino acids, and the amino acid sequence: Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr. Endorphin E Hazum; KJ Chang; P Cuatrecasas (1979-09-07). Specific nonopiate receptors for beta-endorphin. Science. 205 (4410): 1033-1035. doi:10.1126/science.224457 ...
Citation: N/A Interpretive Summary: Technical Abstract: Endorphins, alpha-endorphin, beta-endorphin, and gamma-endorphin, are endogenous morphine-like substances with a similar chemical structure and analgesic function as morphine (endorphin is a short term for endogenous morphine). Endorphin is the basis of a diverse system (opioid system) associated with physiological function and pathological disorders. As components of an intrinsic pain suppression system, endorphins are involved in regulating the pathogenesis of pain. Activation of the endorphin system triggers an endogenous analgesia cascade by modulating nociceptive signals within the local circuits, such as in the dorsal horn of the spinal cord (the gate control theory of pain), resulting in reducing or inhibiting nociceptive messages forwarded to the somatosensory system. Endorphins, similar to other endogenous opioid peptides, is sensitive to different stress factors. Activation of the opioid system is one of the most effective ways to ...
A sensing interface for specific protein capture was fabricated using a novel molecular imprinting (MIP) process. Bovine serum albumin (BSA) and ovalbumin (OVA) were imprinted on a quartz substrate with modified alkyl groups, and target protein capture was detected using a deep-UV fluorescence image microscope (UVFLIM). The imprinted protein was immobilized to silica beads (diameter: 15 μm) using a phospholipid polymer containing both active ester groups and silane coupling groups, which were used as protein stamps to prepare the imprinting surface. Protein recognition sites were constructed by integrating sodium dodecyl sulfate (SDS) as the ligand, which was immobilized with a biocompatible photoreactive phospholipid polymer. When BSA solution was added to the BSA-based MIP substrate, strong fluorescence was observed from the tryptophan residue of BSA. In contrast, for the OVA-based MIP substrate and non-MIP substrate, no fluorescence was observed. The surface showed good selectivity of BSA ...
Influenza virus H5N1, which caused the recent outbreak of avian flu, may have a new enemy. Researchers at the University of Marylands A. James Clark School of Engineering have created a virus sponge that could filter a patients blood in a process similar to kidney dialysis, removing the virus from the patients body. The concept could also be used to make vaccine production more efficient and in a pill to reduce glucose levels in diabetics, among other applications. The virus sponge is based on a technology called molecular imprinting. In molecular imprinting, researchers stamp a molecules shape into a substance (in this case, a hydrogel-a material that looks like a powder when dry; and like Jell-O when wet). When the specific molecule filters through the hydrogel, it fits in the imprint hole and is trapped. The research group of Peter Kofinas, a professor in the Clark Schools Fischell Department of Bioengineering, is the first to apply molecular imprinting to the capture of viruses, and ...
The aim of this work is to serve as a guideline for the initial selection of monomer and solvent for the synthesis of the nitrocompound - based molecularly imprinted polymers, MIPs. Reported data includes evaluation of six systems with ability to for
There is no author summary for this article yet. Authors can add summaries to their articles on ScienceOpen to make them more accessible to a non-specialist audience. ...
29] Wang S., Xu Z.X., Fang G.Z., Zhang Y., Liu B., Zhu H.P.,Development of a biomimetic enzyme-linked immunosorbentassay method for the determination of estrone inenvironmental water using novel molecularly imprinted filmsof controlled thickness as artificial antibodies, J. Agric. Food.Chem., 2009, 57, 4528-4534.[Crossref ...
The wealth of molecular precursors for organic and inorganic polymers has resulted in an incredible volume of molecular imprinting literature. The vast majority of reports deal with organic polymer systems, and molecular imprinting in silica can still be considered a small niche in the field. In this review,
Japans largest platform for academic e-journals: J-STAGE is a full text database for reviewed academic papers published by Japanese societies
Principal Investigator:TAKAGI Makoto, Project Period (FY):1995 - 1998, Research Category:Grant-in-Aid for Scientific Research (A), Section:一般, Research Field:工業分析化学
The turning point of modern immunological theory was the advent of the clonal selection theory (Burnet, Talmage - 1957). A useful heuristic in the classification of theoretical models was the contrast of instructive with selective models of the acquisition of information by biological systems. The neo-Darwinian synthesis of the 1940s had consolidated biologists model of evolution based on prior random variation and natural selection, viz. differential fecundity. While evolution in the large was by then pretty well settled, controversy remained about examples of cellular adaptation to chemical challenges, like induced drug-resistance, enzyme formation and the antibody response. While instructive theories have been on the decline, some clear cut examples can be found of molecular imprinting in the abiotic world, leading, e.g. to the production of specific sorbents. Template-driven assembly, as in DNA synthesis, has remained a paradigm of instructive specification. Nevertheless, the ...
The molecular imprinting is a process by which selected functional monomers that self-assemble around a master molecule and polymerize in the presence of a crosslinking agent.
γ-Endorphin is an opioid peptide that is characterized by the presence of 17 amino acids. The first 16 amino acids are identical to α-endorphin with Leucine added at the end. Similar to other endorphins, research focusing upon γ-endorphin has been ongoing since its discovery in the 1970s. Yet, most of the information about the substances exact role within the body is speculation that has yet to be proven. Some studies have indicated, however, that the polypeptide has antipsychotic effects on a certain category of patients suffering from schizophrenia, while others suggest that gamma-endorphin may act to help regulate blood pressure. Further research is needed, but if γ-endorphin does indeed possess such characteristics, the substance could eventually be utilized as a useful means of medical treatment. Molecular Expressions: Images from the Microscope. Micro.magnet.fsu.edu. Retrieved 2012-07-25 ...
Molecular imprinting is a promising technique for the preparation of synthetic polymers of predetermined specificity. Function monomers are copolymerized with crosslinkers in the desired molecule, the imprinted molecule. Molecular imprinted polymers have been applied in an increasing number of fields including Separation, antibody and ceptor binding mimics, catalysis and artificial enzymes, biosensor-like devices. Besides, some problems and future research topics of this technique are discussed.
Novel analyte-responsive inverse-opal hydrogels (IOHs) based on molecular imprinting technology were fabricated to generate a highly selective and sensitive device for the colorimetric detection of tetracycline (TC). The TC-responsive IOHs were constructed by packing periodic silica-air arrays and then photo
Abstract: Molecular imprinting is an important tool for generating synthetic receptors with specific recognition sites. The resulting artificial receptor has been extensively used in areas that require molecular recognition. Nevertheless, various imprinted materials synthesized using conventional imprinting protocols have low binding capacities and slow binding kinetics because of difficulty in extracting the original templates and high resistance to mass transfer. The combination of molecular imprinting and nanostructured materials is expected to overcome such difficulties. In this work, template molecules were attached onto the electrospun fibers and by using electrospun nanofibers and attached molecules as sacrificial templates, surface molecularly imprinted membranes with bi-, tri- or tetramodal pore structures were fabricated in the absence or presence of SiO2 nanoparticles in the molecular imprinting precursor. As a demonstration, bovine serum albumin (BSA) and hemoglobin from bovine blood ...
Summary is not available for the mouse gene. This summary is for the human ortholog.] This gene encodes a common acute lymphocytic leukemia antigen that is an important cell surface marker in the diagnosis of human acute lymphocytic leukemia (ALL). This protein is present on leukemic cells of pre-B phenotype, which represent 85% of cases of ALL. This protein is not restricted to leukemic cells, however, and is found on a variety of normal tissues. It is a glycoprotein that is particularly abundant in kidney, where it is present on the brush border of proximal tubules and on glomerular epithelium. The protein is a neutral endopeptidase that cleaves peptides at the amino side of hydrophobic residues and inactivates several peptide hormones including glucagon, enkephalins, substance P, neurotensin, oxytocin, and bradykinin. This gene, which encodes a 100-kD type II transmembrane glycoprotein, exists in a single copy of greater than 45 kb. The 5' untranslated region of this gene is ...
article{7ad62f97-b07f-4eb0-a3bf-db956a1e18d1, abstract = {The technique of molecular imprinting allows the formation of specific recognition sites in synthetic polymers through the use of templates or imprint molecules. These recognition sites mimic the binding sites of antibodies and other biological receptor molecules. Molecularly imprinted polymers can therefore be used in applications relying on specific molecular binding events. The stability, ease of preparation and low cost of these materials make them particularly attractive. This review focuses on recent developments and advances in the field of molecularly imprinted materials, with special emphasis on applications in immunoassays and sensors recently developed by our group and by others.}, author = {Haupt, Karsten Olaf}, issn = {1364-548X}, language = {eng}, number = {2}, pages = {171--178}, publisher = {Royal Society of Chemistry}, series = {Chemical Communications}, title = {Imprinted polymers - Tailor-made mimics of antibodies and ...
Stream Bio, a company that develops and manufactures a range of transformative bioimaging molecular probes, is delighted to announce a new joint venture with Colworth based MIP Diagnostics Ltd., a world leader in molecular imprinting for diagnostic and other applications. The collaborative project will focus on the development of a COVID-19 (or SARS-Cov-2) antigen reagent for assays, a lateral flow Rapid Diagnostic Test (RDT) and an ELISA type assay for high throughput screening (HTS) or mass testing.. The unique properties of both Streams and MIPs novel technologies allows for fast development of an extremely sensitive, and stable detection platform for the virus. The lateral flow project aims to reduce the diagnosis time to just 10 minutes, while the ELISA assay would enable a different detection system common in nearly all labs to be utilised alongside PCR, dramatically increasing capability.. With current PCR-based methods, it can take over a day to receive and act on lab results. The ...
The molecular imprinting techniques have been extensively studied for molecular recognition and their potential applications to separation and catalysis. The traditional imprinting method uses the crosslinking polymerization in the presence of a substrate molecule followed by grinding the bulk system to microparticles with an irregular shape. In addition, the imprinting is restricted to a hydrophobic substrate because the polymerization reaction is usually done in the organic solvent using hydrophobic monomers. In this case, the irregular shape and microparticle size might be a concern for microelectromechanical system (MEMS) application as a biosensor. In this study, we investigated a well-defined nanosphere with a core-shell structure for molecular imprinting. The hydrophilic substrates including D-glucose (D-Glu) or L-phenylalanine (L-Phe) were imprinted on the surface (shell) of nanosphere and their binding behavior were investigated. Their enantiomer (L-Glu or D-Phe) binding behavior to the ...
Receptors generated by natural evolution in living organisms show an astonishing capacity for specifically recognizing target molecules. If applied as recognition units of biosensors, these receptors provide very high selectivity. However, they suffer from instability under measurement conditions, and low durability. Devising alternative robust artificial receptors circumvents these deficiencies. For instance, an antibody can be successfully replaced by a corresponding molecularly imprinted polymer (MIP), sometimes called a plastic antibody. Therefore, MIPs used as recognition units in chemical sensors are gaining increasing interest. In this review, we survey selected examples of MIPs used for determining target bioanalytes by mimicking natural recognition. For scientists working with biosensors, MIPs might be considered as alternatives to natural receptors, such as antibodies, enzymes, or histones.
Cooperative binding is commonly observed in biological receptor systems. This study investigates whether it is possible to prepare nano-sized molecularly imprinted polymers (nanoMIPs) that show cooperative binding. NanoMIPs which exhibit cooperative binding would have increased affinity for immobilised template molecules making them useful for advanced applications in diagnostics and sensors. The use of a templatederivatised solid support provides a facile route to prepare nanoMIPs with surface imprints, and the method is ideally suited to study this topic. Although not observed during the course of this study, positive interbinding site cooperativity was hypothesised by way of an increase in the number of binding sites imprinted on the nanoMIPs, by increasing template density on the solid support surface. After synthesis, the affinity of nanoMIPs was analysed using surface plasmon resonance (SPR) technique. Under the conditions investigated, a ten fold increase in binding affinity was measured ...
Small particles of polymeric material are produced by expansion of a mixture of monomers and a propellant. The size and shape of the particles can be precisely tailored by materials selection and expansion conditions. Particles of 10 nanometers to 100 microns can be produced. If monomers exhibiting solid state reactivity are utilized, the particles thus formed can be polymerized at any time after formation. The particles produced by this method can be molecularly imprinted by incorporating a template into the particle prior to fully curing the particle, in a manner which allows selective extraction of the template from the cured particle after formation without deformation of the imprint site. A two step polymerization process allows the particles to be deposited on and adhered to a wide variety of substrates without additional agents. The molecularly imprinted particles can be used in a wide variety of applications including the selective binding of analyte from a sample, where the analyte is the
Surface plasmon resonance (SPR) biosensors are used to characterize and quantify biomolecular interactions. Real-time and fast measurement, high sensitivity and specificity, no need of labeled reagents are the unique properties of SPR biosensors. SPR biosensors have been used for detection of several analytes. Recently, molecular imprinting technology is used for creation of biorecognition surfaces on the SPR biosensors. Molecular imprinting is the technology of designing materials with robust recognition sites suitable for interaction with the print molecule. Due to their stability in complex matrices under tough conditions, ease of preparation, low cost, reusability, high recognition capacity to the template molecule and binding characteristics as high as those of natural binders, molecularly imprinted polymers (MIPs) are extensively used in a variety of areas, such as catalysis, separations, solid-phase extractions and biosensors. In this study, an SPR biosensor was prepared for prostate ...
LVV-hemorphin 6: from human pituitary gland; opioid active peptide fragment of hemoglobin which corresponds to the sequence position 32-40 of the beta chain of human hemoglobin
A new series of phosphonyl derivatives has been prepared and tested for inhibition of serine (classes A and C) beta-lactamases. The results were compared with those previously acquired with aryl phosphonate monoesters and with alkaline hydrolysis rates. A methyl p-nitrophenyl phosphate monoanion was markedly poorer as an inhibitor of the class C beta-lactamase of Enterobacter cloacae P99 than a comparable p-nitrophenyl phosphonate. Phosphonyl fluorides, thiophenyl esters, N-phenylphosphonamidates and a p-nitrophenyl thionophosphonate were, in general, comparable with p-nitrophenyl phosphonates in inhibitory power. The incorporation of a specific amino side chain led to an increase in the rates of inhibition of around 10(4)-fold. Apparently unresponsive to the addition of the side chain to the enzyme was N-phenyl methylphosphonamidate, where binding of the side chain may interfere with access of the leaving group to a proton which is necessary to active-site phosphonylation and inhibition. ...
With great sadness, we inform our colleagues and the scientific community of the decease of Prof. Dr. Denise P. Barlow. Denise died on October 21, 2017 at the age of 67 after severe illness in the company of friends. Denise Barlow was one of the most accomplished geneticists ever to operate in Austria and one of the most inspiring epigeneticists in Europe. Denise Barlow is one of the few researchers who could claim not only to have discovered a fundamental regulatory principle of eukaryotic gene expression, molecular imprinting, but to actually have elucidated the underlying mechanism.. In 1991, the Barlow group discovered the first mammalian imprinted gene (Igf2r) and since then, has worked relentlessly to uncover many fascinating details of the imprinting mechanism. As a result, imprinting of the Igf2r gene has acted as a model of epigenetic regulation in mammals. Her laboratory has shown that an unusual and very long non-coding RNA (lncRNA), a macro ncRNA, induces imprinted gene expression. ...
Molecular Imprinting Technology (MIT) is a technique to design artificial receptors with a predetermined selectivity and specificity for a given analyte, which can be used as ideal materials in various application fields. Molecularly Imprinted Polymers (MIPs), the polymeric matrices obtained using the imprinting technology, are robust molecular recognition elements able to mimic natural recognition entities, such as antibodies and biological receptors, useful to separate and analyze complicated samples such as biological fluids and environmental samples. The scope of this review is to provide a general overview on MIPs field discussing first general aspects in MIP preparation and then dealing with various application aspects. This review aims to outline the molecularly imprinted process and present a summary of principal application fields of molecularly imprinted polymers, focusing on chemical sensing, separation science, drug delivery and catalysis. Some significant aspects about preparation and
Abstract: A highly selective imprinted sorbent was prepared by a surface molecular imprinting technique, and used for solid phase extraction-high performance liquid chromatography (SPE-HPLC) to determine trace norfloxacin (NOF) in complicated samples. The molecularly imprinted polymer (MIP) was obtained by using NOF as the template, β-cyclodextrin-methyl methacrylate (β-CD-MMA) and acrylamide (AM) as functional monomers, ethylene glycol dimethacrylate (EDMA) as the cross-linking agent and toluene as the porogen. Various parameters affecting the extraction efficiency of the polymer have been evaluated to optimize the selective preconcentration of the NOF from fish samples. The NOF from fish samples, selectively extracted by MIP, was detected by RP-HPLC. The MISPE-HPLC method showed high selectivity and good recoveries (>85.7%). It was demonstrated that this MISPE-HPLC method could be applied for direct preconcentration and determination of quinolones in real ...
Definition of LIA in the Legal Dictionary - by Free online English dictionary and encyclopedia. What is LIA? Meaning of LIA as a legal term. What does LIA mean in law?
TY - JOUR. T1 - The distribution of immunoreactive α-melanocyte-stimulating hormone cells in the adult human pituitary gland. AU - Coates, P. J.. AU - Doniach, I.. AU - Hale, A. C.. AU - Rees, L. H.. PY - 1986. Y1 - 1986. N2 - It has been suggested that a proportion of the adenomas and the nodular hyperplasia of cells in the pituitary gland in cases of Cushings disease are derived from cells of the pars intermedia rather than the pars anterior. The evidence can be summarized as follows: the posterior site of adenoma or nodular hyperplasia in the pituitary, the innervation of cells and the suppressive response to the dopamine agonist bromocriptine in vivo or to dopamine in vitro. All these observations infer analogy with cells of the pars intermedia of other species, which are controlled by direct neural tonic dopaminergic inhibition. The adult human pituitary gland, however, does not possess a morphologically distinct pars intermedia, due to regression of the rudimentary fetal pars intermedia ...
Endoproteinase Lys-C is a highly-purified serine protease isolated from Lysobacter enzymogenes that hydrolyzes specifically at the carboxyl side of Lysine. Lys-C retains proteolytic activity under protein denaturing conditions such as 8M urea, which is used to improve digestion of proteolytically resistant proteins. Lys-C activity is optimal in the pH range of 7.0-9.0. This protease can be used alone or in combination with other proteases to produce protein digests for peptide mapping applications or proteinidentification by peptide mass fingerprinting or MS/MS spectral matching. Endoproteinase Lys-N is a metalloprotease that cleaves at the amino side of lysine residues. Lys-N is a zinc metalloprotease derived from Grifola frondosa that retains proteolytic activity under protein denaturing conditions such as 8M urea, which is used to improve digestion of proteolytically resistant proteins. Charged amino-terminal peptide fragments generated by Lys-N are useful for de novo sequencing with ETD
Purpose: : Molecular imprinting has been used to prolong drug release in drug delivery applications. Hyaluronic acid (HA) has been shown to decrease lysozyme sorption and improve wettability in model contact lenses when used as an internal wetting agent. It was of interest to investigate the release of imprinted HA to determine if imprinting prolonged HA release and if this released HA decreased lysozyme sorption. Methods: : Model conventional (pHEMA) and silicone (pHEMA/TRIS) hydrogels were synthesized. HA was added to the reaction mixture prior to UV polymerization. The release of HA into PBS was measured using UV Spectroscopy at 280 nm. Throughout the release, hydrogels were removed from PBS, dried and then incubated with radiolabeled lysozyme for 2 hrs (pHEMA) and 24 hrs (pHEMA/TRIS) to determine if the released HA could decrease sorption. Results: : HA (35 and 910 kDa) was released from pHEMA hydrogels for 14 days. The lysozyme sorption ranged from 5.26 ± 0.32 to 13.49 ± 0.77 µg for 35 ...
In chapter 3, The Sense of Sensibility, author Wendy Jones uses scenes from one of Jane Austens most celebrated novels to illustrate the functioning of the bodys stress response system.. 0 Comments. ...
A molecularly imprinted sol-gel is reported for selective and sensitive electrochemical determination of the drug naloxone (NLX). The sensor was developed by combining molecular imprinting and sol-gel techniques and electrochemically grafting the sol solution onto a functionalized multiwall carbon nanotube modified indium-tin oxide (ITO) electrode. The sol-gel layer was obtained from acid catalyzed hydrolysis and condensation of a solution composed of triethoxyphenylsilane (TEPS) and tetraethoxysilane (TES). The fabrication, structure and properties of the sensing material were characterized via scanning electron microscopy, spectroscopy and electrochemical techniques. Parameters affecting the sensors performance were evaluated and optimized. A sensor fabricated under the optimized conditions responded linearly between 0.0 µM and 12 µM NLX, with a detection limit of 0.02 µM. The sensor also showed good run-to-run repeatability and batch-to-batch performance reproducibility with relative standard
Somatropin is a polypeptide hormone consisting of 191 amino acid residues and its structure is identical to that of growth hormone extracted from human pituitary glands.The clinical efficacy of SEROSTIM (somatropin for injection) was assessed in a short term metabolic study and two placebo-controlled Phase III clinical trials.Patients completing 12 weeks of treatment were eligible to receive open-label SEROSTIM therapy.
"ALPHA WOLF Announce FAULT EP". Amnplify.com. March 20, 2019. Retrieved April 19, 2019. "GRAND MAGUS To Release 'Wolf God' Album ... "INFECTED RAIN Reveal Endorphin Album Details; "Storm" Lyric Video Streaming". Brave Words & Bloody Knuckles. September 5, 2019 ... "KONKHRA Release "Babylon", First Single From New Album Alpha And The Omega". Brave Words & Bloody Knuckles. August 5, 2019. ...
... alpha and gamma-endorphin. Pancreatic enteroendocrine cells are located in the islets of Langerhans and produce most ... Zverkov IV, Vinogradov VA, Smagin VG (October 1983). "[Endorphin-containing cells in the gastric antral mucosa in duodenal ...
... isolation of alpha-N-acetyl peptides. Nature, 272, 252-254. 30. Zakarian, S. and Smyth, D.G. (1982) β-endorphin is processed ... A much more potent analgesic than any of the other endorphins … it is also much longer-lived in the brain. This led Dr Smyth to ... Davis, Joel (1984). Endorphins: New Waves in Brain Chemistry. Garden City, New York: Dial Press. pp. 44-45. OCLC 1033595208. ... Smyth, D.G., Smith, C.C.F. and Zakarian, S. (1981) Isolation and identification of two new peptides related to β-endorphin. In ...
Stress increases the release of [alpha]-melanocyte-stimulating hormone and causes increased grooming and endorphin production. ...
... and synthesis of alpha-endorphin and gamma-endorphin, two peptides of hypothalamic-hypophysial origin with morphinomimetic ... The POMC gene codes for endogenous opioids such as β-endorphin and γ-endorphin. The human gene for the enkephalins was isolated ... Such peptides may be produced by the body itself, for example endorphins. The effects of these peptides vary, but they all ... Comments: β-Endorphin is the highest potency endogenous ligand ... Morphine occurs endogenously [117].. ... Principal ...
... endorphin, enkephalin and alpha-actinin-3. The risks of gene doping would be similar to those of gene therapy: immune reaction ... Alpha-actinin-3 is found only in skeletal muscle in humans, and has been identified in several genetic studies as having a ... for example pain perception depends on endorphins and enkephalins, response to stress depends on BDNF, and an increase in ...
Peniston EG, Kulkosky PJ (April 1989). "Alpha-theta brainwave training and beta-endorphin levels in alcoholics". Alcoholism, ... Many could then produce alpha and non-alpha states at will. In the second part of the study, a tone was sounded whenever alpha ... Alpha-theta training has also been shown to improve novice singing in children. Alpha-theta neurofeedback, in conjunction with ... Biswas, A., & Ray, S. (2019). Alpha neurofeedback has a positive effect for participants who are unable to sustain their alpha ...
The Alphas: A gang of college-age men and women who have werewolf abilities. Billy Borden: One of the Alphas. Georgia: One of ... spun with a Hollywood sensibility for maximum endorphin rush. No, it isn't great literature. It's great escapism, a pure roller ... Susan evacuates the Alphas, and the Chicago police arrest Marcone on general principle, though Dresden predicts that no charges ... the Alphas. The Streetwolves: A Chicago biker gang of lycanthropes. Detective Rudolph: A new officer at SI. Thomas Wagner, on ...
TGF alpha, and β-endorphin. Considerable interest in IDE has been stimulated due to the discovery that IDE can degrade amyloid ...
See Alpha Beta carbon, in organic chemistry-the second carbon atom in a chain when counting from a functional group; See Alpha ... a secondary protein structure Beta-endorphin, a kind of neurotransmitter Beta (plasma physics), the ratio of thermal to ...
... alpha and gamma-endorphin, bombesin Thyroid gland cells Thyroid epithelial cell Parafollicular cell Parathyroid gland cells ... Parathyroid chief cell Oxyphil cell Pancreatic islets (islets of Langerhans) Alpha cell (secretes glucagon) Beta cell (secretes ...
... endorphins MeSH D12.776.641.650.575.241.030 - alpha-endorphin MeSH D12.776.641.650.575.241.080 - beta-endorphin MeSH D12.776. ... alpha-msh MeSH D12.776.641.650.460.075 - beta-msh MeSH D12.776.641.650.460.115 - gamma-msh MeSH D12.776.641.650.575.180 - ... 641.650.575.241.360 - gamma-endorphin MeSH D12.776.641.650.575.281 - enkephalins MeSH D12.776.641.650.575.281.075 - enkephalin ...
"Mapping of alpha-neo-endorphin- and neurokinin B-immunoreactivity in the human brainstem". Brain Structure and Function. 218 (1 ... Neoendorphin Kangawa K.; Minamino N.; Chino N (1981). "The complete amino acid sequence of α-neo-endorphin". Biochemical and ...
... producing a 31 amino acid-long neuropeptide with an alpha-helical secondary structure. However, POMC also gives rise to other ... It is one of three endorphins that are produced in humans, the others of which include α-endorphin and γ-endorphin. The amino ... CID 16132316 from PubChem - β-endorphin CID 3081525 from PubChem - β-endorphin (1-9) CID 133304 from PubChem - β-endorphin (2-9 ... β-Endorphin is considered to be a part of the endogenous opioid and endorphin classes of neuropeptides; all of the established ...
... β-Endorphin [Met]Enkephalin Although the N-terminal 5 amino acids of β-endorphin are identical to the sequence of [Met] ... "Entrez Gene: POMC proopiomelanocortin (adrenocorticotropin/ beta-lipotropin/ alpha-melanocyte stimulating hormone/ beta- ... β-Endorphin and [Met]enkephalin are endogenous opioid peptides with widespread actions in the brain. The POMC gene is located ... These include several distinct melanotropins, lipotropins, and endorphins that are contained within the adrenocorticotrophin ...
... activity in bovine and rat intermediate pituitaries responsible for the acetylation of beta-endorphin and alpha-melanotropin". ... In enzymology, a peptide alpha-N-acetyltransferase (EC 2.3.1.88) is an enzyme that catalyzes the chemical reaction acetyl-CoA ... O'Donohue TL (1983). "Identification of endorphin acetyltransferase in rat brain and pituitary gland". J. Biol. Chem. 258 (4): ... Other names in common use include beta-endorphin acetyltransferase, peptide acetyltransferase, protein N-terminal ...
The μ-opioid receptors (MOR) are a class of opioid receptors with a high affinity for enkephalins and beta-endorphin, but a low ... It is an inhibitory G-protein coupled receptor that activates the Gi alpha subunit, inhibiting adenylate cyclase activity, ...
... endorphins MeSH D12.644.400.575.241.030 - alpha-endorphin MeSH D12.644.400.575.241.080 - beta-endorphin MeSH D12.644.400.575. ... alpha-endorphin MeSH D12.644.468.241.080 - beta-endorphin MeSH D12.644.468.241.360 - gamma-endorphin MeSH D12.644.468.281 - ... gtp-binding protein alpha subunits, g12-g13 MeSH D12.644.360.375.100.200 - gtp-binding protein alpha subunits, gi-go MeSH ... gtp-binding protein alpha subunits, gq-g11 MeSH D12.644.360.375.100.400 - gtp-binding protein alpha subunits, gs MeSH D12.644. ...
Earl CQ, Prozialeck WC, Weiss B.: Interaction of alpha adrenergic antagonists with calmodulin. Life Sci. 1984 Jul 30;35(5):525- ... Sellinger‑Barnette, M. and Weiss, B.: Interaction of beta‑endorphin and other opioid peptides with calmodulin. Mol. Pharmacol. ... alpha adrenergic antagonists [23]and phenothiazineantipsychotic drugs were potent inhibitors of calmodulin activated enzymes [ ...
Neuropsychiatric symptoms related to interferon alpha]" [Neuropsychiatric symptoms related to interferon alpha]. Psychiatria ... In these cases, the self-injury is believed to be done to release beta-endorphin, which binds to the same receptors as heroin ... Naltrexone is effective in suppressing the cytokine-mediated adverse neuropsychiatric effects of interferon alpha therapy. Some ...
They are found within the pre-BötC and act via alpha-1, alpha-2, and beta-noradrenergic mechanisms.NE induces ICAN-dependent ... These include norepinephrine, serotonin, acetylcholine, substance P, ATP, TRH, somatostatin, dopamine, endorphins, and ...
CES has shown to induce changes in the electroencephalogram, increasing alpha relative power and decreasing relative power in ... substantial increases in beta endorphins, adrenocorticotrophic hormone, and serotonin; moderate increases in melatonin and ...
... and synthesis of alpha-endorphin and gamma-endorphin, two peptides of hypothalamic-hypophysial origin with morphinomimetic ... β-Endorphin. YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE. μ-opioid receptor'†'‡, δ-opioid receptor†. [8][9][10][7]. ... α-Endorphin. YGGFMTSEKSQTPLVT. μ-opioid receptor, unknown affinity for other opioid receptors. [8]. ... γ-Endorphin. YGGFMTSEKSQTPLVTL. μ-opioid receptor, unknown affinity for other opioid receptors. [8]. ...
beta-endorphin. 237-267 met-enkephalin. 237-241 In order to regulate the secretion of ACTH, many substances secreted within ... melanotropin alpha. melanocyte-stimulating hormone. α-MSH. 138-150 corticotropin-like intermediate peptide. CLIP. 156-176 ...
Four types of endorphins are created in the human body. They are named alpha (α), beta (β), gamma (γ) and sigma (σ) endorphins ... Beta-endorphins (β-endorphins) are the most powerful endorphins in the body. They are usually in the hypothalamus and pituitary ... Endorphin rush[change , change source]. The term 'endorphin rush' is sometimes used in normal speech to refer to a feeling of ... Endorphins are natural chemicals in the body that fight pain. Endorphins are released when a person gets hurt, but also during ...
Alpha-helical CRH-(9-41) acts as a CRH antagonist. CRH is also synthesized by the placenta and seems to determine the duration ... β-endorphin). ACTH stimulates the synthesis of cortisol, glucocorticoids, mineralocorticoids and DHEA. In the short term, CRH ... "Characterization of a 41-residue ovine hypothalamic peptide that stimulates secretion of corticotropin and beta-endorphin". ...
... tract Lateral vestibulospinal tract Medial vestibulospinal tract Reticulospinal tract Lateral raphespinal tract Alpha system ... organs Noradrenaline system Dopamine system Serotonin system Cholinergic system GABA Neuropeptides Opioid peptides Endorphins ...
... and synthesis of alpha-endorphin and gamma-endorphin, two peptides of hypothalamic-hypophysial origin with morphinomimetic ... The class of endorphins consists of three endogenous opioid peptides: α-endorphin, β-endorphin, and γ-endorphin.[3] α-endorphin ... The endorphin class consists of α-endorphin, β-endorphin, and γ-endorphin. All three preferentially bind to μ-opioid receptors. ... β-endorphin is the primary endorphin released from the pituitary gland. Endorphin binding at μ-receptors inhibits pain signals ...
... labeled alpha- and beta- subunits) that are non-covalently associated: The alpha subunits of LH, FSH, TSH, and hCG are ... Part of the inhibitory action of endorphins on GnRH-1 release is through inhibition of these GABA neurons. Rupture of the ... The gene for the alpha subunit is located on chromosome 6q12.21. The luteinizing hormone beta subunit gene is localized in the ... In contrast to the alpha gene activity, beta LH subunit gene activity is restricted to the pituitary gonadotropic cells. It is ...
Beta-endorphin. *Alpha-endorphin. *Gamma-endorphin. *α-neo-endorphin. *β-neo-endorphin ... α (FSH FSHB, LH LHB, TSH TSHB, CGA) · Prolactin · POMC (CLIP, ACTH, MSH, Endorphins, Lipotropin) · GH ... activity of peptidyl glycine alpha-amidating mono-oxygenase and concentrations of its cofactor, ascorbic acid". J. Endocrinol. ...
... is typically used to treat hypothyroidism,[9] and is the treatment of choice for people with hypothyroidism,[10] who often require lifelong thyroid hormone therapy.[11] It may also be used to treat goiter via its ability to lower thyroid-stimulating hormone (TSH), a hormone that is considered goiter-inducing.[12][13] Levothyroxine is also used as interventional therapy in people with nodular thyroid disease or thyroid cancer to suppress thyroid-stimulating hormone (TSH) secretion.[14] A subset of people with hypothyroidism treated with an appropriate dose of levothyroxine will describe continuing symptoms despite TSH levels in the normal range.[11] In these people, further laboratory and clinical evaluation is warranted as they may have another cause for their symptoms.[11] Furthermore, it is important to review their medications and possible dietary supplements as several medications can affect thyroid hormone levels.[11] Levothyroxine is also used to treat subclinical ...
Four types of endorphins are created in the human body. They are named alpha (α), beta (β), gamma (γ) and sigma (σ) endorphins ... Beta-endorphins (β-endorphins) are the most powerful endorphins in the body. They are usually in the hypothalamus and pituitary ... Endorphin rushEdit. The term 'endorphin rush' is sometimes used in normal speech to refer to a feeling of wellness caused by ... Endorphins are natural chemicals in the body that fight pain. Endorphins are released when a person gets hurt, but also during ...
A number of cytokines, such as IL-1, IL-6, IL-10 and TNF-alpha can activate the HPA axis, although IL-1 is the most potent. The ... E/NE will positively feedback to the pituitary and increase the breakdown of POMCs into ACTH and β-endorphins. ... TNF alpha, and IFN gamma) and increasing the levels of anti-inflammatory cytokines (e.g. IL-4, IL-10, and IL-13) in immune ...
... including the Alpha-7 nicotinic receptor.[27] BDNF has also been shown to interact with the reelin signaling chain.[28] The ... "Brain-derived neurotrophic factor regulates the expression and synaptic delivery of alpha-amino-3-hydroxy-5-methyl-4-isoxazole ...
platelet alpha granule lumen. • extracellular. Biological process. • regulation of gene expression by genetic imprinting. • ...
platelet alpha granule lumen. • extracellular. • clathrin-coated vesicle membrane. • cell membrane. Biological process. • ... Transforming growth factor (Alpha) Epithelial cell Similar to Epidermal growth factor 4 Transforming growth factor (Beta) ... 1p9j: Solution structure and dynamics of the EGF/TGF-alpha chimera T1E ...
The alpha subunits of LH, FSH, TSH, and hCG are identical, and contain 92 amino acids in human but 96 amino acids in almost all ... Part of the inhibitory action of endorphins on GnRH-1 release is through inhibition of these GABA neurons. Rupture of the ... In contrast to the alpha gene activity, beta LH subunit gene activity is restricted to the pituitary gonadotropic cells. It is ... Each monomeric unit is a glycoprotein molecule; one alpha and one beta subunit make the full, functional protein. ...
The last hydrolysis that releases the active oxytocin nonapeptide is catalyzed by peptidylglycine alpha-amidating monooxygenase ... activity of peptidyl glycine alpha-amidating mono-oxygenase and concentrations of its cofactor, ascorbic acid". The Journal of ...
Cleaved from the precursor proopiomelanocortin protein, and include adrenocorticotropic hormone (ACTH), and beta-endorphin, and ... Knepel W, Homolka L, Vlaskovska M, Nutto D. (1984). Stimulation of adrenocorticotropin/beta-endorphin release by synthetic ...
Studies on rats indicate that PCP interacts indirectly with opioid receptors (endorphin and enkephalin) to produce analgesia.[ ... increased delta decreased alpha) and in the hippocampus (increase theta bursts) that were similar to those in schizophrenia.[70 ...
M-ALPHA. *RH-34. Also empathogens in general (e. g.: 5-APB, 5-MAPB, 6-APB and other substituted benzofurans, MDAI, MDMA). ...
... alpha-methylfentanyl.[2] High cross-reactivity may be the effect of the shape of the molecule - the shape of butyrfentanyl is ... alpha-methylfentanyl , butyrylfentanyl , benzylfentanyl.[2] The studies in inhibition studies on binding affinity achieved the ...
It inhibits production of interleukin (IL)-12, interferon (IFN)-gamma, IFN-alpha, and tumor-necrosis-factor (TNF)-alpha by ... Cortisol is also metabolized into 5-alpha tetrahydrocortisol (5-alpha THF) and 5-beta tetrahydrocortisol (5-beta THF), ... reactions for which 5-alpha reductase and 5-beta reductase are the rate-limiting factors, respectively. 5-Beta reductase is ...
... narcoleptic humans also exhibit a specific genetic mutation in the T-cell receptor alpha locus.[22] In conjunction, these ... "Narcolepsy is strongly associated with the T-cell receptor alpha locus". Nature Genetics. 41 (6): 708-11. doi:10.1038/ng.372 ...
Alpha-1 blockers (e.g., prazosin). *Alpha-2 agonists (e.g., clonidine, dexmedetomidine, guanfacine) ...
... such as tumor necrosis factor alpha[12] and fatty acids.[13] One of the defining features of Type 2 diabetes is insulin ... The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase ...
... endorphin, and oxytocin levels, and males after orgasm during copulation experience an increase in endorphins and a marked ... Randall VA (Apr 1994). "Role of 5 alpha-reductase in health and disease". Baillière's Clinical Endocrinology and Metabolism. 8 ... von der PB, Sarkola T, Seppa K, Eriksson CJ (Sep 2002). "Testosterone, 5 alpha-dihydrotestosterone and cortisol in men with and ... When testosterone and endorphins in ejaculated semen meet the cervical wall after sexual intercourse, females receive a spike ...
Proopiomelanocortin (POMC) is a precursor polypeptide that is cleaved into MSH, ACTH, and β-endorphin and expressed in the ... Baltatzi M, Hatzitolios A, Tziomalos K, Iliadis F, Zamboulis C (September 2008). "Neuropeptide Y and alpha-melanocyte- ... The release of a POMC product, beta-endorphin is regulated by NPY. ... β-endorphin, melanocyte-stimulating hormone (MSH), and somatostatin. ...
... causing receptor conformation that activates Gs alpha subunit of the closely associated G-Protein complex on the intracellular ...
"DHEA metabolites activate estrogen receptors alpha and beta". Steroids. 78 (1): 15-25. doi:10.1016/j.steroids.2012.10.002. PMC ... "Discovery of estrogen receptor alpha target genes and response elements in breast tumor cells". Genome Biology. 5 (9): R66. ...
Alpha-lipoic acid (ALA). *Ascorbic acid (vitamin C). *Carotenoids (vitamin A). *Curcumin ...
Combined with alpha-fetoprotein, β-HCG is an excellent tumor marker for the monitoring of germ cell tumors.[citation needed] ... The α (alpha) subunit is 92 amino acids long.[8]. *The β-subunit of hCG gonadotropin (beta-hCG) contains 145 amino acids, ... "Glycoprotein hormones alpha chain precursor - Homo sapiens (Human)". UniProt accession number P01215. UniProt Consortium. ... It is heterodimeric, with an α (alpha) subunit identical to that of luteinizing hormone (LH), follicle-stimulating hormone (FSH ...
"Comprehensive alpha, beta and delta cell transcriptomes reveal that ghrelin selectively activates delta cells and promotes ...
If one takes a large dose of opioids to compensate for the lack of natural endorphins, the result may be death.[28] ... "The Myth of Alpha Consciousness," Skeptical Inquirer, 10, no. 1 [1985].. *Blackmore, Susan J., Dying to Live : Near-death ... Opioid abuse may result in decreased production of endorphins in the brain, natural pain relievers whose effects may be ...
Synthesis of (+)-4-[(alpha R)-alpha-((2S,5R)-4-allyl-2,5-dimethyl-1-piperazinyl)-3- methoxybenzyl]-N,N-diethylbenzamide (SNC 80 ... Synthesis, opioid receptor binding, and bioassay of the highly selective delta agonist (+)-4-[(alpha R)-alpha-((2S,5R)-4-Allyl- ...
Endorphin E Hazum; KJ Chang; P Cuatrecasas (1979-09-07). "Specific nonopiate receptors for beta-endorphin". Science. 205 (4410 ... α-Endorphin is an endogenous opioid peptide with a length of 16 amino acids, and the amino acid sequence: Tyr-Gly-Gly-Phe-Met- ...
Researchers have been investigating alpha-endorphin since the 1970s, but are still not sure exactly how the polypeptide works ... alpha-Endorphin. Researchers have been investigating alpha-endorphin since the 1970s, but are still not sure exactly how the ... It is known, however, that alpha-endorphin contains 16 amino acids, only one less than gamma-endorphin, from which it may be ... Studies have yet to reveal the exact nature of these changes, but some scientists have suggested that alpha-endorphin may ...
Differentiation of cells producing poly peptide hormones acth msh lipotropic hormone alpha endorphin beta endorphin growth ... Ultrastructural localization of acth beta lipotropin and alpha endorphin and beta endorphin in the porcine anterior pituitary. ... Ultrastructural localization of immuno reactive corticotropin beta lipotropin alpha endorphin and beta endorphin in cells of ... Differentiation of cells producing poly peptide hormones acth msh lipotropic hormone alpha endorphin beta endorphin growth ...
alpha-Endorphin 4.. Chemicals ← Amino Acids, Peptides, and Proteins ← Peptides ← Neuropeptides ← Opioid Peptides ← Endorphins ... alpha-Endorphin 6.. Chemicals ← Amino Acids, Peptides, and Proteins ← Peptides ← Peptide Hormones ← Pituitary Hormones ← ... alpha-Endorphin 5.. Chemicals ← Amino Acids, Peptides, and Proteins ← Peptides ← Peptide Hormones ← Hypothalamic Hormones ← Pro ... alpha-Endorphin 3.. Chemicals ← Amino Acids, Peptides, and Proteins ← Peptides ← Neuropeptides ← Hypothalamic Hormones ← Pro- ...
Pituitary melanotropes release alpha-melanocyte-stimulating hormone (alpha-MSH) and acetylated beta-endorphin (NAc beta-end) ... Opioid beta-endorphin differentially modulated the actions of CRH, as NAc beta-end, but not alpha-MSH, release was inhibited. ... Plasma alpha-MSH and acetylated beta-endorphin levels following stress vary according to CRH sensitivity of the pituitary ... and this correlates with the variability in alpha-MSH and NAc beta-end responses in vivo. Relative rates of alpha-MSH and NAc ...
Report Endorphins-India Market Status and Trend Report 2015-2026 offers a comprehensive analysis on Endorphins industry, ... Alpha-Endorphins Beta-Endorphins Gamma-Endorphins Sigma-Endorphins India Endorphins Market: Application Segment Analysis ( ... 1.1 Definition of Endorphins in This Report. 1.2 Commercial Types of Endorphins. 1.2.1 Alpha-Endorphins. 1.2.2 Beta-Endorphins ... 1.2.3 Gamma-Endorphins. 1.2.4 Sigma-Endorphins. 1.3 Downstream Application of Endorphins. 1.3.1 Institutional Pharmacies. 1.3.2 ...
... alpha-endorphin, a polypeptide with 16 residues or amino acids; beta-endorphin, a polypeptide with 31 residues; gamma-endorphin ... a polypeptide with 17 residues; and sigma-endorphin, a polypeptide with 27 residues. The name endorphin, coined by Choh Li of ... View a second image of a gamma-endorphin.. Early in the 1970s, several small peptides were isolated that appeared to possess ... but exacerbation of the shock condition when beta-endorphin is injected. Endorphin research suggests a link between the ...
To examine the effects of low intensity exercise on beta endorphin (β-Ε) levels and urge for alcohol in alcoholic patients. ... Cronbachs alpha coefficient was .73. Alcoholic patients were young and the medical exam revealed no presence of cardiovascular ... Beta Endorphin and Alcohol Urge Responses in Alcoholic Patients Following an Acute Bout of Exercise Athanasios Z Jamurtas1,2*, ... 2014) Beta Endorphin and Alcohol Urge Responses in Alcoholic Patients Following an Acute Bout of Exercise. J Addict Res Ther 5: ...
Four types of endorphins are created in the human body. They are named alpha (α), beta (β), gamma (γ) and sigma (σ) endorphins ... Beta-endorphins (β-endorphins) are the most powerful endorphins in the body. They are usually in the hypothalamus and pituitary ... Endorphin rush[change , change source]. The term endorphin rush is sometimes used in normal speech to refer to a feeling of ... Endorphins are natural chemicals in the body that fight pain. Endorphins are released when a person gets hurt, but also during ...
alpha-melanocyte-stimulating hormone. *alpha-MSH. *beta-endorphin. *beta-LPH. *beta-melanocyte-stimulating hormone ... Another peptide produced from POMC is β-endorphin. Attachment of β-endorphin to proteins in the brain called opioid receptors ... As a result, there is an absence of the peptides made from POMC, including ACTH, α-MSH, β-MSH, β-endorphin, and sometimes γ-MSH ... Three similar peptides called alpha-, beta-, and gamma-melanocyte stimulating hormones (α-, β-, and γ-MSH) are also cut from ...
... alpha_Endorphin antibody Species Human Format IgG Host Rabbit Polyclonal antibody \ 10741-05011 for more molecular products ... Protein kinase B alpha) (PKB alpha) (Proto-oncogene c-Akt) (RAC-PK-alpha). [Thra C-erba-alpha Nr1a1] Thyroid hormone receptor ... Endorphin antibody Species Human Format IgG Host Rabbit Polyclonal antibody. Related products : alpha_Endorphin antibody ... Endorphin antibody Species Human Format IgG Host Rabbit Polyclonal antibody / Product Detail : 10741-05011 alpha_Endorphin ...
... activity in bovine and rat intermediate pituitaries responsible for the acetylation of beta-endorphin and alpha-melanotropin". ... In enzymology, a peptide alpha-N-acetyltransferase (EC 2.3.1.88) is an enzyme that catalyzes the chemical reaction acetyl-CoA ... ODonohue TL (1983). "Identification of endorphin acetyltransferase in rat brain and pituitary gland". J. Biol. Chem. 258 (4): ... Other names in common use include beta-endorphin acetyltransferase, peptide acetyltransferase, protein N-terminal ...
Alpha-Helical Glycopeptide Analgesics: Beta-Endorphin Mimics with Good in vivo Potency. Peptides: The Wave of the Future. ... It was shown some time ago that the C-terminal region of β-endorphin has an amphipathic α-helical structure that plays a role ... beta-Endorphin. Y-G-G-F-M-T-S-Q-T-P-L-V-T-T-L- ... beta-neo-Endorphin. Y-G-G-F-L-R-K-Y-P. ... In another embodiment, the glycopeptide is a glycosylated endorphin.. The glycopeptide may have the N-terminal sequence Y-a-G-F ...
We incorporate powerful Alpha Waves that naturally allow your mind to reach a state of focus, perfect for studying. Our ... In addition, we use binaural beats (Delta, Alpha and Theta Waves) to naturally reach a state of relaxation perfect for ... Beta Endorphins, Serotonin & Dopamine Boo.... Добавлено: 4 год. Brainwave Power Music 4 год. ... We incorporate powerful Alpha Waves that naturally allow your mind to reach a state of focus, perfect for studying. Our ...
Today, four different classes of endorphins are known, alpha, beta, gamma and delta respectively. Endorphins are synthesised ... Endorphin, the physical substance of positivity. Endorphins are very potent substances produced by the brain and other areas of ... The body produces endorphins which, among other things, give physical and mental wellbeing and positivity, increase ... such as adrenaline and cortisol in addition to also stimulate the production of the aforementioned endorphins, chemicals in the ...
... and synthesis of alpha-endorphin and gamma-endorphin, two peptides of hypothalamic-hypophysial origin with morphinomimetic ... The class of endorphins consists of three endogenous opioid peptides: α-endorphin, β-endorphin, and γ-endorphin.[3] α-endorphin ... The endorphin class consists of α-endorphin, β-endorphin, and γ-endorphin. All three preferentially bind to μ-opioid receptors. ... β-endorphin is the primary endorphin released from the pituitary gland. Endorphin binding at μ-receptors inhibits pain signals ...
alpha-Endorphin (Human) ELISA Kit. Catalog #: E4534 , Datasheet $695.00 Add to Cart. ...
alpha-Endorphin (Human) ELISA Kit. Catalog #: E4534 , Datasheet $695.00 Add to Cart. ...
In addition, TNF-alpha may enhance the excitability of DRG neurons to other stimuli (56). In means of phototherapy, NB-UVB, the ... Endorphin; Structures: SC, Stratum Corneum; ED, Epidermis; D, Dermis; BV, Blood Vessel; DRG, Dorsal root ganglia; SN, Sensory ... TNF-alpha or its receptor, IL-12/23p40, IL-23p19, and IL-17 or its receptors), beside an anti-psoriatic effect also a ... which targets the IL-4-receptor alpha-chain of the heterodimeric IL-4 and IL-13 receptors, and, thus, blocks both IL-4 and IL- ...
Anti-gamma Endorphin antibody conjugated to Biotin validated for IP, ELISA, RIA and tested in Human. Immunogen corresponding to ... only one more than alpha-endorphin. Similar to other endorphins, research focusing upon gamma-endorphin has been ongoing since ... Gamma-endorphin is a polypeptide that is characterized by the presence of 17 amino acids, ... while others suggest that gamma-endorphin may act to help regulate blood pressure. ...
49 Beta-endorphin inhibits production of inflammatory cytokines tumor necrosis factor-alpha and IL-1β as well as MMPs.50 A ... Beta-endorphin. Beta-endorphin is an opioid peptide, endogenously produced, which has analgesic effects similar to morphine. ... Takeba Y, Suzuki N, Kaneko A, Asai T, Sakane T. Endorphin and enkephalin ameliorate excessive synovial cell functions in ... pain reduction with APAP was correlated with a reduction in beta-endorphin plasma levels, but rofecoxib was not.49 ...
Find the best running pants & shorts for men from Saucony. Whether you are off on a training run or stepping up to the starting line, our running shorts are ideally suited for active men.
Sunlight……POMC……..alpha MSH and beta endorphin. Sure, Im guessing the UCA-GLU metabolic pathway is also involved with all ... There was a report in 2014 from an MGH/Harvard team that UV exposure increases beta-endorphin levels in the skin, and that ... Youd have to think that beta-endorphin and glutamate are not going to be the end of it (although those two are powerful enough ...
alpha melanocyte stimulating hormone antibody. *Alpha MSH antibody. *Alpha-MSH antibody. *beta endorphin antibody ...
3. Beta-endorphin. 4. Beta-MSH. 5. ACTH. 6. Alpha-MSH. 7. CLIP ... alpha-MSH, so can bind to its receptors when in excess and ... Alpha receptors: stimulation and constriction of blood vessels, orgasms, pupil dilation, growth. Beta receptors: relaxation and ...
What are endorphins? Endorphins. Endorphins are among the brain chemicals known as neurotransmitters, which function to ... At least 20 types of endorphins have been demonstrated in humans. Endorphins can be found in the pituitary gland, in other ... Α, β, γ, σ endorphin: Alpha endorphins * beta endorphins * gamma endorphins * sigma endorphins * are created in the human body ... Endorphins (Overview) Endorphins are endogenous opioid peptides that function as neurotransmitters. They are produced by the ...
2012). Beta-endorphin antagonizes the effects of alpha-MSH on food intake and body weight. Endocrinology, 153(9), 4246-4255. ... Synthesis of beta-endorphin, ACTH, and alpha-MSH. Existence of POMC-related sequences. Annals of the New York Academy of ... 1979). Concomitant synthesis of beta-endorphin and alpha-melanotropin from two forms of pro-opiomelanocortin in the rat pars ... 1999a). Alpha-melanocyte-stimulating hormone inhibits NF-kappa B activation and I kappa B alpha degradation in human glioma ...
Intracerebroventricular injection of the adrenergic alpha-2-receptor agonist, clonidine, stimulated food intake. ... The present study was designed to investigate the role of brain adrenergic alpha-2-receptors on feeding regulation of layer- ... Receptors, Adrenergic, alpha-2 / agonists, antagonists & inhibitors, physiology*. Yohimbine / pharmacology. beta-Endorphin / ... Adrenergic alpha-Agonists / pharmacology. Adrenergic alpha-Antagonists / pharmacology. Animals. Chickens / physiology*. ...
alpha-melanocyte-stimulating hormone. *pro-ACTH-endorphin. *alpha-MSH. *met-enkephalin. *adrenocorticotropin ...
... alpha-MSH; beta-endorphin; beta-LPH; beta-melanocyte-stimulating hormone; beta-MSH; corticotropin-like intermediary peptide; ... These include several distinct melanotropins, lipotropins, and endorphins that are contained within the adrenocorticotrophin ... Protein Aliases: adrenocorticotropic hormone; adrenocorticotropin; alpha-melanocyte-stimulating hormone; ... Corticotropin-lipotropin; gamma-LPH; gamma-MSH; lipotropin beta; lipotropin gamma; melanotropin alpha; melanotropin beta; ...
  • Since then, scientists have identified and named five different types of endorphins, all of which occur naturally in the body. (wikipedia.org)
  • Four types of endorphins are created in the human body. (wikipedia.org)
  • All three types of endorphins are fragments of the precursor protein proopiomelanocortin (POMC). (wikipedia.org)
  • At least 20 types of endorphins have been demonstrated in humans. (healthtap.com)
  • Twenty different types of endorphins have been discovered in the nervous system. (whatscookingamerica.net)
  • These were names given to distinguish the types of endorphins and may reflect nothing more than elution order out of a column or tissue source. (biology-online.org)
  • Three similar peptides called alpha-, beta-, and gamma-melanocyte stimulating hormones (α-, β-, and γ-MSH) are also cut from the POMC protein. (medlineplus.gov)
  • Early in the 1970s, several small peptides were isolated that appeared to possess natural analgesic properties, and these were collectively termed enkephalins and endorphins . (fsu.edu)
  • The name endorphin, coined by Choh Li of the University of California at Berkeley, refers to "morphine within", and was given to the endogenous morphine-like peptides that also originate from the pituitary hormone. (fsu.edu)
  • These include several distinct melanotropins, lipotropins, and endorphins that are contained within the adrenocorticotrophin and beta-lipotropin peptides. (thermofisher.com)
  • β-Endorphin and [Met]enkephalin are endogenous opioid peptides with widespread actions in the brain. (wikipedia.org)
  • [7] Eric J. Simon , who independently discovered opioid receptors, would later term these peptides endorphins. (wikipedia.org)
  • β-LPH, a pituitary hormone with little opiate activity, is then continually fragmented into different peptides, including α-endorphin, β-endorphin, and γ-endorphin. (wikipedia.org)
  • Endorphins are endogenous opioid peptides that function as neurotransmitters. (healthtap.com)
  • The more technical definition is that endorphins are small chains of peptides that actuate opiate receptors, producing a feeling of well-being. (whatscookingamerica.net)
  • The endorphins or enkephalins are small peptides. (biology-online.org)
  • Such peptides may be produced by the body itself, for example endorphins . (wikipedia.org)
  • High-efficiency synthesis of human alpha-endorphin and magainin in the erythrocytes of transgenic mice: a production system for therapeutic peptides. (labome.org)
  • Endorphins, similar to other endogenous opioid peptides, is sensitive to different stress factors. (usda.gov)
  • The endorphin-IR was further characterized using reversed-phase high-performance liquid chromatography and specific radioimmunoassay systems, and the following peptides were identified: des-tyrosine alpha-endorphin (DTalphaE), alphaE, AcalphaE, gammaE, AcgammaE, betaE-(1-31), AcbetaE-(1-31), AcbetaE-(1-27), AcbetaE-(1-26) and betaE-(1-26)/betaE-(1-27) (the latter peptides were not separated with the high-performance liquid chromatography system used). (eurekamag.com)
  • Plasma alpha-MSH and acetylated beta-endorphin levels following stress vary according to CRH sensitivity of the pituitary melanotropes in common carp, Cyprinus carpio. (ru.nl)
  • Pituitary melanotropes release alpha-melanocyte-stimulating hormone (alpha-MSH) and acetylated beta-endorphin (NAc beta-end) during stress responses. (ru.nl)
  • More endorphins are released in the pituitary gland during times of pain or stress. (wikipedia.org)
  • Endorphins are also involved in the release of sex hormones in the pituitary gland. (wikipedia.org)
  • Endorphins are produced in the pituitary gland . (wikipedia.org)
  • Endorphins are released from the pituitary gland in response to pain and can act in both the central nervous system (CNS) and the peripheral nervous system (PNS). (wikipedia.org)
  • In the PNS, β-endorphin is the primary endorphin released from the pituitary gland . (wikipedia.org)
  • Endorphins can be found in the pituitary gland, in other parts of the brain, or distributed throughout the nervous system. (healthtap.com)
  • The body has endorphins or endogenous morphines released by the pituitary gland in the brain and act as neurotransmitters in our bodies. (healthtap.com)
  • Vertebrates produce endorphins in the pituitary gland and the hypothalamus. (whatscookingamerica.net)
  • Endorphins inhibit the release of gonadotrophin secretion, such as luteinizing hormone (LH) released by the pituitary gland. (usda.gov)
  • Furthermore, endogenous endorphins, as modulators, are involved in the crosstalk between the nervous and immune systems directly or indirectly through the hypothalamic-pituitary-adrenal axis. (usda.gov)
  • To test these hypotheses, we study secretory activity in a number of model cell types, especially in pituitary cells from the anterior and intermediate lobes, which secrete prolactin, beta-endorphin and alpha-melanocyte stimulating hormone. (merlot.org)
  • Massage and hydrotherapy help release endorphins and enkephalins. (fsu.edu)
  • Studies have subsequently distinguished between enkephalins, endorphins, and endogenously produced morphine, [9] [10] which is not a peptide . (wikipedia.org)
  • And by simply increasing the feel-good brain chemicals like endorphins, enkephalins, and serotonin, yoga practitioners just feel better. (8limbsyoga.com)
  • Thus, endorphin is a contraction of 'endo(genous) (mo)rphin' (morphin being the old spelling of morphine). (wikipedia.org)
  • Endorphins are opiod neuropeptides, and they produce a morphine-like reaction in our bodies. (whatscookingamerica.net)
  • In sum, endorphins are natural morphine receptors. (whatscookingamerica.net)
  • Endorphins, alpha-endorphin, beta-endorphin, and gamma-endorphin, are endogenous morphine-like substances with a similar chemical structure and analgesic function as morphine (endorphin is a short term for endogenous morphine). (usda.gov)
  • Another peptide produced from POMC is β-endorphin. (medlineplus.gov)
  • [2] The POMC gene codes for endogenous opioids such as β-endorphin and γ-endorphin . (wikipedia.org)
  • The major hormone produced from POMC is alpha MSH, which stimulates the production of melanin in the melanocyte. (skininc.com)
  • It is known, however, that alpha -endorphin contains 16 amino acids, only one less than gamma -endorphin, from which it may be formed. (fsu.edu)
  • Studies have yet to reveal the exact nature of these changes, but some scientists have suggested that alpha -endorphin may stimulate the brain in a manner similar to amphetamines, while others indicate that gamma -endorphin originates at times from cells of the stomach and may help treat anaphylactic shock and similar conditions. (fsu.edu)
  • It is the 16-amino acid sequence of the N-terminal of BETA-ENDORPHIN and differs from GAMMA-ENDORPHIN by one amino acid (beta-endorphin 1-17). (ctdbase.org)
  • View a second image of a gamma -endorphin. (fsu.edu)
  • Experiments with mice in anaphylactic shock, due to allergic reactions, show significantly improved survival rates with an injection of gamma -endorphin, but exacerbation of the shock condition when beta -endorphin is injected. (fsu.edu)
  • They are named alpha (α), beta (β), gamma (γ) and sigma (σ) endorphins. (wikipedia.org)
  • Alpha endorphins * beta endorphins * gamma endorphins * sigma endorphins * are created in the human body. (healthtap.com)
  • hello, i'm doing a project on endorphins and have had a lot of trouble finding specific information on the levels of molecular structure (primary, secondary etc..) even when i've narrowed down my searches to specific alpha-,beta-,gamma- queries, i've been unable to find anything. (biology-online.org)
  • 8799185 ). Agonist binding to the receptor induces coupling to an inactive GDP-bound heterotrimeric G-protein complex and subsequent exchange of GDP for GTP in the G-protein alpha subunit leading to dissociation of the G-protein complex with the free GTP-bound G-protein alpha and the G-protein beta-gamma dimer activating downstream cellular effectors. (uniprot.org)
  • Treatment with haloperidol increased, and with bromocriptine decreased the tissue content and the release of N(alpha)-acetyl-, beta-, gamma- and alpha-endorphin-immunoreactivity (AcE-, betaE-, gammaE, and alphaE-IR). (eurekamag.com)
  • Regular intense exercise may cause the brain to downregulate the production of endorphins in periods of rest to maintain homeostasis , causing a person to exercise more intensely in order to receive the same feeling. (wikipedia.org)
  • The body's natural production of endorphins is likely to be what? (healthtap.com)
  • Other names in common use include beta-endorphin acetyltransferase, peptide acetyltransferase, protein N-terminal acetyltransferase, NAT, Nalpha-acetyltransferase, amino-terminal amino acid-acetylating enzyme, and acetyl-CoA:peptide alpha-N-acetyltransferase. (wikipedia.org)
  • Endorphins may also produce a feeling of euphoria very similar to that produced by other opioids . (wikipedia.org)
  • Receptor for endogenous opioids such as beta-endorphin and endomorphin. (uniprot.org)
  • Alpha brain waves allow for increased release of an important neurotransmitter called serotonin, which can help combat depression . (livestrong.com)
  • Neurochemicals associated with pleasure and performance - endorphin, serotonin, dopamine, norepinephrine and anandamide - are the raw ingredients of flow. (suunto.com)
  • A large body of evidence indicates a major role for the dynorphin/alpha-neo-endorphin kappa opioid receptor as one of the receptors involved in feeding modulation. (nih.gov)
  • The precursor does not contain the sequences of dynorphin, alpha-neo-endorphin or beta-endorphin. (neuromics.com)
  • Because of structural similarities it had been postulated that beta-endorphin is precursor of Met-enkephalin, and that dynorphin or alpha-neo-endorphin is precursor of Leu-enkephalin. (neuromics.com)
  • Attachment of β-endorphin to proteins in the brain called opioid receptors stimulates signaling for pain relief. (medlineplus.gov)
  • All of the endorphins bind to the opioid receptors in the brain. (wikipedia.org)
  • [17] Laughter may also stimulate endorphin production and elevate one's pain threshold . (wikipedia.org)
  • The wonderful healthful properties of Capsaicin stem from its ability to stimulate an endorphin reaction. (whatscookingamerica.net)
  • Reduce pain, promote euphoria and stimulate the release of endorphins. (ironmanmagazine.com)
  • Exercise increases the endorphin release too. (wikipedia.org)
  • There was a report in 2014 from an MGH/Harvard team that UV exposure increases beta-endorphin levels in the skin, and that group showed that rodents can apparently become addicted to sunbathing through this effect. (sciencemag.org)
  • Professionally significant enhancement of music and dance performance and mood has followed training with an EEG-neurofeedback protocol which increases the ratio of theta to alpha waves using auditory feedback with eyes closed. (springer.com)
  • Chronic opiate administration decreases body weight and autosensitization of beta-endorphin increases body weight. (nih.gov)
  • Music stimulation increases endorphin release, decreasing the need for medication, according to the Austin Medical Center & Harvard University Medical School. (wisdom-magazine.com)
  • The main function of endorphins is to inhibit the communication of pain signals. (wikipedia.org)
  • That's because your brain produces more beta-endorphin, noroepinephrine and dopamine - hormones linked to memory formation and feelings of mental clarity . (livestrong.com)
  • Intracerebroventricular injection of the adrenergic alpha-2-receptor agonist, clonidine, stimulated food intake. (biomedsearch.com)
  • This effect was blocked by co-injection of the alpha-2-receptor antagonist, yohimbine, demonstrating that the alpha-2-receptor is related to stimulation of feeding in layer-type chicks. (biomedsearch.com)
  • Obviously the functional tertiary structure of an endorphin is in the ligand-receptor complex. (biology-online.org)
  • G-protein coupled opioid receptor that functions as receptor for endogenous alpha-neoendorphins and dynorphins, but has low affinity for beta-endorphins. (rcsb.org)
  • By using retrograde-tracing techniques combined with dual-labeling immunocytochemistry, we show here that distinct populations of estrogen receptor alpha (ERalpha)-containing neurons located in the hypothalamus and caudal brainstem project to the vicinity of the GnRH perikarya located in the rostral preoptic area (rPOA). (nih.gov)
  • Endorphins (contracted from " endo genous mo rphin e" [1] [2] ) are endogenous opioid neuropeptides and peptide hormones in humans and other animals. (wikipedia.org)
  • The main difference between the natural endorphins and the analgesic drugs is that natural endorphins are cleared from the blood very quickly. (wikipedia.org)
  • The placebo effect is also attributed to endorphin and enkephalin releases, explaining the emotional component of receiving a sugar pill. (fsu.edu)
  • GENTAUR suppliers human normal cells, cell lines, RNA extracts and lots of antibodies and ELISA kits to Human proteins as well as alpha_Endorphin antibody Species Human Format IgG Host Rabbit Polyclonal antibody. (antibody-antibodies.com)
  • 29 Endorphin beta (beta-EP) ELISA Kits from 5 manufacturers are available on www.antibodies-online.com. (antibodies-online.com)
  • Music played before anesthesia caused higher production of alpha waves (indicating deeper relaxation), decreases in the stress hormones cortisol. (wisdom-magazine.com)
  • For example, endorphin release is responsible for producing the euphoric state in cases such as runner's high, sex , orgasm , listening to music, and eating appetizing food such as chocolate . (wikipedia.org)
  • β-endorphin release contributes to a phenomenon known as a " runner's high . (wikipedia.org)
  • Generally, endorphin reactions only come from intense physical activity (i.e. the runner's high or the high from sexual activity). (whatscookingamerica.net)
  • Specifically, getting a "runner's high" or a "second wind" or the blissful feelings one gets after sex are related to increased endorphin production. (whatscookingamerica.net)
  • Here, we show that also within a species, the common carp (Cyprinus carpio), fish sometimes respond with elevated alpha-MSH and NAc beta-end plasma levels, and at other times not. (ru.nl)
  • The origin of this variable response was investigated by (1) studying the effects of corticotropin-releasing hormone (CRH) on alpha-MSH and NAc beta-end release in vitro, (2) establishing where in the second messenger pathway coupled to CRH receptors melanotrope responsiveness is determined, and (3) testing modulatory actions of other hypothalamic factors (here opioid beta-endorphin). (ru.nl)
  • Melanotropes were in a high or low responsive state to CRH in vitro, which was especially evident when tissue was tested from fish kept at higher ambient water temperatures, and this correlates with the variability in alpha-MSH and NAc beta-end responses in vivo. (ru.nl)
  • Relative rates of alpha-MSH and NAc beta-end release following stimulation with CRH in vitro match plasma level changes in vivo, and this indicates that the CRH pathway does act in vivo. (ru.nl)
  • Opioid beta-endorphin differentially modulated the actions of CRH, as NAc beta-end, but not alpha-MSH, release was inhibited. (ru.nl)
  • Objective: To examine the effects of low intensity exercise on beta endorphin (β-Ε) levels and urge for alcohol in alcoholic patients. (omicsonline.org)
  • Alpha-Helical Glycopeptide Analgesics: Beta-Endorphin Mimics with Good in vivo Potency. (freepatentsonline.com)
  • Glycopeptides Related to Beta-Endorphin Adopt Helical Amphipathic Conformations in the Presence of Lipid Bilayers. (freepatentsonline.com)
  • Beta-endorphins (β-endorphins) are the most powerful endorphins in the body. (wikipedia.org)
  • You'd have to think that beta-endorphin and glutamate are not going to be the end of it (although those two are powerful enough for plenty of effects). (sciencemag.org)
  • Stimulation of food intake caused by neuropeptide Y and beta-endorphin was attenuated by co-injection with yohimbine. (biomedsearch.com)
  • It is therefore likely that brain adrenergic alpha-2-receptors mediate the orexigenic effects of neuropeptide Y and beta-endorphin in layer-type chicks. (biomedsearch.com)
  • Alpha-theta brainwave training and beta-endorphin levels in alcoholics. (aapb.org)
  • If you are referring to things like alpha- or beta-endorphin, that has little to do with the structure of the endorphins. (biology-online.org)
  • published a couple of papers on tertiary structure of camel beta-endorphin (CBE). (biology-online.org)
  • Beta-endorphin Monoclonal antibody specifically detects Beta-endorphin in Human samples. (fishersci.com)
  • 28 Endorphin beta (beta-EP) Antikörper von 8 Herstellern verfügbar auf www.antikoerper-online.de. (antikoerper-online.de)
  • Brain waves change from beta, more rapid waves underlying waking consciousness, to somewhere between alpha and theta waves, where we daydream and first enter into sleep. (suunto.com)
  • Sound can entrain our brain waves, taking them to alpha, beta, theta and delta ranges. (wisdom-magazine.com)
  • Approximately 50% of arcuate nucleus neurons projecting to the rPOA were demonstrated to synthesize either neuropeptide Y or beta-endorphin, but little evidence was found for ERalpha immunoreactivity in either of these specific subpopulations. (nih.gov)
  • Endorphins are natural chemicals in the body that fight pain . (wikipedia.org)
  • Endorphins are among the brain chemicals known as neurotransmitters, which function to transmit electrical signals within the nervous system. (healthtap.com)
  • Is there something that mimics the feelings that endorphins give? (healthtap.com)
  • Reports indicate that acute exposure to ethanol leads to an enhanced release of brain β-endorphin (β-E) which through its interaction with μ and δ receptors mediates, at least in part, neurobehavioral effects such as reinforcement and acquisition of ethanol drinking behavior [ 5 ]. (omicsonline.org)
  • [1] Endorphins are three compounds which bind to receptors. (wikipedia.org)
  • Role of adrenergic alpha-2-receptors on feeding behavior in layer-type chicks. (biomedsearch.com)
  • The present study was designed to investigate the role of brain adrenergic alpha-2-receptors on feeding regulation of layer-type chicks. (biomedsearch.com)
  • While originally the protocol was designed to induce hypnogogia, a state historically associated with creativity, the outcome was psychological integration, while subsequent applications focusing on raising the theta-alpha ratio, reduced depression and anxiety in alcoholism and resolved post traumatic stress syndrome (PTSD). (springer.com)
  • Researchers have been investigating alpha -endorphin since the 1970s, but are still not sure exactly how the polypeptide works or how it specifically affects the body. (fsu.edu)
  • They mediate an array of downstream cellular responses, including inhibition of adenylate cyclase activity and both N-type and L-type calcium channels, activation of inward rectifying potassium channels, mitogen-activated protein kinase (MAPK), phospholipase C (PLC), phosphoinositide/protein kinase (PKC), phosphoinositide 3-kinase (PI3K) and regulation of NF-kappa-B. Also couples to adenylate cyclase stimulatory G alpha proteins. (uniprot.org)
  • In addition, endogenous endorphins act within the brain to mediate reproductive function. (usda.gov)
  • [4] Also, scientists think that acupuncture results in the release of more endorphins. (wikipedia.org)
  • It is commonly said that the "high" is a result of the release of bigger amounts of endorphins in the body during the exercise. (wikipedia.org)
  • However, some scientists think this feeling is caused by the challenge , and is not related to endorphin release. (wikipedia.org)
  • it means this feeling is not caused by the release of endorphins in the blood. (wikipedia.org)
  • [12] [17] Research has demonstrated that meditation by trained individuals can be used to trigger endorphin release. (wikipedia.org)
  • Does singing release endorphins? (healthtap.com)
  • What causes the release of endorphins in the body? (healthtap.com)
  • What could cause someone's body to not release endorphins? (healthtap.com)
  • In addition, an as yet unidentified acetylated IR-endorphin component was found which was not observed in extracts of NIL tissue, and therefore was probably formed during release. (eurekamag.com)
  • and sigma -endorphin, a polypeptide with 27 residues. (fsu.edu)
  • Endorphins are released when a person gets hurt, but also during exercise , laughter or sex . (wikipedia.org)
  • The other physical activities producing endorphins are yoga, laughter, exercise and acupuncture. (whatscookingamerica.net)
  • alpha_Endorphin antibody Species Human Format IgG Host Rabbit Polyclonal antibody antibody storage GENTAUR recommends for long therm storage to freeze at -24 C. For short time storage up to 30 days we suggest fridge storage at 1 to 10 C. Prevent multiple freeze taw cycles of alpha_Endorphin antibody Species Human Format IgG Host Rabbit Polyclonal antibody. (antibody-antibodies.com)
  • alpha_Endorphin antibody Species Human Format IgG Host Rabbit Polyclonal antibody rabbit polyclonal These antibodies are very stable and can be stored up to 2 months at fridge temperature under 10C. (antibody-antibodies.com)
  • Do not freeze taw, rather use alpha_Endorphin antibody Species Human Format IgG Host Rabbit Polyclonal antibody from the fridge if your use is less than 1 or 2 weeks. (antibody-antibodies.com)
  • alpha_Endorphin antibody Species Human Format IgG Host Rabbit Polyclonal antibody Human samples 80 % of the research is conducted on human samples. (antibody-antibodies.com)
  • Aftanas LI, Golocheikine SA (2001) Human anterior and frontal midline theta and lower alpha reflect emotionally positive state and internalized attention: high-resolution EEG investigation of meditation. (springer.com)
  • KLH-conjugated synthetic peptide encompassing a sequence within the C-term region of human SIRP alpha. (abbiotec.com)
  • Endorphins play a major role in the body's inhibitory response to pain. (wikipedia.org)
  • In addition, we use binaural beats (Delta, Alpha and Theta Waves) to naturally reach a state of relaxation perfect for concentration, meditation or deep sleep. (mp3real.ru)
  • For example, meditation will increase endorphins as will listening to certain types of music or just relaxing at a quite lake in the mountains. (healthtap.com)
  • If you've ever practiced meditation , yoga or even felt relaxed after a glass (or two) of wine, you've experienced alpha brain waves. (livestrong.com)
  • Meditation will get you into the alpha brainwave state fairly quickly after some practice (provided you know what you're doing). (livestrong.com)
  • If you make meditation a daily practice or start up a routine, you will be able to tap into that alpha state. (livestrong.com)
  • You can expect the alpha meditation musical piece to help with stress reduction, curing insomnia, dealing with ADD, improving memory, increasing IQ and learning ability, increasing concentration, working with affirmations and imagery. (worldofalternatives.com)
  • We incorporate powerful Alpha Waves that naturally allow your mind to reach a state of focus, perfect for studying. (mp3real.ru)
  • Working memory and meditative bliss, representing cognitive and affective domains, respectively, involve coupling between frontal and posterior cortices, exemplify a role for theta and alpha waves in mediating the interaction between distal and widely distributed connections. (springer.com)
  • Alpha brain waves means you're in a deep state of relaxation while still being conscious. (livestrong.com)
  • What Are Alpha Brain Waves? (livestrong.com)
  • Alpha brain waves are a sign of relaxed activity in your brain. (livestrong.com)
  • Your alpha waves are responsible for amping up your immune system. (livestrong.com)
  • Conversely, if you feel that your creativity is lacking, an increase in your alpha waves will feel great. (livestrong.com)
  • Alpha waves integrate both hemispheres of your brain for better communication and clearer thinking. (livestrong.com)
  • Every time you close your eyes and attempt to visualize, your alpha brain waves increase profoundly. (livestrong.com)
  • If you're able to focus on pictures in your mind or using your imagination to create pictures, you can access alpha brain waves. (livestrong.com)
  • The real question is, is there a natural way to train your brain to tune in to these most beneficial alpha/theta brain waves? (ironmanmagazine.com)
  • In the 1960s, he conducted science and research to study the relationship between the earth's natural frequency and the same exact 7.83 Hz frequency of our alpha brain waves. (ironmanmagazine.com)
  • Can we tap into the Schumann Resonance to entrain our own brain waves to stay on this alpha/theta channel, to reap these bountiful mental and physical health benefits? (ironmanmagazine.com)
  • Study Music Alpha Waves: Relaxing Studying Music, Brain Power, Focus Concentration Music, ☯161 - YellowBrickCinema's Study Music & Concentration Music is ideal background music to help you to study, concentrate, focus and work more effectively. (wn.com)
  • Our Studying Music for concentration uses alpha waves and binaural beats to boost concentration and brain power, and is the ideal relaxing music for stress relief. (wn.com)
  • Yoga has also been found to increase alpha and theta waves in the brain, meaning that yoga can relax the brain and increase access to the subconscious and emotions. (8limbsyoga.com)
  • LPH [lipotropic hormone], .alpha. (eurekamag.com)
  • 2007). Peripheral effect of alpha-melanocyte-stimulating hormone on fatty acid oxidation in skeletal muscle. (springer.com)
  • Four distinct groups of endorphins have been identified to date. (fsu.edu)