alpha-Amylases: Enzymes that catalyze the endohydrolysis of 1,4-alpha-glycosidic linkages in STARCH; GLYCOGEN; and related POLYSACCHARIDES and OLIGOSACCHARIDES containing 3 or more 1,4-alpha-linked D-glucose units.Calcium Carbonate: Carbonic acid calcium salt (CaCO3). An odorless, tasteless powder or crystal that occurs in nature. It is used therapeutically as a phosphate buffer in hemodialysis patients and as a calcium supplement.Polymers: Compounds formed by the joining of smaller, usually repeating, units linked by covalent bonds. These compounds often form large macromolecules (e.g., BIOPOLYMERS; PLASTICS).Hydrochloric Acid: A strong corrosive acid that is commonly used as a laboratory reagent. It is formed by dissolving hydrogen chloride in water. GASTRIC ACID is the hydrochloric acid component of GASTRIC JUICE.Engraving and EngravingsStarch: Any of a group of polysaccharides of the general formula (C6-H10-O5)n, composed of a long-chain polymer of glucose in the form of amylose and amylopectin. It is the chief storage form of energy reserve (carbohydrates) in plants.Rare BooksAggression: Behavior which may be manifested by destructive and attacking action which is verbal or physical, by covert attitudes of hostility or by obstructionism.Gas, Natural: A combustible, gaseous mixture of low-molecular weight PARAFFIN hydrocarbons, generated below the surface of the earth. It contains mostly METHANE and ETHANE with small amounts of PROPANE; BUTANES; and higher hydrocarbons, and sometimes NITROGEN; CARBON DIOXIDE; HYDROGEN SULFIDE; and HELIUM. (from McGraw-Hill Dictionary of Scientific and Technical Terms, 6th ed)Water Wells: Constructions built to access underground water.Tribolium: A genus of small beetles of the family Tenebrionidae; T. confusum is the "confused flour beetle".Beetles: INSECTS of the order Coleoptera, containing over 350,000 species in 150 families. They possess hard bodies and their mouthparts are adapted for chewing.Insect Proteins: Proteins found in any species of insect.Methoprene: Juvenile hormone analog and insect growth regulator used to control insects by disrupting metamorphosis. Has been effective in controlling mosquito larvae.Juvenile Hormones: Compounds, either natural or synthetic, which block development of the growing insect.Flour: Ground up seed of WHEAT.Molting: Periodic casting off FEATHERS; HAIR; or cuticle. Molting is a process of sloughing or desquamation, especially the shedding of an outer covering and the development of a new one. This phenomenon permits growth in ARTHROPODS, skin renewal in AMPHIBIANS and REPTILES, and the shedding of winter coats in BIRDS and MAMMALS.Hymenolepiasis: Infection with tapeworms of the genus Hymenolepis.Pupa: An inactive stage between the larval and adult stages in the life cycle of insects.Salivary alpha-Amylases: A subclass of alpha-amylase ISOENZYMES that are secreted into SALIVA.Glucagon-Secreting Cells: A type of pancreatic cell representing about 5-20% of the islet cells. Alpha cells secrete GLUCAGON.Amylases: A group of amylolytic enzymes that cleave starch, glycogen, and related alpha-1,4-glucans. (Stedman, 25th ed) EC 3.2.1.-.Sialorrhea: Increased salivary flow.Glucagon: A 29-amino acid pancreatic peptide derived from proglucagon which is also the precursor of intestinal GLUCAGON-LIKE PEPTIDES. Glucagon is secreted by PANCREATIC ALPHA CELLS and plays an important role in regulation of BLOOD GLUCOSE concentration, ketone metabolism, and several other biochemical and physiological processes. (From Gilman et al., Goodman and Gilman's The Pharmacological Basis of Therapeutics, 9th ed, p1511)Saliva: The clear, viscous fluid secreted by the SALIVARY GLANDS and mucous glands of the mouth. It contains MUCINS, water, organic salts, and ptylin.Iridoid Glycosides: A subclass of iridoid compounds that include a glycoside moiety, usually found at the C-1 position.Proglucagon: The common precursor polypeptide of pancreatic GLUCAGON and intestinal GLUCAGON-LIKE PEPTIDES. Proglucagon is the 158-amino acid segment of preproglucagon without the N-terminal signal sequence. Proglucagon is expressed in the PANCREAS; INTESTINES; and the CENTRAL NERVOUS SYSTEM. Posttranslational processing of proglucagon is tissue-specific yielding numerous bioactive peptides.Molecular Sequence Data: Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.Capnocytophaga: A gram-negative gliding bacterium isolated from the oral cavity. It is a pathogen often causing PERIODONTITIS.Cytophagaceae: A family of gram-negative, gliding bacteria in the order Cytophagales, class Cytophagia. They are found in SOIL and SEA WATER.Catalytic Domain: The region of an enzyme that interacts with its substrate to cause the enzymatic reaction.Gram-Negative Bacterial Infections: Infections caused by bacteria that show up as pink (negative) when treated by the gram-staining method.Emetics: Agents that cause vomiting. They may act directly on the gastrointestinal tract, bringing about emesis through local irritant effects, or indirectly, through their effects on the chemoreceptor trigger zone in the postremal area near the medulla.Heart Failure: A heterogeneous condition in which the heart is unable to pump out sufficient blood to meet the metabolic need of the body. Heart failure can be caused by structural defects, functional abnormalities (VENTRICULAR DYSFUNCTION), or a sudden overload beyond its capacity. Chronic heart failure is more common than acute heart failure which results from sudden insult to cardiac function, such as MYOCARDIAL INFARCTION.Biological Markers: Measurable and quantifiable biological parameters (e.g., specific enzyme concentration, specific hormone concentration, specific gene phenotype distribution in a population, presence of biological substances) which serve as indices for health- and physiology-related assessments, such as disease risk, psychiatric disorders, environmental exposure and its effects, disease diagnosis, metabolic processes, substance abuse, pregnancy, cell line development, epidemiologic studies, etc.Natriuretic Peptide, Brain: A PEPTIDE that is secreted by the BRAIN and the HEART ATRIA, stored mainly in cardiac ventricular MYOCARDIUM. It can cause NATRIURESIS; DIURESIS; VASODILATION; and inhibits secretion of RENIN and ALDOSTERONE. It improves heart function. It contains 32 AMINO ACIDS.Circadian Rhythm: The regular recurrence, in cycles of about 24 hours, of biological processes or activities, such as sensitivity to drugs and stimuli, hormone secretion, sleeping, and feeding.Beer: An alcoholic beverage usually made from malted cereal grain (as barley), flavored with hops, and brewed by slow fermentation.International System of Units: A system of physical units in which the fundamental quantities are length, time, mass, electric current, temperature, luminous intensity, and amount of substance, and the corresponding units are the meter, second, kilogram, ampere, kelvin, candela, and mole. The system has been given official status and recommended for universal use by the General Conference on Weights and Measures.Wine: Fermented juice of fresh grapes or of other fruit or plant products used as a beverage.History, 16th Century: Time period from 1501 through 1600 of the common era.History, 17th Century: Time period from 1601 through 1700 of the common era.

Inhibition of plant-pathogenic fungi by a corn trypsin inhibitor overexpressed in Escherichia coli. (1/1178)

The cDNA of a 14-kDa trypsin inhibitor (TI) from corn was subcloned into an Escherichia coli overexpression vector. The overexpressed TI was purified based on its insolubility in urea and then refolded into the active form in vitro. This recombinant TI inhibited both conidium germination and hyphal growth of all nine plant pathogenic fungi studied, including Aspergillus flavus, Aspergillus parasiticus, and Fusarium moniliforme. The calculated 50% inhibitory concentration of TI for conidium germination ranged from 70 to more than 300 microgram/ml, and that for fungal growth ranged from 33 to 124 microgram/ml depending on the fungal species. It also inhibited A. flavus and F. moniliforme simultaneously when they were tested together. The results suggest that the corn 14-kDa TI may function in host resistance against a variety of fungal pathogens of crops.  (+info)

Insertion analysis of putative functional elements in the promoter region of the Aspergillus oryzae Taka-amylase A gene (amyB) using a heterologous Aspergillus nidulans amdS-lacZ fusion gene system. (2/1178)

Expression of the Taka-amylase A gene (amyB) of Aspergillus oryzae is induced by starch or maltose. The A. oryzae amyB gene promoter contains three highly conserved sequences, designated Regions I, II, and III, compared with promoter regions of the A. oryzae glaA encoding glucoamylase and the agdA encoding alpha-glucosidase. To identify the function of these sequences within the amyB promoter, various fragments containing conserved sequences in the amyB promoter were introduced into the upstream region of the heterologous A. nidulans amdS gene (encoding acetamidase) fused to the Escherichia coli lacZ gene as a reporter. Introduction of the sequence between -290 to -233 (the number indicates the distance in base pairs from the translation initiation point (+1)) containing Region III significantly increased the expression of the lacZ reporter gene in the presence of maltose. The sequence between -377 to -290 containing Region I also increased the lacZ activity, but its maltose inducibility was less than that of Region III. The sequence between -233 to -181 containing Region II had no effect on the expression. These results indicated that Region III is most likely involved in the maltose induction of the amyB gene expression.  (+info)

Overexpression of BiP in tobacco alleviates endoplasmic reticulum stress. (3/1178)

To study the role of the lumenal binding protein (BiP) in the transport and secretion of proteins, we have produced plants with altered BiP levels. Transgenic plants overexpressing BiP showed dramatically increased BiP mRNA levels but only a modest increase in BiP protein levels. The presence of degradation products in BiP overproducers suggests a regulatory mechanism that increases protein turnover when BiP is abundant. Antisense inhibition of BiP synthesis was not successful, demonstrating that even a minor reduction in the basal BiP level is deleterious to cell viability. Overexpression of BiP leads to downregulation of the basal transcript levels of endogenous BiP genes and greatly reduces the unfolded protein response. The data confirm that BiP transcription is regulated via a feedback mechanism that involves monitoring of BiP protein levels. To test BiP activity in vivo, we designed a functional assay, using the secretory protein alpha-amylase and a cytosolic enzyme as a control for cell viability. During tunicamycin treatment, an overall reduction of alpha-amylase synthesis was observed when compared with the cytosolic marker. We show that the tunicamycin effect is due to the depletion of BiP in the endoplasmic reticulum because coexpressed BiP alone is able to restore efficient alpha-amylase synthesis. This is a novel assay to monitor BiP activity in promoting secretory protein synthesis in vivo.  (+info)

Differential dependence of levansucrase and alpha-amylase secretion on SecA (Div) during the exponential phase of growth of Bacillus subtilis. (4/1178)

SecA, the translocation ATPase of the preprotein translocase, accounts for 0.25% of the total protein in a degU32(Hy) Bacillus subtilis strain in logarithmic phase. The SecA level remained constant irrespective of the demand for exoprotein production but dropped about 12-fold during the late stationary phase. Modulation of the level of functional SecA during the exponential phase of growth affected differently the secretion of levansucrase and alpha-amylase overexpressed under the control of the sacB leader region. The level of SecA was reduced in the presence of sodium azide and in the div341 thermosensitive mutant at nonpermissive temperatures. Overproduction of SecA was obtained with a multicopy plasmid bearing secA. The gradual decrease of the SecA level reduced the yield of secreted levansucrase with a concomitant accumulation of unprocessed precursor in the cells, while an increase in the SecA level resulted in an elevation of the production of exocellular levansucrase. In contrast, alpha-amylase secretion was almost unaffected by high concentrations of sodium azide or by very low levels of SecA. Secretion defects were apparent only under conditions of strong SecA deprivation of the cell. These data demonstrate that the alpha-amylase and levansucrase precursors markedly differ in their dependency on SecA for secretion. It is suggested that these precursors differ in their binding affinities for SecA.  (+info)

Genetic regulation of tissue-specific expression of amylase structural genes in Drosophila melanogaster. (5/1178)

Laboratory strains of Drosophila melanogaster were screened for spatial variations in adult midgut alpha-amylase (1,4-alpha-D-glucan glucanohydrolase, EC 3.2.1.1) expression. No strain-specific differences were found anteriorly, but three patterns of activity were discerned in the posterior midgut: A, activity throughout most of the region; B, activity in the anterior part of the region; and C, little or no activity. Alleles of a control gene, map, are responsible for this tissue-specific regulation of activity; e.g., mapA homozygotes produce the A pattern and mapC homozygotes the C pattern. The map locus was placed at 2--80 +/- on the genetic map of chromosome 2R, about two crossover units distal to the Amy structural gene region for alpha-amylase. Electrophoretic studies showed that mapA is trans acting in mapA/mapC flies, allowing expression of amylase isozymes coded for by genes on the opposite chromosome. The map gene behaves as a temporal gene that is clearly separable from the tightly linked, duplicated Amy structural genes.  (+info)

Molecular cloning and primary structure analysis of porcine pancreatic alpha-amylase. (6/1178)

A cDNA library was constructed in a Uni-ZAP XR vector using mRNA isolated from porcine pancreas. A full-length alpha-amylase cDNA was obtained using a combination of library screening and nested polymerase chain reaction. Sequencing of the clone revealed a 1536-nucleotide (nt) open reading frame encoding a protein of 496 amino acid (aa) residues with a signal peptide of 15 aa. The calculated molecular mass of the enzyme was 55354 Da, in accordance with those of the purified porcine pancreatic alpha-amylase forms (PPAI and PPAII) as determined by mass spectrometry. A comparison of the deduced aa sequence with published peptidic sequences of PPAI identified a number of mismatches. The sequence of the cDNA reported here provides a sequence reference for PPA in excellent agreement with the refined three-dimensional structures of both PPAI and PPAII. No evidence for a second variant was found in the cDNA library and it is most likely that PPAI and PPAII are two forms of the same protein. The primary structure of PPA shows high homology with human, mouse and rat pancreatic alpha-amylases. The 304-310 region, corresponding to a mobile loop involved in substrate binding and processing near the active site, is fully conserved.  (+info)

Cloning, mutagenesis, and structural analysis of human pancreatic alpha-amylase expressed in Pichia pastoris. (7/1178)

Human pancreatic alpha-amylase (HPA) was expressed in the methylotrophic yeast Pichia pastoris and two mutants (D197A and D197N) of a completely conserved active site carboxylic acid were generated. All recombinant proteins were shown by electrospray ionization mass spectrometry (ESI-MS) to be glycosylated and the site of attachment was shown to be Asn461 by peptide mapping in conjunction with ESI-MS. Treatment of these proteins with endoglycosidase F demonstrated that they contained a single N-linked oligosaccharide and yielded a protein product with a single N-acetyl glucosamine (GlcNAc), which could be crystallized. Solution of the crystal structure to a resolution of 2.0 A confirmed the location of the glycosyl group as Asn461 and showed that the recombinant protein had essentially the same conformation as the native enzyme. The kinetic parameters of the glycosylated and deglycosylated wild-type proteins were the same while the k(cat)/Km values for D197A and D197N were 10(6)-10(7) times lower than the wild-type enzyme. The decreased k(cat)/Km values for the mutants confirm that D197 plays a crucial role in the hydrolytic activity of HPA, presumably as the catalytic nucleophile.  (+info)

Chemical modification of lysine side chains of cyclodextrin glycosyltransferase from Thermoanaerobacter causes a shift from cyclodextrin glycosyltransferase to alpha-amylase specificity. (8/1178)

Cyclodextrin glycosyltransferases and alpha-amylases are two groups of enzymes with related secondary structures. However, cyclodextrin glycosyltransferases display transferase activities not present in alpha-amylases, probably derived from the existence of two more domains and different amino acid sequences. The hydrolytic activity of cyclodextrin glycosyltransferases is generally quite low, except for two cyclodextrin glycosyltransferases from termophiles. In this work, we have carried out the chemical modification (with acetic anhydride) of the amino groups of cyclodextrin glycosyltransferase from Thermoanaerobacter to assess their contributions to protein function. The acetylated cyclodextrin glycosyltransferase showed a significant reduction of its cyclization, coupling and disproportionation activities. Surprisingly, the hydrolytic (saccharifying) activity was slightly enhanced. These results suggest the participation of one or more lysine side chains in the interactions contributing to the transferase activity, either in any of the S11 subsites or in the acceptor binding site.  (+info)

*Saliva testing

Subsequent findings reveal a relationship between α-amylase and competition. Results showed that alpha amylase levels changed ... Alpha amylase, on the other hand, spikes quickly when confronted with a stressor and returns to baseline soon after the stress ... Alpha amylase levels in saliva provide a non-invasive way to examine sympathoadrenal medullary (SAM) activity, which can ... Salivary alpha amylase levels have been found to correlate with heightened autonomic nervous system activity levels, reacting ...

*Alpha-amylase

The alpha-Amylase Protein alpha-Amylase at the US National Library of Medicine Medical Subject Headings (MeSH) This article ... α-Amylase is a protein enzyme EC 3.2.1.1 that hydrolyses alpha bonds of large, alpha-linked polysaccharides, such as starch and ... See amylase for more uses of the amylase family in general. α-Amylase has exhibited efficacy in degrading polymicrobial ... Medical laboratories will usually measure either pancreatic amylase or total amylase. If only pancreatic amylase is measured, ...

*Alpha amylase inhibitor

In molecular biology, alpha-amylase inhibitor is a protein family which inhibits mammalian alpha-amylases specifically, by ... 1 complex with alpha-amylase. This family of inhibitors has no action on plant and microbial alpha amylases. A crystal ... The binding of tendamistat to alpha-amylase leads to the steric blockage of the active site of the enzyme. The crystal ... König V, Vértesy L, Schneider TR (October 2003). "Structure of the alpha-amylase inhibitor tendamistat at 0.93 A". Acta ...

*Plant defensin

Richardson M, Bloch Jr C (1991). "A new family of small (5 kDa) protein inhibitors of insect alpha-amylases from seeds or ... Inhibitors of insect alpha-amylases from sorghum. Probable protease inhibitor P322 from Solanum tuberosum (Potato). A ... This structure differs from that of the plant alpha- and beta-thionins, but is analogous to scorpion toxins and insect ... Three disulfide bridges are located in the hydrophobic core between the helix and sheet, forming a cysteine-stabilised alpha- ...

*Exoenzyme

Organisms can either by alpha-hemolytic, beta-hemolytic, or gamma-hemolytic (non-hemolytic). Amylases are a group of ... The different classes of amylases are α-amylases, β-amylases, and glucoamylases. The α-amylases hydrolyze starch by randomly ... Sharma A, Satyanarayana T (2013). "Microbial acid-stable alpha-amylases: Characteristics, genetic engineering and applications ... In humans, amylases are secreted by both the pancreas and salivary glands with both sources of the enzyme required for complete ...

*Edmond H. Fischer

Fischer worked on alpha-amylase. After his PhD, Fischer went to the United States in 1950 for postdoctoral research. He was ...

*Starch

Alpha-amylases are found in plants and in animals. Human saliva is rich in amylase, and the pancreas also secretes the enzyme. ... This process is important in the digestion of starch and is also used in brewing, where amylase from the skin of seed grains is ... Glucose molecules are bound in starch by the easily hydrolyzed alpha bonds. The same type of bond is found in the animal ... The enzyme starch synthase then adds the ADP-glucose via a 1,4-alpha glycosidic bond to a growing chain of glucose residues, ...

*Bacillus amyloliquefaciens

... amylase (amylo). Alpha amylase from B. amyloliquefaciens is often used in starch hydrolysis. It is also a source of subtilisin ... J. Fukumoto (1943). "Studies on the production of bacterial amylase. I. Isolation of bacteria secreting potent amylases and ...

*AMY2B

Alpha-amylase 2B is an enzyme that in humans is encoded by the AMY2B gene. Amylases are secreted proteins that hydrolyze 1,4- ... "Entrez Gene: AMY2B amylase, alpha 2B (pancreatic)". Human AMY2B genome location and AMY2B gene details page in the UCSC Genome ... 2001). "alpha-Amylase expressed in human liver is encoded by the AMY-2B gene identified in tumorous tissues". Clin. Chim. Acta ... 1989). "The human alpha-amylase multigene family consists of haplotypes with variable numbers of genes". Genomics. 5 (1): 29-42 ...

*Glycogen debranching enzyme

Their catalyses are similar to that of alpha-amylase and glucoamylase, respectively. Their active sites are selective towards ... In E. coli, Glucose transfer is performed by 4-alpha-glucanotransferase, a 78.5 kDa protein coded for by the gene malQ. A ... "4-alpha-glucanotransferase - Escherichia coli (strain K12)". "Glycogen debranching enzyme - Escherichia coli O139:H28 (strain ... Yamamoto E, Makino Y, Omichi K (May 2007). "Active site mapping of amylo-alpha-1,6-glucosidase in porcine liver glycogen ...

*AMY1A

This gene is found in many organisms, see Alpha-Amylase. Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside ... 1988). "Primary structure of human pancreatic alpha-amylase gene: its comparison with human salivary alpha-amylase gene". Gene ... 1989). "The human alpha-amylase multigene family consists of haplotypes with variable numbers of genes". Genomics. 5 (1): 29-42 ... Alpha-amylase 1 is an enzyme that in humans is encoded by the AMY1A gene. ...

*AMY2A

1994). "The active center of a mammalian alpha-amylase. Structure of the complex of a pancreatic alpha-amylase with a ... 1988). "Primary structure of human pancreatic alpha-amylase gene: its comparison with human salivary alpha-amylase gene". Gene ... Pancreatic alpha-amylase is an enzyme that in humans is encoded by the AMY2A gene. Amylases are secreted proteins that ... "Entrez Gene: AMY2A amylase, alpha 2A; pancreatic". Human AMY2A genome location and AMY2A gene details page in the UCSC Genome ...

*3,5-Dinitrosalicylic acid

It is mainly used in assay of alpha-amylase. However, enzymatic methods are usually preferred due to DNS lack of specificity. 3 ...

*Alpha-glucosidase inhibitor

Acarbose also blocks pancreatic alpha-amylase in addition to inhibiting membrane-bound alpha-glucosidases. Pancreatic alpha- ... Moreover, acarbose inhibits pancreatic alpha-amylase in addition to alpha-glucosidase. There are a large number of natural ... Alpha-glucosidase Alpha amylase inhibitor Benalla, Wafaa; Bellahcen, Said; Bnouham, Mohamed (2010). "Antidiabetic Medicinal ... Hence, alpha-glucosidase inhibitors reduce the impact of carbohydrates on blood sugar. Examples of alpha-glucosidase inhibitors ...

*Glucansucrase

1] MacGregor, E. A.; Jespersen, H. M.; Svensson, B (1996). "A circularly permuted alpha-amylase-type alpha/beta-barrel ... have a different arrangement than those in α-amylase. The folding characteristics of α-amylase and glucansucrase are still very ... However, glucansucrase is very similar to α-amylase, another sugar-cutting enzyme. Glucansucrase thus has many of the same ... Glucansucrase proteins likely evolved from an amylase enzyme precursor. The two enzymes have similar folding patterns and ...

*Dental plaque

Some salivary components are crucial for plaques ecosystem, such as salivary alpha-amylase which plays a role in binding and ... "Salivary alpha-amylase: role in dental plaque and caries formation". Critical Reviews in Oral Biology & Medicine. 4 (3): 301- ...

*Wooden reed care

Also, alpha-amylase contains a significant level of sialic acid. When alpha-amylase combines with saliva, the enzymes hydrolyze ... Amines and glycoproteins have been found in the reed matrix: salivary mucosins, Proline-rich Glycoproteins, alpha-amylases, ...

*Premastication

Alpha-amylase from maternal saliva aids in digestion of starches fed to a baby. This may be important in the developed nations ... "Human α-amylase and starch digestion: An interesting marriage", Starch - Stärke, WILEY-VCH Verlag, 63 (7): 395-405, doi:10.1002 ... digestion of the starch will require the action of salivary amylase..." Children being fed mainly plant based diets by ...

*Parotid gland

Additionally, the alpha amylase has been suggested to prevent bacterial attachment to oral surfaces and to enable bacterial ... The parotid gland also secretes salivary alpha-amylase (sAA), which is the first step in the decomposition of starches during ... With the inflammation of mumps or obstruction of the ducts, increased levels of the salivary alpha amylase secreted by the ... "Salivary alpha-amylase activity and salivary flow rate in young adults". The Open Dentistry Journal. 7: 7-15. doi:10.2174/ ...

*Icodextrin

There it is broken down into oligosaccharides by the enzyme alpha-amylase. In patients with intact kidney function, both ...

*Glycogen branching enzyme

Buisson, G; Duee, E; Haser, R; Payan, F (December 20, 1987). "Three dimensional structure of porcine pancreatic alpha-amylase ... 4-alpha-D-glucan:1,4-alpha-D-glucan 6-alpha-D-(1,4-alpha-D-glucano)-transferase. Other names in common use include branching ... 4-alpha-glucan branching enzyme, plant branching enzyme, alpha-1,4-glucan:alpha-1,4-glucan-6-glycosyltransferase, and starch ... Glycogen branching enzyme belongs to the α-amylase family of enzymes, which include α-amylases, pullulanas/isoamylase, ...

*Thermococcus hydrothermalis

"Tyrosine 39 of GH13 alpha-amylase from Thermococcus hydrothermalis contributes to its thermostability". Biologia (Bratislava). ...

*Falling Number

In other words, the more sprouted the grain was the higher the alpha-amylase activity will be. The higher the alpha-amylase ... An additional effect of the high temperature is that the alpha-amylase enzyme contained in the grain begins to break the starch ... The amount of starch break-down is directly proportionate to the alpha-amylase activity, meaning that the higher the activity ... The germination causes an accelerated production of the starch degrading enzyme alpha-amylase. Severely sprouted grain kernels ...

*Plant lipid transfer proteins

Fukuyama K, Oda Y, Morimoto T, Matsunaga T, Miyazaki T (1997). "Tertiary and quaternary structures of 0.19 alpha-amylase ... Plant lipid transfer proteins share the same structural domain with seed storage proteins and trypsin-alpha amylase inhibitors ... "Structure of the bifunctional inhibitor of trypsin and alpha-amylase from ragi seeds at 2.2 A resolution". Acta Crystallogr. D ... Plant lipid transfer proteins consist of 4 alpha-helices in a right-handed superhelix with a folded leaf topology. The ...

*Forensic serology

In testing, the alpha-amylase breaks down starches present and creates a color change. A starch iodine gel contains agarose and ... When saliva is present, the alpha-amylase breaks down the starches, creating a clear circle around the sample well. RSID Karl ... Common saliva detection techniques are based on the activity of the enzyme alpha-amylase which breaks down starches from food ...

*List of food additives

Carotenes - color Alpha-carotene - color Beta-carotene - color Gamma-carotene - color Carrageenan - thickener, vegetable gum, ... improving agent Amylases - flour treatment agent Angelica (Angelica archangelica) Anise - Annatto - color Anthocyanins - color ... antioxidant Dl-alpha-tocopherol (synthetic) - antioxidant Dodecyl gallate - antioxidant Echinacea - EDTA - Antioxidant, ...
611536DNAArtificial SequenceDescription of Artificial Sequence Synthetic polynucleotide 1atgaaacaac aaaaacggct ttacgcccga ttgctgacgc tgttatttgc gctcatcttc 60ttgctgcctc attctgcagc ttcagcagca aatcttaatg ggacgctgat gcagtatttt 120gaatggtaca tgcccaatga cggccaacat tggaagcgtt tgcaaaacga ctcggcatat 180ttggctgaac acggtattac tgccgtctgg attcccccgg catataaggg aacgagccaa 240gcggatgtgg gctacggtgc ttacgacctt tatgatttag gggagtttca tcaaaaaggg 300acggttcgga caaagtacgg cacaaaagga gagctgcaat ctgcgatcaa aagtcttcat 360tcccgcgaca ttaacgttta cggggatgtg gtcatcaacc acaaaggcgg cgctgatgcg 420accgaagatg taaccgcggt tgaagtcgat cccgctgacc gcaaccgcgt aatttcagga 480gaacacctaa ttaaagcctg gacacatttt cattttccgg ggcgcggcag cacatacagc 540gattttaaat ggcattggta ccattttgac ggaaccgatt gggacgagtc ccgaaagctg 600aaccgcatct ataagtttca aggaaaggct tgggattggg aagtttccaa tgaaaacggc 660aactatgatt atttgatgta tgccgacatc gattatgacc atcctgatgt cgcagcagaa 720attaagagat ggggcacttg gtatgccaat gaactgcaat tggacggttt ccgtcttgat 780gctgtcaaac acattaaatt ...
in North America! We love pizzas, breads, pastas, potatoes and pretty much anything starchy! It is almost impossible for someone to cut them out completely because life has to be somewhat enjoyable and lets face it, a freshly baked Italian loaf of bread with some butter on it is to die for. White Kidney Bean is a starch neutralizer and is a healthy way to sneak some of your favourite meals in, such as a beautiful pasta dinner without feeling guilty.. What is White Kidney Bean? And HOW does it Work?. Through numerous studies, White Kidney Bean has been found effective in neutralizing carbohydrates safely! White Kidney Bean prevents starch from being converted into sugar and eventually into fat! When White Kidney Bean is consumed before a starchy meal, it later excretes a solid waste of starch (carbohydrates)! White Kidney Bean works by binding itself to the enzyme Amylase which is produced by the pancreas and thus does not convert starch into sugar. Diabetics may also benefit from White Kidney ...
en] alpha-Amylases are present in all kingdoms of the living world. Despite strong conservation of the tertiary structure, only a few amino acids are conserved in interkingdom comparisons. Animal alpha-amylases are characterized by several typical motifs and biochemical properties. A few cases of such alpha-amylases have been previously reported in some eubacterial species. We screened the bacterial genomes available in the sequence databases for new occurrences of animal-like alpha-amylases. Three novel cases were found, which belong to unrelated bacterial phyla: Chloroflexus aurantiacus, Microbulbifer degradans, and Thermobifida fusca. All the animal-like alpha-amylases in Bacteria probably result from repeated horizontal gene transfer from animals. The M. degradans genome also contains bacterial-type and plant-type alpha-amylases in addition to the animal-type one. Thus, this species exhibits alpha-amylases of animal, plant, and bacterial origins. Moreover, the similarities in the extra ...
Business Directory for White Kidney Beans Suppliers in Anand - Get contact details of White Kidney Beans Manufacturers, Wholesale White Kidney Beans Exporters, Best White Kidney Beans Traders & Distributors Across the Anand.
N-terminal alpha-amylase secretory signal peptide and V5 epitope tag plasmid. This yeast expression vector allows the creation of secreted proteins with a Thrombin cleavage site to remove the tag. The secretory signal peptide will be cleaved off during secretion.
1KBB: Mechanistic analyses of catalysis in human pancreatic alpha-amylase: detailed kinetic and structural studies of mutants of three conserved carboxylic acids.
Pancreatic alpha-amylase activity was 54% higher in cattle fed at twice maintenance energy than in cattle fed at maintenance and was 52% greater in hay-fed than grain-fed cattle. Increased pancreatic alpha-amylase activity ...
White Kidney Bean Extract is extracted from white kidney bean which has been shown to prevent the body from properly digesting starch (carbohydrates).
extracellular exosome, extracellular space, alpha-amylase activity, amylase activity, calcium ion binding, chloride ion binding, carbohydrate catabolic process
Alpha-amylase is used as an important ingredient for the production of baked goods in order to increase the sugar and dextrin content in the finished product. Increasing importance of enzymes as functional additives in food & beverage applications on account of attributing features including good emulsification properties and self-stabilization effects is expected to remain a crucial factor over the next eight years.. Plant-based alpha-amylase demand was 1,682.6 tons in 2015. Plant-based extracts derived from rice, tobacco leaves, corn, potato and beetroot are also used as sources for the production of alpha-amylase. Over the past few years, the research institutes of the U.S. and Canada have introduced numerous publications pertaining to the development of alpha-amylase from DNA sequences of these species.. The report "Alpha-Amylase Baking Enzyme Market Analysis by Source [Fungi, Bacteria (Maltogenic, G4), Plant-Based], By Application (Breads, Cookies & Biscuits, Desserts) And Segment Forecasts ...
Excessive consumption of carbohydrates is once of the causes of obesity or weight gain. Whenever you eat carbs such a breads, pastas, cereals, pastas, cereals, cakes, coookies, chips, pizzas, burgers, etc, the digestive enzynme known as alpha amylase breaks down the starches into glucose. Your body uses glucose for energy, but any excess will be stored as fat. This is why consuming too much carbs can easily lead to weight gain.. How does kidney bean extract aid weight loss?. White kidney bean extract, also known as Phaseolus Vulgaris extract, may help to induce weight loss by inhibiting the digestive enzyme, alpha amylase, from breaking down carbs into glucose. By reducing or slowing down digestion of carbs, this decreases the number of carbohydrate calories absorbed and may result in weight loss.. ...
Abstract The inhibitory activity of six groups of flavonoids against yeast and rat small intestinal alpha-glucosidases and porcine pancreatic alpha-amylase was compared, and chemic..
TrendTerms displays relevant terms of the abstract of this publication and related documents on a map. The terms and their relations were extracted from ZORA using word statistics. Their timelines are taken from ZORA as well. The bubble size of a term is proportional to the number of documents where the term occurs. Red, orange, yellow and green colors are used for terms that occur in the current document; red indicates high interlinkedness of a term with other terms, orange, yellow and green decreasing interlinkedness. Blue is used for terms that have a relation with the terms in this document, but occur in other documents ...
Rats According to a summary report, a 14-day range-finding study in rats was performed (Elvig-Jørgensen & Pedersen, 2002). However, this study was not submitted. Groups of 10 male and 10 female Sprague-Dawley rats (aged 6 weeks) were given water containing LE399 alpha-amylase (batch PPY 7075) at a dose of 0, 1, 3.3, or 10 ml/kg bw per day (equivalent to a dose of 0, 304, 1004, or 3040 KNU(T)/kg bw per day, or 0, 102, 336, or 1020 mg/kg bw per day expressed as TOS (total organic solids from the fermentation; mainly protein and carbohydrate components)) by gavage for 13 weeks. The study was performed according to OECD test guideline 408 (1998), and was certified for compliance with good laboratory practice (GLP) and quality assurance. All animals were observed twice daily for morbidity and mortality and daily for clinical signs and reactions to treatment. Ophthalmoscopy was performed before treatment on all animals and during week 13 on all animals in the control group and in the group receiving ...
White kidney bean extract prevents your body from absorbing carbohydrates and starches to help you lose weight. Find out how it works. Learn more at eVitamins México.
White kidney bean extract prevents your body from absorbing carbohydrates and starches to help you lose weight. Find out how it works. Learn more at eVitamins Schweiz.
Order White Kidney Bean Extract from Vox Nutrition to get the fastest turn around time in the industry. Click or Call to place your order today 800-795-7161
A study, published in the Internal Journal of Medical Science, conducted a double-blind, placebo-controlled study, in which 60 slightly overweight people were given either placebo or Phase 2, a highly concentrated phaseolus extract, once daily.. This single daily dose was given 30 minutes prior to a large meal rich in carbohydrates. Over the 30 days of the study, subjects receiving Phaseolus vulgaris extract had significantly greater reduction of body weight, BMI, fat mass, adipose tissue thickness, and waist/hip/ thigh circumferences while maintaining lean body mass compared to subjects receiving placebo.. research notes: Layer, P., et al. "Effect of purified amylase inhibitor on carbohydrate tolerance in normal subjects and patients with diabetes mellitus." MAYO Clinic Proceedings 61, 6 (June, 1986) 442-447.. Brugge, W.R. and M. S. Rosenfeld. "Impairment of starch absorption by a potent amylase inhibitor." American Journal of Gastroenterology 82, 8 (August, 1987) 718-722.. Layer, P., et al. ...
Laboratory and field tests have shown the effectiveness of Eradicake™ alpha-amylase in breaking down filter cake created by starch-based drilling muds. Using Eradicake™ alpha-amylase to break down the polymer structures of filter cake is easy and convenient (no specialized equipment is required), and safe for the operator and the environment. This product has been shown to remove filter cake from lengthy sections of a horizontal reservoir by a non-aggressive chemical reaction. This performance contrasts sharply with conventional approaches, such as the use of hydrochloric acid (HCl), which reacts aggressively with calcium carbonate (CaCo3) reservoirs and is suspected of creating wormholes that lead to formation damage and blockage of formation pores. This, in turn, can restrict the flow of hydrocarbons to the wellbore and limit well productivity. Eradicake™ alpha-amylase performs at higher temperatures and across a wider range of operating conditions than competitive products. This ...
Due to the changes that occurred in the baking industry and the growing demand for natural products, clean label enzymes have gained more importance in the bread-making recipes in replacing additives such as oxidants or emulsifiers. The use of amylase from cereal, fungal or bacterial sources is known for many years. However, it is well acknowledged that cereal amylases, such as beta-amylase from soy flour or malt alpha-amylase and fungal ones have a limited effect against aging, whereas bacterial thermostable alpha-amylase has adverse effect on the quality of the finished products, leading to gummy and sticky crumb. Commercial amylases used in the baking industry are, in general, alpha-amylase, which hydrolyzes specifically, alpha-1,4-glycosidic linkages of amylose and amylopectin molecules in the starch. Based on these considerations, the aim of this study was to study the effect of lack of alpha- amylase in wheat flour used in the process of bread making. In this context, we intended to study ...
Due to the changes that occurred in the baking industry and the growing demand for natural products, clean label enzymes have gained more importance in the bread-making recipes in replacing additives such as oxidants or emulsifiers. The use of amylase from cereal, fungal or bacterial sources is known for many years. However, it is well acknowledged that cereal amylases, such as beta-amylase from soy flour or malt alpha-amylase and fungal ones have a limited effect against aging, whereas bacterial thermostable alpha-amylase has adverse effect on the quality of the finished products, leading to gummy and sticky crumb. Commercial amylases used in the baking industry are, in general, alpha-amylase, which hydrolyzes specifically, alpha-1,4-glycosidic linkages of amylose and amylopectin molecules in the starch. Based on these considerations, the aim of this study was to study the effect of lack of alpha- amylase in wheat flour used in the process of bread making. In this context, we intended to study ...
We Supply Enzyme like: 1.Glucoamylase(high activity) 2.Medium temperature alpha-Amylase(2000-3000u/ml) 3.Thermostable alpha-amylase(80000u/ml,120000u/g) 4.
SYN-E3272-5 x SYN-BTØ11-1 x SYN-IR6Ø4-5 x DAS-Ø15Ø7-1 x SYN-Ø53Ø7-1 x MON-ØØØ21-9 - Modified thermostable alpha-amylase, insect-resistant, herbicide-tolerant maize ...
Perten Instruments announces the release of the FN 1000 - Pertens newest Falling Number® instrument. The FN 1000 is a dual sample analysis system and reports the world standard Falling Number value - indicating alpha-amylase activity in grain and flou...
View Notes - Enzyme Bio100L from BIO SOMETHING at UMBC. Determining the Optimum pH and Optimum Temperature for an Alpha-Amylase Enzyme (Corpulentus Martitus) Lenell Davis BIO 100L. Nov 05,
Heat and acid-stable alpha-amylase enzymes having the following characteristics: (1) capable of retaining at least about 70% of their initial activity when held at 90° C. and at a pH of 6.0 for 10 min
cge:100767001 K01176 alpha-amylase [EC:3.2.1.1] , (RefSeq) pancreatic alpha-amylase (A) MKFFLLLSLIGFCWAQYDPQTQYGRTAIVHLFEWRWVDIAKECERYLAPKGFGGVQVSPP NENIVVYNPSRPWWERYQPISYKICTRSGNEDEFRDMVTRCNNVGVRIYVDAVINHMCGA GGGAGTSSTCGSYYNANNRDFPSVPYSGWDFNDGKCNGEISNYNDANQVRNCRLSGLLDL ALEKDYVRSKVAEYMNRLIDIGVAGFRLDAAKHMWPGDIKAVLDKLHNLNTKWFSQGSRP FIFQEVIDLGGEAIKSSEYFGNGRVTEFKYGAKLGTVIRKWNGEKMAYLKNWGEGWGFVP SDRALVFVDNHDNQRGHGAGGASILTFWDARMYKMAVGFMLAHPYGFTRVMSSYRWARNF QNGKDVNDWIGPPNNNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVAFRNVVSGQPFSN WWDNGSNQVAFGRGNRGFIVFNNDDWSLSTTLQTGLPAGTYCDVISGDKVDGNCTGIKVN VGNDGNAHFSISNSAEDPFIAIHAESKL ...
Os08g0473900, AMY3D, ALPHA-AMYLASE_3D; Alpha-amylase isozyme 3D precursor (EC 3.2.1.1) (1,4-alpha-D-glucan glucanohydrolase).; K01176 alpha-amylase [EC:3.2.1.1] ...
xop:PXO_03668 K05343 maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1] , (GenBank) alpha-amylase family protein (A) MVADQRWYKDAIIYQVHVKSFFDSNDDGIGDFPGLISKLDYIAELGVDTIWLLPFYPSPR RDDGYDIAEYMAVHPDYGSIEDFEQLVAQAHARGIRIVTELVINHTSDQHPWFQRARTAP AGSPGRDFYVWSDTDQEYEGTRIIFCDTEKSNWTWDPVAGQYFWHRFYSHQPDLNFDNPA VLEAVLEVMRFWLDRGVDGLRLDAVPYLIERAGTSNENLPETHAILRKIRATLDAEYPDR MLLAEANMWPEDTQQYFGQNADECHMAFHFPLMPRMYMAIAREDRFPITDIMRQTPEIPE SCQWAIFLRNHDELTLEMVTDSERDYLWQTYAADRRARINLGIRRRLAPLLERDRRRIEL MTSLLLTMPGTPVLYYGDEIGMGDNIHLGDRDGVRTPMQWSIDRNGGFSRADPAQLVLPP VMDPLYGFQAVNVEAQIRDQHSLLTWTRRVLSVRKRYQAFGRGTLRFLYPGNRRMLAYLR CYQDETVLCVANLSHTLQAVELDLSEFEGRVPVDIIGGGSFPPIGRLTYLLTVPPFGFYA FELVSEGTLPDWHVPSPVPLPDYRTLVLRSDADGSAALLPHLPTLEGEILPAWLSARRWF SAKDQALRSVRIARRTPLPGDQPMTLLELEVELEDGRRERYMLPVGIVWEREQPSTLAEQ LALARVRQGREVGYLTDAFALKPMVRGVIDALCSNAALKFCDGEEASQQGQVRFEATPAL AMLDIPHDPEIRWLSAEQSNSSLVIADKAVFKLLRHVAVGANPEIEIGRRLTEMGYANAA PLLGSISRVDGQGTVTTIALLQGFIRNQGDAWRWTLDHLARSFDEYVTAQTDEARAEAVA ...
What is Phase 2™ Starch Neutralizer? Phase 2™ is an amazing, non-stimulant, all-natural nutritional ingredient that is derived from the white kidney bean.
All content by Amy Wruble on FertilitySmarts. Amy Wruble is a regular contributor to mom.me and Momtastic. Her work has also appeared in The...
Day trading strategies using price action patterns pdf download #### COMO SE GANA DINERO CON FOREX Belajar forex di kediri #### Jforex example strategy
article{doron:1998a, author = {R. Doron and E. Behar and M. Fraenkel and P. Mandelbaum and A. Zigler and J.L. Schwob and A.Y. Faenov and T.A. Pikuz ...
article{doron:2000a, author = {Doron, R and Behar, E and Fraenkel, M and Mandelbaum, P and Schwob, JL and Zigler, A and Faenov, A Ya and Pikuz, TA ...
Previous studies have demonstrated that human salivary alpha-amylase specifically binds to the oral bacterium Streptococcus gordonii. This interaction is inhibited by substrates such as starch and maltotriose suggesting that bacterial binding may involve the enzymatic site of amylase. Experiments were performed to determine if amylase bound to the bacterial surface possessed enzymatic activity. It was found that over one-half of the bound amylase was enzymatically active. In addition, bacterial-bound amylase hydrolyzed starch to glucose which was then metabolized to lactic acid by the bacteria. In further studies, the role of amylases histidine residues in streptococcal binding and enzymatic function was assessed after their selective modification with diethyl pyrocarbonate. DEP-modified amylase showed a marked reduction in both enzymatic and streptococcal binding activities. These effects were diminished when DEP modification occurred in the presence of maltotriose. DEP-modified amylase had a
Shop Alpha-amylase/trypsin inhibitor ELISA Kit, Recombinant Protein and Alpha-amylase/trypsin inhibitor Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
Thoma, Myriam Verena; Joksimovic, Ljiljana; Kirschbaum, Clemens; Wolf, Jutta Manuela; Rohleder, Nicolas (2012). Altered salivary alpha-amylase awakening response in Bosnian War refugees with posttraumatic stress disorder. Psychoneuroendocrinology, 37(6):810-817. ...
Salivary α-amylase activity is an increasingly investigated biomarker for the activation of the autonomic nervous system. Autonomic imbalance is associated to several diseases, one of which is heart failure, and the aim of the present study was to test if salivary α-amylase activity might be a new biomarker in patients with chronic heart failure.. Methods: In this pilot study, 48 elderly men (range 59-89 years), 24 patients with established chronic heart failure in NYHA class I to III, and 24 controls were included. In all participants, saliva was collected for three consecutive days at three time points (at awakening, 30 minutes later and in the late afternoon), and blood was sampled for analysis of NT-proBNP.. Results: Within the whole group of participants, a statistically significant positive correlation between morning salivary α-amylase activity levels and serum NT-proBNP could be found, which was strongest for the measurement taken 30 minutes after awakening, as well as a significant ...
1G1Y: Studies on the hydrolyzing mechanism for cyclodextrins of Thermoactinomyces vulgaris R-47 alpha-amylase 2 (TVAII). X-ray structure of the mutant E354A complexed with beta-cyclodextrin, and kinetic analyses on cyclodextrins.
Analyses of T cell receptors (TCR) on T cells infiltrating labial salivary glands of patients with Sjögrens syndrome (SS) indicate that the cells expand by antigen stimulation in context of major histocompatibility complex (MHC). To elucidate the autoantigens recognized by T cells infiltrating in labial salivary glands from patients with SS, proteins derived from human salivary gland cDNA libraries were screened by West-Western method using TCR-CDR3 probe, which is antigen recognition region of TCR on T cells. 13 cDNA clones were detected as proteins binding to TCR-CDR3 region. One was a human alpha-amylase salivary precursor (AA54-407), suggesting that alpha-amylase might be a salivary gland-specific autoantigen. To examine whether alpha-amylase acts as an antigen in labial salivary glands, PBL from 11 patients with SS were incubated with 9 different synthetic amino acids of alpha-amylase or salivary alpha-amylase. SSCP analysis on TCR clearly showed that alpha-amylase reactive T cells were ...
Looking for online definition of alpha-amylase in the Medical Dictionary? alpha-amylase explanation free. What is alpha-amylase? Meaning of alpha-amylase medical term. What does alpha-amylase mean?
A proteinaceous inhibitor of the digestive enzyme alpha-amylase (1,4-a-D-Glucan glucanohydrolase; EC 3.2.1.1) has been isolated and purified from kidney beans Phaseolus v
Modules of approx. 120 residues. Granular starch-binding function has been demonstrated in the case of Thermoactinomyces vulgaris R-47 α-amylase 1 (TVAI ...
White Kidney Bean cooking information, facts and recipes. A white oval bean with a thin skin and mild flavor. It is also known as the Cannellini bean and is available canned or dried.
Shrink that waistline in a flash! White Kidney Bean extract is one of the worlds most successful weight loss supplements, and the ideal complement to anyones fat burning efforts. Natures Design offers the purest, most potent Wh...
Genetic stability of amylase activity after serial subcultivation experiments with amylolytic ruminalStreptococcus bovis strains was investigated. Two strains Amy+ and Amy− were obtained. Loss of amylase activity connected with the loss of plasmid DNA was not found in these strains. The presence of the gene responible for the amylase activity in the chromosome of these strains was revealed by hybridization of the α-amylase gene on pJK108 against chromosomal DNA ofS. bovis andBacillus subtilis after a complete restriction withEcoRI.
The yeast Saccharomyces cerevisiae is a widely used platform for the production of heterologous proteins of medical or industrial interest. However, heterologous protein productivity is often restricted due to the limitations of the host strain. In the protein secretory pathway, the protein trafficking between different organelles is catalyzed by the soluble NSF (N-ethylmaleimide-sensitive factor) receptor (SNARE) complex and regulated by the Secl/Munc18 (SM) proteins. In this study, we report that over-expression of the SM protein encoding genes SEC1 and SLY1, improves the protein secretion in S. cerevisiae. Engineering Sec1p, the SM protein that is involved in vesicle trafficking from Golgi to cell membrane, improves the secretion of heterologous proteins human insulin precursor and alpha-amylase, and also the secretion of an endogenous protein invertase. Enhancing Sly1p, the SM protein regulating the vesicle fusion from endoplasmic reticulum (ER) to Golgi, increases alpha-amylase production only. Our
Salivary cortisol (sCort) and salivary alpha-amylase (sAA) constitute proxy measures of the two major stress response systems, i.e. the hypothalamic-pituitary-adrenal axis and the autonomic nervous system, respectively. Potentially confounding determinants of sCort and sAA may limit a reliable concurrent measurement of both biomarkers, if not adequately considered. We reviewed the most important determinants of sCort and sAA and provide recommendations for handling these potential confounders. We focused on a selection of potential confounders, resulting in an in-depth consideration of age, sex steroid-related factors, somatic health, acute medication, smoking, consumption of food and drinks, alcohol consumption, physical activity/fitness, and sleep ...
Technically, starch blockers are amylase inhibitors. Amylase is one of the main enzymes the body uses to digest starch. In theory, when amylase is blocked, starch can pass through the body undigested. If the body is unable to digest a part of the meal the calorie intake will be lower which can aid in weight loss. However, theory is one thing, reality another and clinical studies of amylase inhibitors have not established definitive benefits.1-3 For example, one published study failed to find that use of a phaseolus product reduced the usual blood sugar rise that follows a meal.7 Several possible reasons for this discrepancy have been proposed, such as that the amylase inhibitor may be broken down and made ineffective in the stomach, the product may supply enough of its own amylase to counteract any benefit, and that another enzyme, glucoamylase, may be able to take over when amylase cant do the job. However, according to the manufacturer of a current product, more concentrated extracts of ...
Arch JJ, Brown KW, Dean DJ, Landy LN, Brown KD, Laudenslager ML. Self-compassion training modulates alpha-amylase, heart rate variability, and subjective responses to social evaluative threat in women. Psychoneuroendocrinology. 2014 Apr; 42:49-58 ...
Mono- and Stereopictres of 5.0 Angstrom coordination sphere of Sodium atom in PDB 2gjp: Structure of Bacillus Halmapalus Alpha-Amylase, Crystallized With the Substrate Analogue Acarbose and Maltose
Pixdaus.com is an environmental photo-bookmarking and sharing service. All the pictures are uploaded by users and the copyrights belong to the rightholders. You can request a removal using the Copyright flag link below each image if you find an image that shouldnt belong here ...
The Guardian. · I love Christmas. All those festive news stories planted by industry about how chocolate and booze are good for you, and then the excitement of a season of new year bad science detox stories to look forward to. "According to the British Nutrition Foundation, most adults tend to put on at least 5-7Ib over the four-week Christmas period." So says the PR department of Phase 2, a white kidney bean extract thats "the low-carb diet in a pill". Its a great idea: an amylase inhibitor that stops your body breaking down carbohydrates, so you cant absorb them and you presumably poo them out. Whole chips perhaps.. · Its not a particularly new idea. In fact, in 1983, Professor John Garrow and some colleagues read about a similar product, and came up with an ingenious way of testing it. We eat plants and then break down their carbohydrates, release their energy for our own dubious purposes and breathe out carbon dioxide. There are two isotopes of carbon: carbon-13 and carbon-12. Some ...
Mit ihrem zweiten Werk "Fixed Action Pattern" [davor gab es noch die "Human Abyss"-Scheibe im Jahre 2007, die man sich ber die MySpace-Page der Band gratis downloaden kann] zeigen die Berliner, dass sie auf jeden Fall berregional konkurrenzf hig sind, aber leider auch, dass sie noch l ngst nicht zu den [ganz] Gro en geh ren. Die Jungs m hen sich zwar redlich ab, aber es fehlt noch ein letztes St ck Finesse f r die erste Liga. PLACENTA versuchen zwar sich durch viele interessante Parts [z.b. einige Clean Vocals-Einlagen, die allerdings wenig mit Emo-Gejammer zu tun haben, sonstige Melodik wie in "Simon Says" sowie einige Schlenker in Richtung MESHUGGAH] oder elektronische Interludes ["Pinocchio Stretches Woodenly In The Forest"] von der Masse abzuheben, aber leider sind meisten Songs selbst einfach nicht au ergew hnlich genug, um wirklich gegen die Vorbilder bestehen zu k nnen. Au erdem wirkt "Fixed Action Pattern" etwas zu lang, was durch die drei gut gemeinten Bonustracks, die allesamt der ...
Analysis of enzymatic activity of PCR mutated alpha- amylase gene , Analysis of enzymatic activity of PCR mutated alpha- amylase gene , کتابخانه دیجیتال دانشگاه علوم پزشکی اصفهان
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
Source Naturals Phase 2 Carbohydrate Blocker 500mg 120 tablet ource Naturals Carbohydrate Blocker contains Phase 2(R) white kidney bean extract. Phase 2(R) works ...
Sinvastatina Basi is a medicine available in a number of countries worldwide. A list of US medications equivalent to Sinvastatina Basi is available on the Drugs.com website.
α-Amylase hydrolyzes the 2-chloro-p-nitrophenyl-α-D-maltotrioside (CNPG3) to release 2-chloro-nitrophenol and form 2-chloro-p-nitrophenyl-α-D-maltoside (CNPG2), maltotriose (G3) and glucose (G). The rate of increase in absorbance is measured at 405 nm and is proportional to the α-amylase activity in the sample.(G). The rate of increase in absorbance is measured at 405 nm and is proportional to the α-amylase activity in the sample.. ...
K01176 alpha-amylase [EC:3.2.1.1] , (RefSeq) pancreatic alpha- ...
Kommisjonens gjennomføringsforordning (EU) 2017/173 av 1. februar 2017 om endring av forordning (EF) nr. 1292/2008 og gjennomføringsforordning (EU) nr. 887/2011 hva angår navnet på innehaveren av godkjenningen av Bacillus amyloliquefaciens CECT 5940 og...
Amy Winehouse Rehab (live) - Amy performing her hit Rehab at a 2007 award show. Parents seek naloxone to help their adult kids Filed under: drug tr
Guy`s , Experience PornStar Services wiTh a Genuine PornStar Her name ... `````` Amy Anderssen `````` Amy is available ```` OUTCALL & INCALL ```` TodaY Tuesday From 4.00pm to 2.00am !!! First in Class PSE Services : PSE, GFE, DFK, , COB, MSOG, MPOS
From: ForeverAmber (Original Message)Sent: 7/11/2002 12:47 AMOn September 8, 1560, a tragic event occurred at Cumnor Place. Amy Robsart, wife of Robert Dudley, had insisted.
Discover Lifes page about the biology, natural history, ecology, identification and distribution of Amy Stander I_AST/0000 -- Discover Life
Dancing With The Stars has taken Amy Purdy aboard and Duracell is featuring her in their new ad. Read on to see why America is going crazy for Purdy.
Home for Sale: 1,544 sq. ft., 3 bed, 2 full bath house located at 3205 Amy Drive, Champaign, IL 61822 on sale for $156,900. MLS# 09639641. Looking for purchase
When reflecting on the life of Amy Mesara, words such as caring, smart as a tac, and animal lover come to mind, however, perhaps the word that paints the most vivid picture of her is
If youd like to use CustomFit to create a custom version of Ayana, please read all about CustomFit recipes and get one for this sweater here.
Top Secet Nutrition Garcinia Cambogia + White Kidney Bean Extract 90 Veggie Caps This synergistic combination of weight loss ingredients presents a fat fighting duo of incredible power. The benefits of Top Secret Nutritions Garcinia Cambogia Extract 60% Hydroxycitric Acid (HCA) with white kidney bean extract include: Promoting appetite control Supporting weight loss Affecting caloric absorption Supplement Facts Serving Size 2 Capsules Servings Per Container 45 Amount Per Serving %Daily Value Garcinia Cambogia (Standardized to 60% Hydroxicitric Acid (HA) 750mg * White Kidney Bean Extract (Phaseolus vulgaris) 400mg * *DV not established ** Percent daily values based upon a 2,000 calorie diet. Other Ingredients: Hypromellose, magnesium stearate, microcrystalline cellulose, silicon dioxide, titanium dioxide. Directions: Adults, Take two capsule on an empty stomach, before each meal. Store in a cool, dry place. Warning: Do not exceed recommended dosage.
Mrs. Grimes White Kidney Beans nutrition facts and nutritional information. Find calories, carbs, and nutritional contents for Mrs. Grimes White Kidney Beans and over 2,000,000 other foods at MyFitnessPal.com.
The two main components of the stress system are the hypothalamic-pituitary-adrenal (HPA) and sympathetic-adrenal-medullary (SAM) axes. While cortisol has been commonly used as a biomarker of HPA functioning, much less attention has been paid to the role of the SAM in this context. Studies have shown that long-term breast cancer survivors display abnormal reactive cortisol patterns, suggesting a dysregulation of their HPA axis. To fully understand the integrity of the stress response in this population, this paper explored the diurnal and acute alpha-amylase profiles of 22 breast cancer survivors and 26 women with no history of cancer. Results revealed that breast cancer survivors displayed identical but elevated patterns of alpha-amylase concentrations in both diurnal and acute profiles relative to that of healthy women, F (1, 39) = 17.95, p | 0.001 and F (1, 37) = 7.29, p = 0.010, respectively. The average area under the curve for the diurnal and reactive profiles was 631.54 ± 66.94 SEM and 1238.78
Plant defensins are known for different biological functions such as insect resistance, antibacterial, antifungal and antiviral activities. The role of plant defensins against weevils is based on inhibitor of alpha-amylase activity in weevil gut, therefore, weevils can not digest starch and then die. The low content of Vigna radiata plant defensin 1 (VrPDF1) in mung bean seeds is promted researches to increase the VrPDF1content, in which leads to enhance alpha-amylase inhibition and improve bruchid resistance in mung bean. This article presents the results of overexpression of VrPDF1 gene in transgenic mung bean plants. VrPDF1 gene was successfully transferred into DX22 mung bean cultivar and expressed in T1 generation transgenic mung bean seeds. The extract containing recombinant VrPDF1 protein inhibited alpha-amylase of weevil larvae in its larval stage. The performance of alpha-amylase inhibitor of DX1-3 and DX1-7 transgenic mung bean lines increased by 166.40% and 178.19% respectively, in comparison
Fungal Alpha-Amylase (Powder) is one kind of food grade alpha-amylase made from Aspergillus oryzal var in the fermentation and extraction method. It is ...
alpha amylase amylose digestion. Alpha-Amylase Assay Kit - Measurement Alpha-Amylase .... Bowtrol Colon Cleanser Health Support forumlas include natural colon cleanse supplements and natural Sensitive Digestion remedies.
Cellulase (endo-1,4-β-D-glucanase) (Bacillus amyloliquefaciens) [ME-CELBA] - High purity recombinant Cellulase (endo-1,4-β-D-glucanase) (Bacillus amyloliquefaciens) for use in research, biochemical enzyme assays and in vitro diagnostic analysis. EC 3.2.1.4 CAZy Family: GH5 Recombinant. From Bacillus amyloliquefaciens. In 3.2 M ammonium sulphate. Specific activity: ~ 80 U/mg (40oC, pH 6.0 on CM-cellulose 4M); ~ 160 U/mg (60oC, pH 6.0 on CM-cellulose 4M). Stability: | 2 years at 4oC.
Ten genes from two multigene families encode barley alpha-amylases. To gain insight into the occurrence and fate of individual isoforms during seed germination, the alpha-amylase repertoire was mapped by using a proteomics approach consisting of 2D gel electrophoresis, western blotting, and mass spectrometry. Mass spectrometric analysis confirmed that the 29 alpha-amylase positive 2D gel spots contained products of one (GenBank accession gi,113765) and two (gi,4699831 and gi,166985) genes encoding alpha-amylase 1 and 2, respectively, but lacked products from seven other genes. Eleven spots were identified only by immunostaining. Mass spectrometry identified 12 full-length forms and 12 fragments from the cultivar Barke. Products of both alpha-amylase 2 entries co-migrated in five full-length and one fragment spot. The alpha-amylase abundance and the number of fragments increased during germination. Assessing the fragment minimum chain length by peptide mass fingerprinting suggested that ...
The study s objectives were to measure flour antigen exposure in bakeries and define the determinants of exposure. Ninety-six bakery workers, employed in seven different bakeries, participated in the study. Two side-by-side full-shift inhalable dust samples were obtained from each study participant on a single occasion. The flour antigen...
Technically, starch blockers are amylase inhibitors. Amylase is one of the main enzymes the body uses to digest starch. In theory, when amylase is blocked, starch can pass through the body undigested. If the body is unable to digest a part of the meal the calorie intake will be lower which can aid in weight loss. However, theory is one thing, reality another and clinical studies of amylase inhibitors have not established definitive benefits.1-3 For example, one published study failed to find that use of a phaseolus product reduced the usual blood sugar rise that follows a meal.7 Several possible reasons for this discrepancy have been proposed, such as that the amylase inhibitor may be broken down and made ineffective in the stomach, the product may supply enough of its own amylase to counteract any benefit, and that another enzyme, glucoamylase, may be able to take over when amylase cant do the job. However, according to the manufacturer of a current product, more concentrated extracts of ...
Product Name: Native Phaseolus vulgaris Alpha-Amylase InhibitorDescription: A proteinaceous inhibitor of the digestive enzyme alpha-amylase (1,4-a-D-Glucan glucanohydrolase; EC 3.2.1.1) has been isolated and purified from kidney beans Phaseolus vulgaris. It is a glycoprotein and it specifically inhibits corresponding plant, bacteAbbr: α-Amylase Inhibitor, Native (Phaseolus vulgaris)Alias: Source: Phaseolus vulgarisAppearance: CAS NO: 1338806-73-7 www.medchemexpress.com Molecular Weight: 45-50 […]. Read More ...
During the past few years great progress has been made in the understanding of the function of starch-degrading enzymes. Combining mutational analysis, multiple sequence alignment, and three dimensional structures of enzyme substrate analogue complexes formed the basis for developing amylolytic and related enzymes through protein engineering. In the case of barley a-amylase this has involved rational site-directed mutagenesis, regional random mutagenesis and isozyme sequence exchange as well as generation of isozyme chimeras. The approach has enabled modulation of enzyme specificity and identification of the functional roles of distinct residues and regions. The mutational analysis included the complex between barley α-amylase 2 and a proteinaceous inhibitor from barley seeds, BASI (barley a-amylase/subtilisin inhibitor). The interplay between the catalytic and the starch binding domains in glucoamylase from Aspergillus niger was investigated. The two domains are connected by a highly ...
Emmer wheat as the progenitor of common wheat, holds the genetic potentiality for improvement of wheat yield, quality and stress tolerance such as drought and salt. To comprehensively evaluate the salt tolerance of emmer wheat, a total of 30 traits including growth, physiology and photosynthesis related as well as K+ and Na+ content of 30 wild emmer and 14 durum wheat accessions were systematically investigated and compared between normal and saline conditions. Salt tolerance index (STI) based on multiple regression analysis of these traits was calculated and five wild emmer accessions showed high salt tolerance, which could be used as valuable resource for wheat salt tolerance improvement. Furthermore, wild emmer genotypes showed wider trait performance variation compared to durum wheat, indicating the higher genetic diversity in wild emmer wheat. Then, shoot Na+ content, shoot K+/Na+ ratio, root length and root surface area were identified as suitable indexes for salt tolerance evaluation. Na+
Excessive consumption of carbohydrates is once of the causes of obesity or weight gain. Whenever you eat carbs such a breads, pastas, cereals, pastas, cereals, cakes, coookies, chips, pizzas, burgers, etc, the digestive enzynme known as alpha amylase breaks down the starches into glucose. Your body uses glucose for energy, but any excess will be stored as fat. This is why consuming too much carbs can easily lead to weight gain.. How does kidney bean extract aid weight loss?. White kidney bean extract, also known as Phaseolus Vulgaris extract, may help to induce weight loss by inhibiting the digestive enzyme, alpha amylase, from breaking down carbs into glucose. By reducing or slowing down digestion of carbs, this decreases the number of carbohydrate calories absorbed and may result in weight loss.. ...
Manufacturer of Alcohol Enzymes - Alpha Amylase Enzyme, Glucoamylase, Neutral Protease Enzyme and Starch Liquefaction Enzyme offered by Aum Enzymes, Borsad, Gujarat.
The role of lipase and alpha-amylase in both the degradation of starch/poly(epsilon-caprolactone) fiber meshes and the osteogenic differentiation of cultured marrow stromal ...
This is one of the Enzymology protocol on Effect of Temperature on Amylase activity (Enzymology Protocol). Download Salivary amylase activity assay Protocol
Bacillus amyloliquefaciens FZB42 is a Gram-positive, pathogen-suppressing and plant-growth promoting rhizobacterium. Apart from this ability, it produces a vast array of secondary metabolites, which includes both ribosomal and non-ribosomal peptides. In this work, the transcriptional activation and regulation of bacilysin biosynthesis were studied at the promoters of bac and ywfH genes. The promoter of bacilysin was identified using 5-deletion analysis. Sigma factor A (σA) was found to start transcription via conserved promoter elements (-10 and -35) of bac and ywfH genes. lacZ reporter fusion studies were performed in wild type and regulatory mutants. The results show the involvement of transcriptional regulators to activate the expression of bacilysin genes. Several global regulators such as DegU, ComA, Hpr and AbrB were identified and found to influence gene expression. In particular, I confirmed DegU binding in bac and ywfH promoters using radioactive DNase I footprinting. Furthermore, ...
Read "Plant growth promoting effect of Bacillus amyloliquefaciens H-2-5 on crop plants and influence on physiological changes in soybean under soil salinity, Physiology and Molecular Biology of Plants" on DeepDyve, the largest online rental service for scholarly research with thousands of academic publications available at your fingertips.
RNA Polymerase from Bacillus amyloliquefaciens Infected with ϕ29 Bacteriophage: DNA-dependent RNA polymerase was purified from uninfected and ϕ29-infected Bacil
Identification des facteurs structuraux responsables de lactivité aux basses températures chez une -amylase produite par une bactérie psychrophile de ...
I have found classic Irvingia to be best on its own rather than mixed with other ingredients. Had results similar to study last Spring until I became stressed. In my opinion, it doesnt overcome cortisol to help you lose if you are stressed. It helped me maintain my loss through stress though. I suggest if you lead a stressful lifestyle to incorporate a cortisol support formula. Side effects noted: Increased thirst, deep sleep and vivid dreams. NO gastric upset with IntegraLean Irvingia. Tried Enhanced Irvingia with the white kidney bean extract and it caused severe heartburn, gas and gastric upset. ...
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
Sigma-Aldrich offers Sigma-A6255, α-Amylase from porcine pancreas for your research needs. Find product specific information including CAS, MSDS, protocols and references.
Meisler, M and Strahler, J R., "Two distinct amylase genes active in pancreas of ybr mice. Abstr." (1982). Subject Strain Bibliography 1982. 1964 ...
Torulopsis ingeniosaDi Menna was found to possess an α-amylase strongly attached to the cell wall, its pH optimum being at 5.5, optimum temperature at 50 °C, highly sensitive to thermal inactivation. The enzyme was found to be induced by starch but the synthesis is not subject to a glucose effect.
Corey Haim had cleaned up and turned his life around, acting and caring for his cancer-stricken mother, before he died, says his best friend Corey
Camelids produce functional antibodies devoid of light chains and CH1 domains. The antigen-binding fragment of such heavy chain antibodies is therefore comprised in one single domain, the camelid heavy chain antibody VH (VHH). Here we report on the structures of three dromedary VHH domains in complex with porcine pancreatic alpha-amylase. Two VHHs bound outside the catalytic site and did not inhibit or inhibited only partially the amylase activity. The third one, AMD9, interacted with the active site crevice and was a strong amylase inhibitor (K(i) = 10 nm). In contrast with complexes of other proteinaceous amylase inhibitors, amylase kept its native structure. The water-accessible surface areas of VHHs covered by amylase ranged between 850 and 1150 A(2), values similar to or even larger than those observed in the complexes between proteins and classical antibodies. These values could certainly be reached because a surprisingly high extent of framework residues are involved in the interactions ...
The purpose of this study was to identify the major salivary components which interact with oral bacteria and to determine the mechanism(s) responsible for their binding to the bacterial surface. Strains of Streptococcus sanguis, Streptococcus mitis, Streptococcus mutans, and Actinomyces viscosus were incubated for 2 h in freshly collected human submandibular-sublingual saliva (HSMSL) or parotid saliva (HPS), and bound salivary components were eluted with 2% sodium dodecyl sulfate. By sodium dodecyl sulfate-polyacrylamide gel electrophoresis and Western transfer, alpha-amylase (EC 3.2.1.1) was the prominent salivary component eluted from S. sanguis. Studies with 125I-labeled HSMSL or 125I-labeled HPS also demonstrated a component with an electrophoretic mobility identical to that of alpha-amylase which bound to S. sanguis. Purified alpha-amylase from human parotid saliva was radiolabeled and found to bind to strains of S. sanguis genotypes 1 and 3 and S. mitis genotype 2, but not to strains of ...
TY - JOUR. T1 - Effect of nucleotide polymorphism in cis-regulatory and coding regions on amylase activity and fitness in Drosophila melanogaster. AU - Goto, Hiroki. AU - Szmidt, Alfred. AU - Yamazaki, T.. AU - Inomata, N.. PY - 2005/11/1. Y1 - 2005/11/1. N2 - In natural populations of Drosophila melanogaster, there are many amylase (AMY) isozymes encoded by the duplicated genes, but their adaptive significance remains unclear. One approach to elucidate this issue is to understand the molecular basis of functional differences between the allelic classes. In this study, the effects of nucleotide polymorphism in 5′-flanking (cis-regulatory) and coding regions on AMY activity were examined, both on glucose and starch food media and in larvae and adults, using three chimeric Amylase (Amy) genes, Amyc111, Amyc161 and Amy fc661. In this notation, the first number in the superscript indicates the sequence of the 5′-flnaking region (similar to Amy 1 or Amy6), the second number refers to the coding ...
TY - JOUR. T1 - Glucosylation of sucrose laurate with cyclodextrin glucanotransferase. AU - Okada, Katsuhide. AU - Zhao, Haisuo. AU - Izumi, Minoru. AU - Nakajima, Shuhei. AU - Baba, Naomichi. PY - 2007. Y1 - 2007. N2 - Sucrose monolauroyl esters were found to serve as substrates for cyclodextrin glucanotransferase (CGTase)-catalyzed transglucosidation reactions, affording new sucrose esters that have an additional 1-3 glucose residues on the pyranose ring of the sucrose moiety in the ester.. AB - Sucrose monolauroyl esters were found to serve as substrates for cyclodextrin glucanotransferase (CGTase)-catalyzed transglucosidation reactions, affording new sucrose esters that have an additional 1-3 glucose residues on the pyranose ring of the sucrose moiety in the ester.. KW - CGTase. KW - Cyclodextrin glucanotransferase. KW - Sucrose monolaurate. KW - Surfactant. UR - http://www.scopus.com/inward/record.url?scp=33947580881&partnerID=8YFLogxK. UR - ...
Bacillus amyloliquefaciens strain FZB42 is a free-living bacterium that competitively colonizes plant roots and stimulates plant growth by many different modes of action. The molecular basis of singular beneficial effects that this Plant Growth-Promoting Rhizobacteria (PGPR) exert on their hosts have been studied. To decipher the molecular cross-talk of B. amyloliquefaciens and its host plants as a whole system, an extensive proteomic approach was performed. Reference maps of the extracellular and cytosolic protein fractions were established. The highest number of secreted proteins was observed during stationary growth phase. Identified extracellular proteins belong to different functional classes, with the most prominent classes involved in carbohydrate degradation and transportation of molecules across the cell wall. Cytosolic extracts obtained from cultures grown in 1C and minimal media subjected to the 2 Dimensional Electrophoresis (2 DE), revealed 461 and 245 different protein entries, ...
article{846db9be-cde0-4c61-ad98-3a878883f3ac, abstract = {Dodecyl glucooligosides, a class of interesting non ionic surfactant molecules were synthesized by cyclodextrin glucanotransferase from Bacillus macerans using either alpha-cyclodextrin (alpha-CD) or soluble starch as glycosyl donor and dodecyl beta-D-glucoside (C(12)G(1)) or dodecyl beta-D-maltoside (C(12)G(2)) as acceptor substrates. The primary coupling products obtained in the respective reactions were identified as dodecyl glucoheptaoside and dodecyl maltooctaoside by mass spectrometry. Higher yields of coupling products were obtained using alpha-CD as donor, while more dispoportionation occurred with starch. Nearly 78% conversion of the acceptor substrate C(12)G(1) into dodecyl glucooligosides could be achieved at 132 mu g/ml of CGTase in 20 min, while 93% of C(12)G(2) could be transformed into products at 17.6 mu g/ml of enzyme in 120 min using soluble starch as donor substrate. For applications requiring pure compounds like ...
Background,br /,Mental stress reliably induces increases in salivary alpha amylase (sAA), a suggested surrogate marker for sympathetic nervous system (SNS) reactivity. While stress-induced sAA increases correlate with norepinephrine (NE) secretion, a potential mediating role of noradrenergic mechanisms remains unclear. In this study, we investigated for the first time in humans whether a NE-stress-reactivity mimicking NE-infusion with and without alpha-adrenergic blockade by phentolamine would induce changes in sAA.,br /,,br /,Methods,br /,In a single-blind placebo-controlled within-subjects design, 21 healthy men (29-66 years) took part in three different experimental trials varying in terms of substance infusion with a 1-min first infusion followed by a 15-min second infusion: saline-infusion (trial-1), NE-infusion (5 μg/min) without alpha-adrenergic blockade (trial-2), and with phentolamine-induced non-selective blockade of alpha1- and alpha2-adrenergic receptors (trial-3). Saliva samples ...

Alpha amylase (IPR006046) | InterPro | EMBL-EBIAlpha amylase (IPR006046) | InterPro | EMBL-EBI

Alpha amylase (IPR006046). Short name: Alpha_amylase Overlapping homologous superfamilies *Glycoside hydrolase superfamily ( ... Alpha-amylases, which belong to glycoside hydrolase family 13, are 1,4-alpha-D-glucan glucanohydrolases, which degrade both the ... branched and unbranched forms of starch by cleaving the internal alpha-1,4 bonds connecting the glucose monomers. The products ...
more infohttps://www.ebi.ac.uk/interpro/entry/IPR006046

Alpha-amylase - Lactobacillus amylovorusAlpha-amylase - Lactobacillus amylovorus

IPR031319. A-amylase_C. IPR006046. Alpha_amylase. IPR031965. CBM26. IPR006047. Glyco_hydro_13_cat_dom. IPR013780. Glyco_hydro_b ... IPR031319. A-amylase_C. IPR006046. Alpha_amylase. IPR031965. CBM26. IPR006047. Glyco_hydro_13_cat_dom. IPR013780. Glyco_hydro_b ... Alpha-amylaseImported. ,p>Information which has been imported from another database using automatic procedures.,/p> ,p>,a href ... tr,Q48502,Q48502_LACAM Alpha-amylase OS=Lactobacillus amylovorus OX=1604 PE=3 SV=2 ...
more infohttp://www.uniprot.org/uniprot/Q48502

What is Alpha Amylase? (with pictures)What is Alpha Amylase? (with pictures)

If a persons alpha amylase levels are too... ... Alpha amylase is a protein that breaks down large molecules of ... Alpha amylase is a protein involved in the digestion of food. This type of digestive enzyme cleaves large molecules of food ... Alpha amylases are enzymes and, by definition, speed up the rate of reactions. In this case, the reaction is to cleave the ... Pancreatic alpha amylase cleaves the linkages of amylose. This compound is a linear form of starch that lacks the side branches ...
more infohttps://www.wisegeek.com/what-is-alpha-amylase.htm

Eradicake Alpha-AmylaseEradicake Alpha-Amylase

... alpha-amylase in breaking down filter cake created by starch-based drilling muds. Using Eradicake™ alpha-amylase to break down ... Fuelzyme Alpha-amylase. Industrial Enzyme from USA by Dupont, Verenium. Detalzym GA L-E5 Glucoamylase. Industrial Enzyme from ... Eradicake™ alpha-amylase performs at higher temperatures and across a wider range of operating conditions than competitive ... In support of reservoir clean-up needs, Vereniums Eradicake™ alpha-amylase product addresses the removal of filter cake from ...
more infohttp://www.synbioproject.org/cpi/applications/eradicake-alpha-amylase/

Oramyl (Alpha-Amylase) NovartisOramyl (Alpha-Amylase) Novartis

Oramyl information about active ingredients, pharmaceutical forms and doses by Novartis, Oramyl indications, usages and related health products lists
more infohttp://drugs-about.com/drugs-o/oramyl.html

Alpha-amylase - Tribolium castaneum (Red flour beetle)Alpha-amylase - Tribolium castaneum (Red flour beetle)

IPR006048. A-amylase/branching_C. IPR031319. A-amylase_C. IPR006046. Alpha_amylase. IPR006047. Glyco_hydro_13_cat_dom. ... IPR006048. A-amylase/branching_C. IPR031319. A-amylase_C. IPR006046. Alpha_amylase. IPR006047. Glyco_hydro_13_cat_dom. ... Alpha-amylaseUniRule annotation. ,p>Information which has been generated by the UniProtKB automatic annotation system, without ... Alpha-amylaseSequence analysis. ,p>Information which has been generated by the UniProtKB automatic annotation system, without ...
more infohttp://www.uniprot.org/uniprot/Q26855

alpha-Amylase antibody | ELISA | A8273 | Sigma-Aldrichalpha-Amylase antibody | ELISA | A8273 | Sigma-Aldrich

Anti-α-Amylase antibody produced in rabbit - Tested Applications: indirect ELISA 1:4,000-1:6,000,Ouchterlony double diffusion ... Anti-α-Amylase antibody produced in rabbit fractionated antiserum, lyophilized powder Synonym: Alpha Amylase Antibody - Anti-α- ... human salivary α-amylase. General description α amylase is an enzyme present in human saliva and pancreatic secretions which ... Anti-α-amylase antibody reacts specifically with α amylase present in human saliva and pancreatic extract but not with other ...
more infohttps://www.sigmaaldrich.com/catalog/product/sigma/a8273?lang=en®ion=US

M)SDS - Alpha Amylase, 2% | Carolina.comM)SDS - Alpha Amylase, 2% | Carolina.com

Introduction to Feeding Preferences in Caenorhabditis elegans The nonparasitic soil nematode Caenorhabditis elegans has served as a model organism for research scientists since the 1960s. This lab introduces students to the organism and provides them with the tools necessary to perform simple experiments. View » ...
more infohttps://www.carolina.com/teacher-resources/carolina-labsheets/21801.co?N=2219004719&Nr=&trId=tr-msds-alpha-amylase-2-percent&nore=y

M)SDS - Alpha Amylase, 2% | Carolina.comM)SDS - Alpha Amylase, 2% | Carolina.com

Make your classroom electrifying with activities and information spanning chemistry and physics content. Everything from equilibrium to electricity and reactions to rocketry at your fingertips.. ...
more infohttps://www.carolina.com/teacher-resources/life-science/31502.co?N=3495351681&Nr=&nore=y&trId=tr-msds-alpha-amylase-2-percent&nore=y

Natural human Pancreatic alpha amylase protein (ab77861)Natural human Pancreatic alpha amylase protein (ab77861)

Buy our Natural human Pancreatic alpha amylase protein. Ab77861 is an active full length protein produced in Nativesyntheticaly ... Natural human Pancreatic alpha amylase protein. See all Pancreatic alpha amylase proteins and peptides. ... from a total amylase concentration in serum of about 120µg/L. Pancreatic amylase and salivary amylase are the products of ... Pancreatic amylase is a digestive enzyme secreted by the pancreas. It consists of a single polypeptide chain with a molecular ...
more infohttp://www.abcam.com/natural-human-pancreatic-alpha-amylase-protein-ab77861.html

RCSB PDB 









- 1BLI: BACILLUS LICHENIFORMIS ALPHA-AMYLASE Literature Report PageRCSB PDB - 1BLI: BACILLUS LICHENIFORMIS ALPHA-AMYLASE Literature Report Page

Activation of Bacillus licheniformis alpha-amylase through a disorderorder transition of the substrate-binding site mediated ... ALPHA-AMYLASE A 483 Bacillus licheniformis EC#: 3.2.1.1 IUBMB Mutation: R134L, N190F, Q264S, N265Y, S310G, A320S, E465A Details ...
more infohttp://www.rcsb.org/pdb/explore/litView.do?structureId=1BLI

RCSB PDB - Protein Feature View 









 - Alpha-amylase - P00692 (AMY BACAM)RCSB PDB - Protein Feature View - Alpha-amylase - P00692 (AMY BACAM)

Endohydrolysis of 1->4-alpha-D-glucosidic linkages in polysaccharides containing three or more 1->4-alpha-linked D-glucose ...
more infohttp://www.rcsb.org/pdb/protein/P00692

alpha amylase, catalytic domain protein [Capnocytophaga sp. oral taxon - Protein - NCBIalpha amylase, catalytic domain protein [Capnocytophaga sp. oral taxon - Protein - NCBI

alpha amylase, catalytic domain protein [Capnocytophaga sp. oral taxon 380 str. F0488]. NCBI Reference Sequence: ZP_19279919.1 ...
more infohttps://www.ncbi.nlm.nih.gov/protein/429746575?report=fasta

Alpha-Amylase pharmaceutical drugs and health productsAlpha-Amylase pharmaceutical drugs and health products

Alpha-Amylase indications and usages ATC and ICD codes, combinations with other active ingredients and trade names information ... Alpha-Amylase. Lipase. Protease Dipan 9 - Thorne Research Alpha-Amylase. Papain Neopeptine Liquid - Raptakos Brett. Zymowin - ... Alpha-Amylase. Ampicillin Angicilin - Grupo Vita / Vita Cientifica Alpha-Amylase. Anise Oil. Caraway Oil. Dill Oil. Papain ... Alpha-Amylase Alfa-Amylase - Biogaran. Alfa-Amylase BGR - Ferlux Laboratoire. Maxilase - Sanofi-Aventis. Megamylase - Leurquin ...
more infohttps://drugs-about.com/ing/alpha-amylase.html

WO2015165472A3 - Cold-active alpha-amylase 
        - Google PatentsWO2015165472A3 - Cold-active alpha-amylase - Google Patents

Functional, biochemical analysis has documented that the alpha-amylase is cold-adapted with a temperature optimum at 10 °C to ... Sequence analysis has indicated that the alpha-amylase is related to Clostridia , and has revealed classical characteristics of ... There is provided a novel cold-active alpha-amylase identified by a functional metagenomic approach expressed in E. coli and ... WO2015165472A3 - Cold-active alpha-amylase - Google Patents. Cold-active alpha-amylase Download PDF Info. Publication number. ...
more infohttps://patents.google.com/patent/WO2015165472A3/en?oq=WO%2F2015%2F165472

Alpha-amylase/branching enzyme, C-terminal all beta (IPR006048) | InterPro | EMBL-EBIAlpha-amylase/branching enzyme, C-terminal all beta (IPR006048) | InterPro | EMBL-EBI

Alpha-amylase is an essential enzyme in alpha-glucan metabolism, acting to catalyse the hydrolysis of alpha-1,4-glucosidic ... Alpha-amylase/branching enzyme, C-terminal all beta (IPR006048) *Alpha-amylase, C-terminal domain (IPR031319) ... Evolution of alpha-amylases: architectural features and key residues in the stabilization of the (beta/alpha)(8) scaffold.. Mol ... Alpha-amylase/branching enzyme, C-terminal all beta (IPR006048). Short name: A-amylase/branching_C ...
more infohttp://www.ebi.ac.uk/interpro/entry/IPR006048

Alpha-amylase | definition of alpha-amylase by Medical dictionaryAlpha-amylase | definition of alpha-amylase by Medical dictionary

... alpha-amylase explanation free. What is alpha-amylase? Meaning of alpha-amylase medical term. What does alpha-amylase mean? ... Looking for online definition of alpha-amylase in the Medical Dictionary? ... alpha-amylase. Also found in: Dictionary, Thesaurus, Encyclopedia, Wikipedia.. Related to alpha-amylase: Amyloglucosidase, ... Alpha-amylase , definition of alpha-amylase by Medical dictionary https://medical-dictionary.thefreedictionary.com/alpha- ...
more infohttps://medical-dictionary.thefreedictionary.com/alpha-amylase

Salivary Alpha-Amylase Activity, a New Biomarker in Heart Failure?Salivary Alpha-Amylase Activity, a New Biomarker in Heart Failure?

Saliva; Salivary !-amylase; Alpha-amylase; Heart failure; National Category Medical and Health Sciences Identifiers. URN: urn: ... Salivary Alpha-Amylase Activity, a New Biomarker in Heart Failure?. Suska, Anke Linköping University, Department of Physics, ... Salivary α-amylase activity is an increasingly investigated biomarker for the activation of the autonomic nervous system. ... Within the control group separately, higher daily salivary α-amylase activity output correlated with increasing levels of NT- ...
more infohttp://www.diva-portal.org/smash/record.jsf?pid=diva2:588790

SMART: Pfam domain Alpha-amylaseSMART: Pfam domain Alpha-amylase

... such as alpha-amylase, belong to family 13 of the glycosyl hydrolases. The maltogenic alpha-amylase is an enzyme which ... Alpha-amylase. PFAM accession number:. PF00128. Interpro abstract (IPR006047):. O-Glycosyl hydrolases (EC 3.2.1.) are a ... The domain within your query sequence starts at position 36 and ends at position 271; the E-value for the Alpha-amylase domain ... For full annotation and more information, please see the PFAM entry Alpha-amylase ...
more infohttp://smart.embl.de/smart/do_annotation.pl?DOMAIN=Pfam:Alpha-amylase&START=36&END=271&E_VALUE=1.4e-21&TYPE=PFAM&BLAST=WVDIAKECERYLAPNGFAGVQVSPPNENIVVHSPSRPWWERYQPISYKICSRSGNEDEFRDMVNRCNNVGVRIYVDAVINHMCGVGAQAGQSSTCGSYFNPNNRDFPGVPYSGFDFNDGKCRTASGGIENYQDAAQVRDCRLSGLLDLALEKDYVRTKVADYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNTKWFSQGSRPFIFQEVIDLGGEAVSSNEYFGNGRVTEF

Alpha-amylase - WikipediaAlpha-amylase - Wikipedia

The alpha-Amylase Protein alpha-Amylase at the US National Library of Medicine Medical Subject Headings (MeSH) This article ... α-Amylase is a protein enzyme EC 3.2.1.1 that hydrolyses alpha bonds of large, alpha-linked polysaccharides, such as starch and ... See amylase for more uses of the amylase family in general. α-Amylase has exhibited efficacy in degrading polymicrobial ... Medical laboratories will usually measure either pancreatic amylase or total amylase. If only pancreatic amylase is measured, ...
more infohttps://en.wikipedia.org/wiki/Alpha-amylase

Novozymes releases new alpha-amylase effective at low pH  : Biofuels DigestNovozymes releases new alpha-amylase effective at low pH : Biofuels Digest

Novozymes releases new alpha-amylase effective at low pH. September 22, 2015 , Meghan Sapp ... Liquozyme LpH is an alpha-amylase effective at low pH that thins the mash by breaking down starch into shorter dextrin chains. ...
more infohttp://www.biofuelsdigest.com/bdigest/2015/09/22/novozymes-releases-new-alpha-amylase-effective-at-low-ph/

high temperature alpha amylase - Wholesale  high temperature alpha amylasehigh temperature alpha amylase - Wholesale high temperature alpha amylase

... buy latest high temperature alpha amylase direct from 639 high temperature alpha amylase Factories. ... alpha amylase enzyme alpha amylase enzymes alpha amylase proteases an alpha amylase alpha amylase of alpha amylase ... high temperature alpha amylase. All high temperature alpha amylase wholesalers & high temperature alpha amylase manufacturers ... High Temperature Alpha Amylase Brewing Enzymes Non - GMO For Soy Sauce Brewing Food Grade Heat-stable Alpha-Amylase LIQMEI FD A ...
more infohttp://www.spintoband.com/wholesale-high-temperature-alpha-amylase

Alpha amylase inhibitor - WikipediaAlpha amylase inhibitor - Wikipedia

In molecular biology, alpha-amylase inhibitor is a protein family which inhibits mammalian alpha-amylases specifically, by ... 1 complex with alpha-amylase. This family of inhibitors has no action on plant and microbial alpha amylases. A crystal ... The binding of tendamistat to alpha-amylase leads to the steric blockage of the active site of the enzyme. The crystal ... König V, Vértesy L, Schneider TR (October 2003). "Structure of the alpha-amylase inhibitor tendamistat at 0.93 A". Acta ...
more infohttps://en.wikipedia.org/wiki/Alpha_amylase_inhibitor

Biochemical, Nutritional and Toxicological Aspects of Alpha-Amylase Inhibitors from Plant Foods | SpringerLinkBiochemical, Nutritional and Toxicological Aspects of Alpha-Amylase Inhibitors from Plant Foods | SpringerLink

... paper is a critical review of the available data on plant protein inhibitors active either on animal or endogenous plant alpha- ... amylases. The First Section is a review of available data on... ... alpha-amylase inhibitor with porcine pancreatic alpha-amylase. ... Some aspects of the mechanism of complexation of red kidney bean alpha-amylase inhibitor and alpha-amylase. Biochemistry, 23, ... Saunders, R.M. (1975). Alpha-amylase inhibitors in wheat and other cereals. Cereal Fd. World, 20, 282-285.Google Scholar ...
more infohttps://link.springer.com/chapter/10.1007/978-1-4757-0022-0_28

Inhibitory Effect of Heracleum persicum and Ziziphus jujuba on Activity of Alpha-AmylaseInhibitory Effect of Heracleum persicum and Ziziphus jujuba on Activity of Alpha-Amylase

... Reza Afrisham,1 Mohammad Aberomand,2 ... J.-S. Kim, C.-S. Kwon, and K. H. Son, "Inhibition of alpha-glucosidase and amylase by leuteolin, a flavanoid," Bioscience, ... R. S. Abu Soud, I. I. Hamdan, and F. U. Afifi, "Alpha amylase inhibitory activity of some plant extracts with hypoglycemic ... K. Karthic, K. S. Kirthiram, S. Sadasivam, B. Thayumanavan, and T. Palvannan, "Identification of alpha amylase inhibitors from ...
more infohttps://www.hindawi.com/journals/jb/2015/824683/ref/
  • salivary - AMY1A, AMY1B, AMY1C pancreatic - AMY2A, AMY2B α-Amylase activity in grain is measured by, for instance, the Hagberg-Perten Falling Number, a test to assess sprout damages, or the Phadebas method. (wikipedia.org)
  • Increased plasma levels in humans are found in: Salivary trauma (including anaesthetic intubation) Mumps - due to inflammation of the salivary glands Pancreatitis - because of damage to the cells that produce amylase Renal failure - due to reduced excretion Total amylase readings of over 10 times the upper limit of normal (ULN) are suggestive of pancreatitis. (wikipedia.org)
  • Optimum pH - 7.0 Human body temperature[citation needed] Presence of certain anions and activators: Chloride and bromide - most effective Iodide - less effective Sulfate and phosphate - least effective The salivary amylase gene has undergone duplication during evolution, and DNA hybridization studies indicate many individuals have multiple tandem repeats of the gene. (wikipedia.org)
  • For example, a Japanese individual had 14 copies of the amylase gene (one allele with 10 copies, and a second allele with four copies). (wikipedia.org)
  • Perry and colleagues speculated the increased copy number of the salivary amylase gene may have enhanced survival coincident to a shift to a starchy diet during human evolution. (wikipedia.org)
  • This gene encodes an amylase isoenzyme produced by the pancreatic gland. (acris-antibodies.com)
  • Mouse pancreatic sections were fixed in 4% paraformaldehyde and used for immunohistochemistry using rabbit anti-amylase antibody at a dilution of 1:100. (sigmaaldrich.com)
  • The first step in the production of high-fructose corn syrup is the treatment of cornstarch with α-amylase, producing shorter chains of sugars oligosaccharides. (wikipedia.org)
  • In support of reservoir clean-up needs, Verenium's Eradicake™ alpha-amylase product addresses the removal of filter cake from the wellbore wall, a critical step in the drilling process. (synbioproject.org)
  • α-Amylase is used in ethanol production to break starches in grains into fermentable sugars. (wikipedia.org)
  • Measurement of amylase concentrations in serum is a diagnostic test for various pancreatic disorders (especially acute and relapsing pancreatitis). (abcam.com)
  • Results: Within the whole group of participants, a statistically significant positive correlation between morning salivary α-amylase activity levels and serum NT-proBNP could be found, which was strongest for the measurement taken 30 minutes after awakening, as well as a significant negative correlation of awakening α-amylase activity levels with arterial blood pressure. (diva-portal.org)
  • Eradicake™ alpha-amylase performs at higher temperatures and across a wider range of operating conditions than competitive products. (synbioproject.org)