AnatomyOrganismsDiseasesChemicals and DrugsTechnology, Industry, AgricultureHumanitiesInformation Science
Salivary alpha-AmylasesAmylasesalpha-AmylasesSialorrheaSalivaPancreasParotid Glandalpha 1-AntitrypsinStarchEncyclopedias as TopicMaltosePancreatic JuiceCapnocytophagaCytophagaceaeTriboliumBeetlesInsect ProteinsMethopreneJuvenile HormonesFlourGlucagon-Secreting CellsGlucagonEmeticsHeart FailureBiological MarkersCalcium CarbonatePolymersHydrochloric AcidEngraving and EngravingsRare BooksSalivary GlandsSalivary Glands, MinorLipSjogren's SyndromeSialadenitis
Salivary alpha-Amylases
A subclass of alpha-amylase ISOENZYMES that are secreted into SALIVA.
Amylases
A group of amylolytic enzymes that cleave starch, glycogen, and related alpha-1,4-glucans. (Stedman, 25th ed) EC 3.2.1.-.
alpha-Amylases
Enzymes that catalyze the endohydrolysis of 1,4-alpha-glycosidic linkages in STARCH; GLYCOGEN; and related POLYSACCHARIDES and OLIGOSACCHARIDES containing 3 or more 1,4-alpha-linked D-glucose units.
Sialorrhea
Increased salivary flow.
Saliva
The clear, viscous fluid secreted by the SALIVARY GLANDS and mucous glands of the mouth. It contains MUCINS, water, organic salts, and ptylin.
Pancreas
A nodular organ in the ABDOMEN that contains a mixture of ENDOCRINE GLANDS and EXOCRINE GLANDS. The small endocrine portion consists of the ISLETS OF LANGERHANS secreting a number of hormones into the blood stream. The large exocrine portion (EXOCRINE PANCREAS) is a compound acinar gland that secretes several digestive enzymes into the pancreatic ductal system that empties into the DUODENUM.
Parotid Gland
The largest of the three pairs of SALIVARY GLANDS. They lie on the sides of the FACE immediately below and in front of the EAR.
alpha 1-Antitrypsin
Plasma glycoprotein member of the serpin superfamily which inhibits TRYPSIN; NEUTROPHIL ELASTASE; and other PROTEOLYTIC ENZYMES.
Starch
Any of a group of polysaccharides of the general formula (C6-H10-O5)n, composed of a long-chain polymer of glucose in the form of amylose and amylopectin. It is the chief storage form of energy reserve (carbohydrates) in plants.
Encyclopedias as Topic
Works containing information articles on subjects in every field of knowledge, usually arranged in alphabetical order, or a similar work limited to a special field or subject. (From The ALA Glossary of Library and Information Science, 1983)
Maltose
A dextrodisaccharide from malt and starch. It is used as a sweetening agent and fermentable intermediate in brewing. (Grant & Hackh's Chemical Dictionary, 5th ed)
Pancreatic Juice
The fluid containing digestive enzymes secreted by the pancreas in response to food in the duodenum.
Capnocytophaga
A gram-negative gliding bacterium isolated from the oral cavity. It is a pathogen often causing PERIODONTITIS.
Cytophagaceae
A family of gram-negative, gliding bacteria in the order Cytophagales, class Cytophagia. They are found in SOIL and SEA WATER.
Tribolium
A genus of small beetles of the family Tenebrionidae; T. confusum is the "confused flour beetle".
Beetles
INSECTS of the order Coleoptera, containing over 350,000 species in 150 families. They possess hard bodies and their mouthparts are adapted for chewing.
Insect Proteins
Proteins found in any species of insect.
Methoprene
Juvenile hormone analog and insect growth regulator used to control insects by disrupting metamorphosis. Has been effective in controlling mosquito larvae.
Juvenile Hormones
Compounds, either natural or synthetic, which block development of the growing insect.
Flour
Ground up seed of WHEAT.
Glucagon-Secreting Cells
A type of pancreatic cell representing about 5-20% of the islet cells. Alpha cells secrete GLUCAGON.
Glucagon
A 29-amino acid pancreatic peptide derived from proglucagon which is also the precursor of intestinal GLUCAGON-LIKE PEPTIDES. Glucagon is secreted by PANCREATIC ALPHA CELLS and plays an important role in regulation of BLOOD GLUCOSE concentration, ketone metabolism, and several other biochemical and physiological processes. (From Gilman et al., Goodman and Gilman's The Pharmacological Basis of Therapeutics, 9th ed, p1511)
Emetics
Agents that cause vomiting. They may act directly on the gastrointestinal tract, bringing about emesis through local irritant effects, or indirectly, through their effects on the chemoreceptor trigger zone in the postremal area near the medulla.
Heart Failure
A heterogeneous condition in which the heart is unable to pump out sufficient blood to meet the metabolic need of the body. Heart failure can be caused by structural defects, functional abnormalities (VENTRICULAR DYSFUNCTION), or a sudden overload beyond its capacity. Chronic heart failure is more common than acute heart failure which results from sudden insult to cardiac function, such as MYOCARDIAL INFARCTION.
Biological Markers
Measurable and quantifiable biological parameters (e.g., specific enzyme concentration, specific hormone concentration, specific gene phenotype distribution in a population, presence of biological substances) which serve as indices for health- and physiology-related assessments, such as disease risk, psychiatric disorders, environmental exposure and its effects, disease diagnosis, metabolic processes, substance abuse, pregnancy, cell line development, epidemiologic studies, etc.
Calcium Carbonate
Carbonic acid calcium salt (CaCO3). An odorless, tasteless powder or crystal that occurs in nature. It is used therapeutically as a phosphate buffer in hemodialysis patients and as a calcium supplement.
Polymers
Compounds formed by the joining of smaller, usually repeating, units linked by covalent bonds. These compounds often form large macromolecules (e.g., BIOPOLYMERS; PLASTICS).
Hydrochloric Acid
A strong corrosive acid that is commonly used as a laboratory reagent. It is formed by dissolving hydrogen chloride in water. GASTRIC ACID is the hydrochloric acid component of GASTRIC JUICE.
Engraving and Engravings
Rare Books
Salivary Glands
Glands that secrete SALIVA in the MOUTH. There are three pairs of salivary glands (PAROTID GLAND; SUBLINGUAL GLAND; SUBMANDIBULAR GLAND).
Salivary Glands, Minor
Accessory salivary glands located in the lip, cheek, tongue, floor of mouth, palate and intramaxillary.
Lip
Either of the two fleshy, full-blooded margins of the mouth.
Sjogren's Syndrome
Chronic inflammatory and autoimmune disease in which the salivary and lacrimal glands undergo progressive destruction by lymphocytes and plasma cells resulting in decreased production of saliva and tears. The primary form, often called sicca syndrome, involves both KERATOCONJUNCTIVITIS SICCA and XEROSTOMIA. The secondary form includes, in addition, the presence of a connective tissue disease, usually rheumatoid arthritis.
Sialadenitis
INFLAMMATION of salivary tissue (SALIVARY GLANDS), usually due to INFECTION or injuries.

Inhibition of plant-pathogenic fungi by a corn trypsin inhibitor overexpressed in Escherichia coli. (1/1178)

The cDNA of a 14-kDa trypsin inhibitor (TI) from corn was subcloned into an Escherichia coli overexpression vector. The overexpressed TI was purified based on its insolubility in urea and then refolded into the active form in vitro. This recombinant TI inhibited both conidium germination and hyphal growth of all nine plant pathogenic fungi studied, including Aspergillus flavus, Aspergillus parasiticus, and Fusarium moniliforme. The calculated 50% inhibitory concentration of TI for conidium germination ranged from 70 to more than 300 microgram/ml, and that for fungal growth ranged from 33 to 124 microgram/ml depending on the fungal species. It also inhibited A. flavus and F. moniliforme simultaneously when they were tested together. The results suggest that the corn 14-kDa TI may function in host resistance against a variety of fungal pathogens of crops.  (+info)

Insertion analysis of putative functional elements in the promoter region of the Aspergillus oryzae Taka-amylase A gene (amyB) using a heterologous Aspergillus nidulans amdS-lacZ fusion gene system. (2/1178)

Expression of the Taka-amylase A gene (amyB) of Aspergillus oryzae is induced by starch or maltose. The A. oryzae amyB gene promoter contains three highly conserved sequences, designated Regions I, II, and III, compared with promoter regions of the A. oryzae glaA encoding glucoamylase and the agdA encoding alpha-glucosidase. To identify the function of these sequences within the amyB promoter, various fragments containing conserved sequences in the amyB promoter were introduced into the upstream region of the heterologous A. nidulans amdS gene (encoding acetamidase) fused to the Escherichia coli lacZ gene as a reporter. Introduction of the sequence between -290 to -233 (the number indicates the distance in base pairs from the translation initiation point (+1)) containing Region III significantly increased the expression of the lacZ reporter gene in the presence of maltose. The sequence between -377 to -290 containing Region I also increased the lacZ activity, but its maltose inducibility was less than that of Region III. The sequence between -233 to -181 containing Region II had no effect on the expression. These results indicated that Region III is most likely involved in the maltose induction of the amyB gene expression.  (+info)

Overexpression of BiP in tobacco alleviates endoplasmic reticulum stress. (3/1178)

To study the role of the lumenal binding protein (BiP) in the transport and secretion of proteins, we have produced plants with altered BiP levels. Transgenic plants overexpressing BiP showed dramatically increased BiP mRNA levels but only a modest increase in BiP protein levels. The presence of degradation products in BiP overproducers suggests a regulatory mechanism that increases protein turnover when BiP is abundant. Antisense inhibition of BiP synthesis was not successful, demonstrating that even a minor reduction in the basal BiP level is deleterious to cell viability. Overexpression of BiP leads to downregulation of the basal transcript levels of endogenous BiP genes and greatly reduces the unfolded protein response. The data confirm that BiP transcription is regulated via a feedback mechanism that involves monitoring of BiP protein levels. To test BiP activity in vivo, we designed a functional assay, using the secretory protein alpha-amylase and a cytosolic enzyme as a control for cell viability. During tunicamycin treatment, an overall reduction of alpha-amylase synthesis was observed when compared with the cytosolic marker. We show that the tunicamycin effect is due to the depletion of BiP in the endoplasmic reticulum because coexpressed BiP alone is able to restore efficient alpha-amylase synthesis. This is a novel assay to monitor BiP activity in promoting secretory protein synthesis in vivo.  (+info)

Differential dependence of levansucrase and alpha-amylase secretion on SecA (Div) during the exponential phase of growth of Bacillus subtilis. (4/1178)

SecA, the translocation ATPase of the preprotein translocase, accounts for 0.25% of the total protein in a degU32(Hy) Bacillus subtilis strain in logarithmic phase. The SecA level remained constant irrespective of the demand for exoprotein production but dropped about 12-fold during the late stationary phase. Modulation of the level of functional SecA during the exponential phase of growth affected differently the secretion of levansucrase and alpha-amylase overexpressed under the control of the sacB leader region. The level of SecA was reduced in the presence of sodium azide and in the div341 thermosensitive mutant at nonpermissive temperatures. Overproduction of SecA was obtained with a multicopy plasmid bearing secA. The gradual decrease of the SecA level reduced the yield of secreted levansucrase with a concomitant accumulation of unprocessed precursor in the cells, while an increase in the SecA level resulted in an elevation of the production of exocellular levansucrase. In contrast, alpha-amylase secretion was almost unaffected by high concentrations of sodium azide or by very low levels of SecA. Secretion defects were apparent only under conditions of strong SecA deprivation of the cell. These data demonstrate that the alpha-amylase and levansucrase precursors markedly differ in their dependency on SecA for secretion. It is suggested that these precursors differ in their binding affinities for SecA.  (+info)

Genetic regulation of tissue-specific expression of amylase structural genes in Drosophila melanogaster. (5/1178)

Laboratory strains of Drosophila melanogaster were screened for spatial variations in adult midgut alpha-amylase (1,4-alpha-D-glucan glucanohydrolase, EC 3.2.1.1) expression. No strain-specific differences were found anteriorly, but three patterns of activity were discerned in the posterior midgut: A, activity throughout most of the region; B, activity in the anterior part of the region; and C, little or no activity. Alleles of a control gene, map, are responsible for this tissue-specific regulation of activity; e.g., mapA homozygotes produce the A pattern and mapC homozygotes the C pattern. The map locus was placed at 2--80 +/- on the genetic map of chromosome 2R, about two crossover units distal to the Amy structural gene region for alpha-amylase. Electrophoretic studies showed that mapA is trans acting in mapA/mapC flies, allowing expression of amylase isozymes coded for by genes on the opposite chromosome. The map gene behaves as a temporal gene that is clearly separable from the tightly linked, duplicated Amy structural genes.  (+info)

Molecular cloning and primary structure analysis of porcine pancreatic alpha-amylase. (6/1178)

A cDNA library was constructed in a Uni-ZAP XR vector using mRNA isolated from porcine pancreas. A full-length alpha-amylase cDNA was obtained using a combination of library screening and nested polymerase chain reaction. Sequencing of the clone revealed a 1536-nucleotide (nt) open reading frame encoding a protein of 496 amino acid (aa) residues with a signal peptide of 15 aa. The calculated molecular mass of the enzyme was 55354 Da, in accordance with those of the purified porcine pancreatic alpha-amylase forms (PPAI and PPAII) as determined by mass spectrometry. A comparison of the deduced aa sequence with published peptidic sequences of PPAI identified a number of mismatches. The sequence of the cDNA reported here provides a sequence reference for PPA in excellent agreement with the refined three-dimensional structures of both PPAI and PPAII. No evidence for a second variant was found in the cDNA library and it is most likely that PPAI and PPAII are two forms of the same protein. The primary structure of PPA shows high homology with human, mouse and rat pancreatic alpha-amylases. The 304-310 region, corresponding to a mobile loop involved in substrate binding and processing near the active site, is fully conserved.  (+info)

Cloning, mutagenesis, and structural analysis of human pancreatic alpha-amylase expressed in Pichia pastoris. (7/1178)

Human pancreatic alpha-amylase (HPA) was expressed in the methylotrophic yeast Pichia pastoris and two mutants (D197A and D197N) of a completely conserved active site carboxylic acid were generated. All recombinant proteins were shown by electrospray ionization mass spectrometry (ESI-MS) to be glycosylated and the site of attachment was shown to be Asn461 by peptide mapping in conjunction with ESI-MS. Treatment of these proteins with endoglycosidase F demonstrated that they contained a single N-linked oligosaccharide and yielded a protein product with a single N-acetyl glucosamine (GlcNAc), which could be crystallized. Solution of the crystal structure to a resolution of 2.0 A confirmed the location of the glycosyl group as Asn461 and showed that the recombinant protein had essentially the same conformation as the native enzyme. The kinetic parameters of the glycosylated and deglycosylated wild-type proteins were the same while the k(cat)/Km values for D197A and D197N were 10(6)-10(7) times lower than the wild-type enzyme. The decreased k(cat)/Km values for the mutants confirm that D197 plays a crucial role in the hydrolytic activity of HPA, presumably as the catalytic nucleophile.  (+info)

Chemical modification of lysine side chains of cyclodextrin glycosyltransferase from Thermoanaerobacter causes a shift from cyclodextrin glycosyltransferase to alpha-amylase specificity. (8/1178)

Cyclodextrin glycosyltransferases and alpha-amylases are two groups of enzymes with related secondary structures. However, cyclodextrin glycosyltransferases display transferase activities not present in alpha-amylases, probably derived from the existence of two more domains and different amino acid sequences. The hydrolytic activity of cyclodextrin glycosyltransferases is generally quite low, except for two cyclodextrin glycosyltransferases from termophiles. In this work, we have carried out the chemical modification (with acetic anhydride) of the amino groups of cyclodextrin glycosyltransferase from Thermoanaerobacter to assess their contributions to protein function. The acetylated cyclodextrin glycosyltransferase showed a significant reduction of its cyclization, coupling and disproportionation activities. Surprisingly, the hydrolytic (saccharifying) activity was slightly enhanced. These results suggest the participation of one or more lysine side chains in the interactions contributing to the transferase activity, either in any of the S11 subsites or in the acceptor binding site.  (+info)

Barley alpha-amylase bound to its endogenous protein inhibitor BASI: crystal structure of the complex at 1.9 A resolution<...Barley alpha-amylase bound to its endogenous protein inhibitor BASI: crystal structure of the complex at 1.9 A resolution<...
TY - JOUR. T1 - Barley alpha-amylase bound to its endogenous protein inhibitor BASI: crystal structure of the complex at 1.9 A resolution. AU - Vallée, F.. AU - Kadziola, A.. AU - Bourne, Y.. AU - Juy, M.. AU - Rodenburg, K. W.. AU - Svensson, Birte. AU - Haser, R.. PY - 1998. Y1 - 1998. N2 - Barley alpha-amylase is a 45 kDa enzyme which is involved in starch degradation during barley seed germination. The released sugars provide the plant embryo with energy for growth. The major barley alpha-amylase isozyme (AMY2) binds with high affinity to the endogenous inhibitor BASI (barley alpha-amylase/subtilisin inhibitor) whereas the minor isozyme (AMY1) is not inhibited. BASI is a 19.6 kDa bifunctional protein that can simultaneously inhibit AMY2 and serine proteases of the subtilisin family. This inhibitor may therefore prevent degradation of the endosperm starch during premature sprouting and protect the seed from attack by pathogens secreting proteases. RESULTS: The crystal structure of AMY2 in ...
https://orbit.dtu.dk/en/publications/barley-alpha-amylase-bound-to-its-endogenous-protein-inhibitor-ba
VARIANTS OF BACILLUS LICHENIFORMIS ALPHA-AMYLASE WITH INCREASED THERMOSTABILITY AND/OR DECREASED CALCIUM DEPENDENCE - Patent...VARIANTS OF BACILLUS LICHENIFORMIS ALPHA-AMYLASE WITH INCREASED THERMOSTABILITY AND/OR DECREASED CALCIUM DEPENDENCE - Patent...
611536DNAArtificial SequenceDescription of Artificial Sequence Synthetic polynucleotide 1atgaaacaac aaaaacggct ttacgcccga ttgctgacgc tgttatttgc gctcatcttc 60ttgctgcctc attctgcagc ttcagcagca aatcttaatg ggacgctgat gcagtatttt 120gaatggtaca tgcccaatga cggccaacat tggaagcgtt tgcaaaacga ctcggcatat 180ttggctgaac acggtattac tgccgtctgg attcccccgg catataaggg aacgagccaa 240gcggatgtgg gctacggtgc ttacgacctt tatgatttag gggagtttca tcaaaaaggg 300acggttcgga caaagtacgg cacaaaagga gagctgcaat ctgcgatcaa aagtcttcat 360tcccgcgaca ttaacgttta cggggatgtg gtcatcaacc acaaaggcgg cgctgatgcg 420accgaagatg taaccgcggt tgaagtcgat cccgctgacc gcaaccgcgt aatttcagga 480gaacacctaa ttaaagcctg gacacatttt cattttccgg ggcgcggcag cacatacagc 540gattttaaat ggcattggta ccattttgac ggaaccgatt gggacgagtc ccgaaagctg 600aaccgcatct ataagtttca aggaaaggct tgggattggg aagtttccaa tgaaaacggc 660aactatgatt atttgatgta tgccgacatc gattatgacc atcctgatgt cgcagcagaa 720attaagagat ggggcacttg gtatgccaat gaactgcaat tggacggttt ccgtcttgat 780gctgtcaaac acattaaatt ...
http://www.patentsencyclopedia.com/app/20090238923
Alive White Kidney Bean Extract - Carbohydrate Neutralizer - Alive Health Centre BlogAlive White Kidney Bean Extract - Carbohydrate Neutralizer - Alive Health Centre Blog
in North America! We love pizzas, breads, pastas, potatoes and pretty much anything starchy! It is almost impossible for someone to cut them out completely because life has to be somewhat enjoyable and lets face it, a freshly baked Italian loaf of bread with some butter on it is to die for. White Kidney Bean is a starch neutralizer and is a healthy way to sneak some of your favourite meals in, such as a beautiful pasta dinner without feeling guilty.. What is White Kidney Bean? And HOW does it Work?. Through numerous studies, White Kidney Bean has been found effective in neutralizing carbohydrates safely! White Kidney Bean prevents starch from being converted into sugar and eventually into fat! When White Kidney Bean is consumed before a starchy meal, it later excretes a solid waste of starch (carbohydrates)! White Kidney Bean works by binding itself to the enzyme Amylase which is produced by the pancreas and thus does not convert starch into sugar. Diabetics may also benefit from White Kidney ...
https://www.alivehealthblog.com/2014/03/18/alive-white-kidney-bean-extract-carbohydrate-neutralizer/
Publications | Page 2 | GMR | Genetics and Molecular Research | The Original by FUNPEC-RPPublications | Page 2 | GMR | Genetics and Molecular Research | The Original by FUNPEC-RP
Asghari SM,Khajeh K,Ranjbar B,Sajedi RH,et al. (2004). Comparative studies on trifluoroethanol (TFE) state of a thermophilic alpha-amylase and its mesophilic counterpart: limited proteolysis, conformational analysis, aggregation and reactivation of the enzymes. Int. J. Biol. Macromol. 34: 173-179. http://dx.doi.org/10.1016/j.ijbiomac.2004.03.006 PMid:15225989 Azad MA, Bae JH, Kim JS, Lim JK, et al. (2009). Isolation and characterization of a novel thermostable alpha-amylase from Korean pine seeds. N. Biotechnol. 26: 143-149. http://dx.doi.org/10.1016/j.nbt.2009.09.006 PMid:19772955 Declerck N, Machius M, Wiegand G, Huber R, et al. (2000). Probing structural determinants specifying high thermostability in Bacillus licheniformis alpha-amylase. J. Mol. Biol. 301: 1041-1057. http://dx.doi.org/10.1006/jmbi.2000.4025 PMid:10966804 Dong Y,Liu Y,Chen Y,Niu D,et al. (2008). Purification and characterization of thermostable amylases from two bacterial species. Wei Sheng Wu Xue Bao 48: 169-175. ...
https://geneticsmr.com/publications?page=1&f%5Bauthor%5D=3614
Immunohistochemical and immunoelectron microscopic analyses of alpha-amylase isozymes in human intrahepatic biliary epithelium...Immunohistochemical and immunoelectron microscopic analyses of alpha-amylase isozymes in human intrahepatic biliary epithelium...
Terada, T.; Kono, N.; Nakanuma, Y., 1992: Immunohistochemical and immunoelectron microscopic analyses of alpha-amylase isozymes in human intrahepatic biliary epithelium and hepatocytes
https://geoscience.net/research/008/820/008820066.php
Horizontal gene transfer from Eukarya to Bacteria and domain shuffling: the alpha-amylase model - Da Lage J. L.Horizontal gene transfer from Eukarya to Bacteria and domain shuffling: the alpha-amylase model - Da Lage J. L.
en] alpha-Amylases are present in all kingdoms of the living world. Despite strong conservation of the tertiary structure, only a few amino acids are conserved in interkingdom comparisons. Animal alpha-amylases are characterized by several typical motifs and biochemical properties. A few cases of such alpha-amylases have been previously reported in some eubacterial species. We screened the bacterial genomes available in the sequence databases for new occurrences of animal-like alpha-amylases. Three novel cases were found, which belong to unrelated bacterial phyla: Chloroflexus aurantiacus, Microbulbifer degradans, and Thermobifida fusca. All the animal-like alpha-amylases in Bacteria probably result from repeated horizontal gene transfer from animals. The M. degradans genome also contains bacterial-type and plant-type alpha-amylases in addition to the animal-type one. Thus, this species exhibits alpha-amylases of animal, plant, and bacterial origins. Moreover, the similarities in the extra ...
http://orbi.ulg.ac.be/handle/2268/15738
White Kidney Beans in Anand,White Kidney Beans Manufacturers and Suppliers from indiaWhite Kidney Beans in Anand,White Kidney Beans Manufacturers and Suppliers from india
Business Directory for White Kidney Beans Suppliers in Anand - Get contact details of White Kidney Beans Manufacturers, Wholesale White Kidney Beans Exporters, Best White Kidney Beans Traders & Distributors Across the Anand.
http://www.indianyellowpages.com/anand/white-kidney-beans.htm
Characterization of a partial alpha-amylase clone from red porgy (Pagrus pagrus): expression during larval development. | BOREA...Characterization of a partial alpha-amylase clone from red porgy (Pagrus pagrus): expression during larval development. | BOREA...
A partial alpha-amylase cDNA was isolated from red porgy (Pagrus pagrus, Teleostei: Sparidae) and its tissue specific expression during larval development was examined. The cDNA was 949 bp long and showed 90% identity with other fish amylases. A 545 bp fragment was used to study amylase expression using in situ hybridization and RT-PCR techniques. Both methods showed a similar pattern: high and relatively constant expression for the first 30 days after hatching (dah), subsequently decreasing until the end of the experiment at 60 dah. The goal of this work was to extend the existing knowledge of the functionality of larval fish digestive systems and to provide new information about alpha-amylase gene expression.. ...
https://borea.mnhn.fr/en/characterization-partial-alpha-amylase-clone-red-porgy-pagrus-pagrus-expression-during-larval
blood sugar - Vivid Health Nutritionblood sugar - Vivid Health Nutrition
What is white kidney bean extract?. White kidney bean extract is sourced from white kidney beans, or, Phaseolus Vulgaris. It is thought to prevent the body from turning excess sugar into fat, and is therefore commonly used in supplements and marketed as a starch blocker or starch inhibitor. White kidney bean extract slows alpha-amylase activity, which is an … Read More ». ...
https://vividhealthnutrition.com/tag/blood-sugar/
Browsing by Author Kreikemeier, K.K.Browsing by Author Kreikemeier, K.K.
Pancreatic alpha-amylase activity was 54% higher in cattle fed at twice maintenance energy than in cattle fed at maintenance and was 52% greater in hay-fed than grain-fed cattle. Increased pancreatic alpha-amylase activity ...
http://krex.k-state.edu/dspace/browse?value=Kreikemeier%2C+K.K.&type=author
Buy White Kidney Bean Extract | Myprotein.comBuy White Kidney Bean Extract | Myprotein.com
White Kidney Bean Extract is extracted from white kidney bean which has been shown to prevent the body from properly digesting starch (carbohydrates).
https://www.myprotein.com/sports-nutrition/white-kidney-bean-extract/10575136.html
Global Alpha-Amylase Baking Enzyme Market is expected to reach USD 320.1 million by 2024: Radiant Insights - ABNewswire - Press...Global Alpha-Amylase Baking Enzyme Market is expected to reach USD 320.1 million by 2024: Radiant Insights - ABNewswire - Press...
Alpha-amylase is used as an important ingredient for the production of baked goods in order to increase the sugar and dextrin content in the finished product. Increasing importance of enzymes as functional additives in food & beverage applications on account of attributing features including good emulsification properties and self-stabilization effects is expected to remain a crucial factor over the next eight years.. Plant-based alpha-amylase demand was 1,682.6 tons in 2015. Plant-based extracts derived from rice, tobacco leaves, corn, potato and beetroot are also used as sources for the production of alpha-amylase. Over the past few years, the research institutes of the U.S. and Canada have introduced numerous publications pertaining to the development of alpha-amylase from DNA sequences of these species.. The report Alpha-Amylase Baking Enzyme Market Analysis by Source [Fungi, Bacteria (Maltogenic, G4), Plant-Based], By Application (Breads, Cookies & Biscuits, Desserts) And Segment Forecasts ...
http://www.abnewswire.com/pressreleases/global-alphaamylase-baking-enzyme-market-is-expected-to-reach-usd-3201-million-by-2024-radiant-insights_78140.html
white kidney bean extract dr oz | Healthy Livingwhite kidney bean extract dr oz | Healthy Living
Excessive consumption of carbohydrates is once of the causes of obesity or weight gain. Whenever you eat carbs such a breads, pastas, cereals, pastas, cereals, cakes, coookies, chips, pizzas, burgers, etc, the digestive enzynme known as alpha amylase breaks down the starches into glucose. Your body uses glucose for energy, but any excess will be stored as fat. This is why consuming too much carbs can easily lead to weight gain.. How does kidney bean extract aid weight loss?. White kidney bean extract, also known as Phaseolus Vulgaris extract, may help to induce weight loss by inhibiting the digestive enzyme, alpha amylase, from breaking down carbs into glucose. By reducing or slowing down digestion of carbs, this decreases the number of carbohydrate calories absorbed and may result in weight loss.. ...
http://bestweightlosstea.net/tag/white-kidney-bean-extract-dr-oz
Alpha-amylase activity in blood increases after pharmacological, but not psychological, activation of the adrenergic system -...Alpha-amylase activity in blood increases after pharmacological, but not psychological, activation of the adrenergic system -...
TrendTerms displays relevant terms of the abstract of this publication and related documents on a map. The terms and their relations were extracted from ZORA using word statistics. Their timelines are taken from ZORA as well. The bubble size of a term is proportional to the number of documents where the term occurs. Red, orange, yellow and green colors are used for terms that occur in the current document; red indicates high interlinkedness of a term with other terms, orange, yellow and green decreasing interlinkedness. Blue is used for terms that have a relation with the terms in this document, but occur in other documents ...
http://www.zora.uzh.ch/id/eprint/112389/
Block Carbohydrates with White Kidney Bean Extract - eVitamins MéxicoBlock Carbohydrates with White Kidney Bean Extract - eVitamins México
White kidney bean extract prevents your body from absorbing carbohydrates and starches to help you lose weight. Find out how it works. Learn more at eVitamins México.
https://www.evitamins.com/mx/a/block-carbohydrates-with-white-kidney-bean-extract-245
Block Carbohydrates with White Kidney Bean Extract - eVitamins SchweizBlock Carbohydrates with White Kidney Bean Extract - eVitamins Schweiz
White kidney bean extract prevents your body from absorbing carbohydrates and starches to help you lose weight. Find out how it works. Learn more at eVitamins Schweiz.
https://www.evitamins.com/de-ch/a/block-carbohydrates-with-white-kidney-bean-extract-245
White Kidney Bean Extract - 100% Pure Carb Blocker - Keto Carb Blocker- Double Dragon Organics (60 Caps / 600MG) | Double...White Kidney Bean Extract - 100% Pure Carb Blocker - Keto Carb Blocker- Double Dragon Organics (60 Caps / 600MG) | Double...
$14.98 on Amazon: White Kidney Bean Extract ASIN:B07MJQMYP2 ✅POWERFUL NATURAL CARBOHYDRATE BLOCKER ✅100% MONEY BACK GUARANTEE ✅RELIABLE - Third party safety…
https://doubledragonorganics.com/product/white-kidney-bean-extract-60-caps-600mg/
White Kidney Bean Extract 60 Capsules - Order White Kidney Bean | Weight Loss PharmacyWhite Kidney Bean Extract 60 Capsules - Order White Kidney Bean | Weight Loss Pharmacy
Kidney - By this sudden change, the low grounds were parched, and vegetation destroyed, giving rise to an abundant production of vegetable miasm; and it was not suprising that malarious fever was produced.
http://www.pinkmail.org/white-kidney-bean-extract-60-capsules/
Private Label White Kidney Bean Extract | Vox NutritionPrivate Label White Kidney Bean Extract | Vox Nutrition
Order White Kidney Bean Extract from Vox Nutrition to get the fastest turn around time in the industry. Click or Call to place your order today 800-795-7161
http://www.voxnutrition.com/products/white-kidney-bean-extract/
White Kidney Bean Extract for weight loss | Alivebynature - Evidence Based ReviewsWhite Kidney Bean Extract for weight loss | Alivebynature - Evidence Based Reviews
A study, published in the Internal Journal of Medical Science, conducted a double-blind, placebo-controlled study, in which 60 slightly overweight people were given either placebo or Phase 2, a highly concentrated phaseolus extract, once daily.. This single daily dose was given 30 minutes prior to a large meal rich in carbohydrates. Over the 30 days of the study, subjects receiving Phaseolus vulgaris extract had significantly greater reduction of body weight, BMI, fat mass, adipose tissue thickness, and waist/hip/ thigh circumferences while maintaining lean body mass compared to subjects receiving placebo.. research notes: Layer, P., et al. Effect of purified amylase inhibitor on carbohydrate tolerance in normal subjects and patients with diabetes mellitus. MAYO Clinic Proceedings 61, 6 (June, 1986) 442-447.. Brugge, W.R. and M. S. Rosenfeld. Impairment of starch absorption by a potent amylase inhibitor. American Journal of Gastroenterology 82, 8 (August, 1987) 718-722.. Layer, P., et al. ...
http://alivebynature.com/white-kidney-bean-extract-for-weight-loss/
Eradicake Alpha-AmylaseEradicake Alpha-Amylase
Laboratory and field tests have shown the effectiveness of Eradicake™ alpha-amylase in breaking down filter cake created by starch-based drilling muds. Using Eradicake™ alpha-amylase to break down the polymer structures of filter cake is easy and convenient (no specialized equipment is required), and safe for the operator and the environment. This product has been shown to remove filter cake from lengthy sections of a horizontal reservoir by a non-aggressive chemical reaction. This performance contrasts sharply with conventional approaches, such as the use of hydrochloric acid (HCl), which reacts aggressively with calcium carbonate (CaCo3) reservoirs and is suspected of creating wormholes that lead to formation damage and blockage of formation pores. This, in turn, can restrict the flow of hydrocarbons to the wellbore and limit well productivity. Eradicake™ alpha-amylase performs at higher temperatures and across a wider range of operating conditions than competitive products. This ...
http://www.synbioproject.org/cpi/applications/eradicake-alpha-amylase/
Study on the improvement of hypoenzymatic wheat flour-Gabriela Constantinescu, Amelia Buculei, Monica DinuStudy on the improvement of hypoenzymatic wheat flour-Gabriela Constantinescu, Amelia Buculei, Monica Dinu
Due to the changes that occurred in the baking industry and the growing demand for natural products, clean label enzymes have gained more importance in the bread-making recipes in replacing additives such as oxidants or emulsifiers. The use of amylase from cereal, fungal or bacterial sources is known for many years. However, it is well acknowledged that cereal amylases, such as beta-amylase from soy flour or malt alpha-amylase and fungal ones have a limited effect against aging, whereas bacterial thermostable alpha-amylase has adverse effect on the quality of the finished products, leading to gummy and sticky crumb. Commercial amylases used in the baking industry are, in general, alpha-amylase, which hydrolyzes specifically, alpha-1,4-glycosidic linkages of amylose and amylopectin molecules in the starch. Based on these considerations, the aim of this study was to study the effect of lack of alpha- amylase in wheat flour used in the process of bread making. In this context, we intended to study ...
http://journal-of-agroalimentary.ro/Journal-of-Agroalimentary-Processes-and-Technologies-Article_XXWQPo.html
Study on the improvement of hypoenzymatic wheat flour-Gabriela Constantinescu, Amelia Buculei, Monica DinuStudy on the improvement of hypoenzymatic wheat flour-Gabriela Constantinescu, Amelia Buculei, Monica Dinu
Due to the changes that occurred in the baking industry and the growing demand for natural products, clean label enzymes have gained more importance in the bread-making recipes in replacing additives such as oxidants or emulsifiers. The use of amylase from cereal, fungal or bacterial sources is known for many years. However, it is well acknowledged that cereal amylases, such as beta-amylase from soy flour or malt alpha-amylase and fungal ones have a limited effect against aging, whereas bacterial thermostable alpha-amylase has adverse effect on the quality of the finished products, leading to gummy and sticky crumb. Commercial amylases used in the baking industry are, in general, alpha-amylase, which hydrolyzes specifically, alpha-1,4-glycosidic linkages of amylose and amylopectin molecules in the starch. Based on these considerations, the aim of this study was to study the effect of lack of alpha- amylase in wheat flour used in the process of bread making. In this context, we intended to study ...
http://journal-of-agroalimentary.ro/Journal-of-Agroalimentary-Processes-and-Technologies-Article_iihONm.html
enzyme from china - Dyes And Chemicals - Enzymesenzyme from china - Dyes And Chemicals - Enzymes
We Supply Enzyme like: 1.Glucoamylase(high activity) 2.Medium temperature alpha-Amylase(2000-3000u/ml) 3.Thermostable alpha-amylase(80000u/ml,120000u/g) 4.
http://www.yarnsandfibers.com/preferredsupplier/productpreview.php?id=5663&mc=1&sc=4&producttitle=enzyme%20from%20china&companyname=Wuxi%20Green%20Year%20Union%20Works%20Co.,%20Ltd
Decisions on the LMODecisions on the LMO
SYN-E3272-5 x SYN-BTØ11-1 x SYN-IR6Ø4-5 x DAS-Ø15Ø7-1 x SYN-Ø53Ø7-1 x MON-ØØØ21-9 - Modified thermostable alpha-amylase, insect-resistant, herbicide-tolerant maize ...
http://bch.cbd.int/database/lmo/decisions.shtml?documentid=106346
Perten releases next generation Falling Number® System | Perten InstrumentsPerten releases next generation Falling Number® System | Perten Instruments
Perten Instruments announces the release of the FN 1000 - Pertens newest Falling Number® instrument. The FN 1000 is a dual sample analysis system and reports the world standard Falling Number value - indicating alpha-amylase activity in grain and flou...
https://www.perten.com/zh/6/1/Perten-releases-next-generation-Falling-Number-System/
Heat Stable Alpha-Amylase by Baiyin Sino BioScience Co., Ltd. - Food, Beverage & NutritionHeat Stable Alpha-Amylase by Baiyin Sino BioScience Co., Ltd. - Food, Beverage & Nutrition
Heat Stable Alpha-Amylase is made from the best strain of Bacillus licheniformis through deep fermentation and extraction technique. This product posses...
https://www.ulprospector.com/en/na/Food/Detail/16267/396080/Heat-Stable-Alpha-Amylase?st=31&sl=52171873&crit=S25vd2xlZGdlIENlbnRlciBDb250ZW50ID4gSW5ncmVkaWVudHMgPiBrZXl3b3JkOltBbXlsYXNlXQ%3D%3D&ss=2&k=Amylase&t=Amylase
Enzyme Bio100L - Determining the Optimum pH and Optimum Temperature for an Alpha-Amylase Enzyme(Corpulentus Martitus Lenell...Enzyme Bio100L - Determining the Optimum pH and Optimum Temperature for an Alpha-Amylase Enzyme(Corpulentus Martitus Lenell...
View Notes - Enzyme Bio100L from BIO SOMETHING at UMBC. Determining the Optimum pH and Optimum Temperature for an Alpha-Amylase Enzyme (Corpulentus Martitus) Lenell Davis BIO 100L. Nov 05,
https://www.coursehero.com/file/5672048/Enzyme-Bio100L/
Heat and acid-stable alpha-amylase enzymes and processes for producing the same - CPC International Inc.Heat and acid-stable alpha-amylase enzymes and processes for producing the same - CPC International Inc.
Heat and acid-stable alpha-amylase enzymes having the following characteristics: (1) capable of retaining at least about 70% of their initial activity when held at 90° C. and at a pH of 6.0 for 10 min
http://www.freepatentsonline.com/4284722.html
KEGG T02813: 100767001KEGG T02813: 100767001
cge:100767001 K01176 alpha-amylase [EC:3.2.1.1] , (RefSeq) pancreatic alpha-amylase (A) MKFFLLLSLIGFCWAQYDPQTQYGRTAIVHLFEWRWVDIAKECERYLAPKGFGGVQVSPP NENIVVYNPSRPWWERYQPISYKICTRSGNEDEFRDMVTRCNNVGVRIYVDAVINHMCGA GGGAGTSSTCGSYYNANNRDFPSVPYSGWDFNDGKCNGEISNYNDANQVRNCRLSGLLDL ALEKDYVRSKVAEYMNRLIDIGVAGFRLDAAKHMWPGDIKAVLDKLHNLNTKWFSQGSRP FIFQEVIDLGGEAIKSSEYFGNGRVTEFKYGAKLGTVIRKWNGEKMAYLKNWGEGWGFVP SDRALVFVDNHDNQRGHGAGGASILTFWDARMYKMAVGFMLAHPYGFTRVMSSYRWARNF QNGKDVNDWIGPPNNNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVAFRNVVSGQPFSN WWDNGSNQVAFGRGNRGFIVFNNDDWSLSTTLQTGLPAGTYCDVISGDKVDGNCTGIKVN VGNDGNAHFSISNSAEDPFIAIHAESKL ...
http://www.genome.jp/dbget-bin/www_bget?-f+-n+a+cge:100767001
GFIT result for T01710GFIT result for T01710
Os08g0473900, AMY3D, ALPHA-AMYLASE_3D; Alpha-amylase isozyme 3D precursor (EC 3.2.1.1) (1,4-alpha-D-glucan glucanohydrolase).; K01176 alpha-amylase [EC:3.2.1.1] ...
http://www.kegg.jp/ssdb-bin/www_ssget?gmx:100815664
Sequence Similarity Search - BLASTSequence Similarity Search - BLAST
xop:PXO_03668 K05343 maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1] , (GenBank) alpha-amylase family protein (A) MVADQRWYKDAIIYQVHVKSFFDSNDDGIGDFPGLISKLDYIAELGVDTIWLLPFYPSPR RDDGYDIAEYMAVHPDYGSIEDFEQLVAQAHARGIRIVTELVINHTSDQHPWFQRARTAP AGSPGRDFYVWSDTDQEYEGTRIIFCDTEKSNWTWDPVAGQYFWHRFYSHQPDLNFDNPA VLEAVLEVMRFWLDRGVDGLRLDAVPYLIERAGTSNENLPETHAILRKIRATLDAEYPDR MLLAEANMWPEDTQQYFGQNADECHMAFHFPLMPRMYMAIAREDRFPITDIMRQTPEIPE SCQWAIFLRNHDELTLEMVTDSERDYLWQTYAADRRARINLGIRRRLAPLLERDRRRIEL MTSLLLTMPGTPVLYYGDEIGMGDNIHLGDRDGVRTPMQWSIDRNGGFSRADPAQLVLPP VMDPLYGFQAVNVEAQIRDQHSLLTWTRRVLSVRKRYQAFGRGTLRFLYPGNRRMLAYLR CYQDETVLCVANLSHTLQAVELDLSEFEGRVPVDIIGGGSFPPIGRLTYLLTVPPFGFYA FELVSEGTLPDWHVPSPVPLPDYRTLVLRSDADGSAALLPHLPTLEGEILPAWLSARRWF SAKDQALRSVRIARRTPLPGDQPMTLLELEVELEDGRRERYMLPVGIVWEREQPSTLAEQ LALARVRQGREVGYLTDAFALKPMVRGVIDALCSNAALKFCDGEEASQQGQVRFEATPAL AMLDIPHDPEIRWLSAEQSNSSLVIADKAVFKLLRHVAVGANPEIEIGRRLTEMGYANAA PLLGSISRVDGQGTVTTIALLQGFIRNQGDAWRWTLDHLARSFDEYVTAQTDEARAEAVA ...
http://www.genome.jp/tools-bin/search_sequence?prog=blast&seqid=xop:PXO_03668+aa
Phase 2™ FAQs | NOW FoodsPhase 2™ FAQs | NOW Foods
What is Phase 2™ Starch Neutralizer? Phase 2™ is an amazing, non-stimulant, all-natural nutritional ingredient that is derived from the white kidney bean.
https://www.nowfoods.com/now/nowledge/phase-2-faqs
White Kidney | Agricultural Marketing ServiceWhite Kidney | Agricultural Marketing Service
This site is also protected by an SSL (Secure Sockets Layer) certificate thats been signed by the U.S. government. The https:// means all transmitted data is encrypted - in other words, any information or browsing history that you provide is transmitted securely.. ...
https://www.ams.usda.gov/book/white-kidney
Amy Sever International - Amy Sever InternationalAmy Sever International - Amy Sever International
Let Amy Sever Speak to Your Organization Hear Amys Eye-Opening Message About the Epidemic of Sex-Slavery and Human-Trafficking Happening All Around You. Find Out What You Can Do To Help... WOMENS MINISTRY... Amy started her womens ministry in 2002 after winning several national and international fitness competitions, and sensing the emptiness in so many other…
https://amysevercom.wordpress.com/let-amy-sever-bring-awareness-to-your-group-church-or-organization/
Amy | Learn the meaning, definition & origin of the name AmyAmy | Learn the meaning, definition & origin of the name Amy
Learn the meaning, definition and origin of the name Amy. Emmas Diary presents all the information you need on the name Amy before deciding what to name your baby.
https://www.emmasdiary.co.uk/pregnancy-and-birth/unique-baby-names/detail-name/Amy
FertilitySmarts Contributors - Amy WrubleFertilitySmarts Contributors - Amy Wruble
All content by Amy Wruble on FertilitySmarts. Amy Wruble is a regular contributor to mom.me and Momtastic. Her work has also appeared in The...
https://www.fertilitysmarts.com/contributors/amy-wruble
1 - Como se gana dinero con forex1 - Como se gana dinero con forex
Day trading strategies using price action patterns pdf download #### COMO SE GANA DINERO CON FOREX Belajar forex di kediri #### Jforex example strategy
http://ozoneforex.com/como-se-gana-dinero-con-forex.html
WIS Plasma Laboratory - Ramy DoronWIS Plasma Laboratory - Ramy Doron
article{doron:1998a, author = {R. Doron and E. Behar and M. Fraenkel and P. Mandelbaum and A. Zigler and J.L. Schwob and A.Y. Faenov and T.A. Pikuz ...
http://plasma-gate.weizmann.ac.il/index.php?mact=BibMan,cntnt01,default,0&cntnt01cite_key=doron%3A1998a&cntnt01export=bibtex&cntnt01returnid=119
WIS Plasma Laboratory - Ramy DoronWIS Plasma Laboratory - Ramy Doron
article{doron:2000a, author = {Doron, R and Behar, E and Fraenkel, M and Mandelbaum, P and Schwob, JL and Zigler, A and Faenov, A Ya and Pikuz, TA ...
http://plasma-gate.weizmann.ac.il/index.php?mact=BibMan,cntnt01,default,0&cntnt01cite_key=doron%3A2000a&cntnt01export=bibtex&cntnt01returnid=119
Structural relationship between the enzymatic and streptococcal binding sites of human salivary alpha-amylase. - Semantic...Structural relationship between the enzymatic and streptococcal binding sites of human salivary alpha-amylase. - Semantic...
Previous studies have demonstrated that human salivary alpha-amylase specifically binds to the oral bacterium Streptococcus gordonii. This interaction is inhibited by substrates such as starch and maltotriose suggesting that bacterial binding may involve the enzymatic site of amylase. Experiments were performed to determine if amylase bound to the bacterial surface possessed enzymatic activity. It was found that over one-half of the bound amylase was enzymatically active. In addition, bacterial-bound amylase hydrolyzed starch to glucose which was then metabolized to lactic acid by the bacteria. In further studies, the role of amylases histidine residues in streptococcal binding and enzymatic function was assessed after their selective modification with diethyl pyrocarbonate. DEP-modified amylase showed a marked reduction in both enzymatic and streptococcal binding activities. These effects were diminished when DEP modification occurred in the presence of maltotriose. DEP-modified amylase had a
https://www.semanticscholar.org/paper/Structural-relationship-between-the-enzymatic-and-Scannapieco-Bhandary/205e674bfe019da7fa849c6449c3910a5aad3241
Alpha-amylase/trypsin inhibitor elisa and antibodyAlpha-amylase/trypsin inhibitor elisa and antibody
Shop Alpha-amylase/trypsin inhibitor ELISA Kit, Recombinant Protein and Alpha-amylase/trypsin inhibitor Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
https://www.mybiosource.com/protein_family.php?root=alpha-amylase-trypsin-inhibitor
Altered salivary alpha-amylase awakening response in Bosnian War refugees with posttraumatic stress disorder - Zurich Open...Altered salivary alpha-amylase awakening response in Bosnian War refugees with posttraumatic stress disorder - Zurich Open...
Thoma, Myriam Verena; Joksimovic, Ljiljana; Kirschbaum, Clemens; Wolf, Jutta Manuela; Rohleder, Nicolas (2012). Altered salivary alpha-amylase awakening response in Bosnian War refugees with posttraumatic stress disorder. Psychoneuroendocrinology, 37(6):810-817. ...
http://www.zora.uzh.ch/id/eprint/109802/
Salivary Alpha-Amylase Activity, a New Biomarker in Heart Failure?Salivary Alpha-Amylase Activity, a New Biomarker in Heart Failure?
Salivary α-amylase activity is an increasingly investigated biomarker for the activation of the autonomic nervous system. Autonomic imbalance is associated to several diseases, one of which is heart failure, and the aim of the present study was to test if salivary α-amylase activity might be a new biomarker in patients with chronic heart failure.. Methods: In this pilot study, 48 elderly men (range 59-89 years), 24 patients with established chronic heart failure in NYHA class I to III, and 24 controls were included. In all participants, saliva was collected for three consecutive days at three time points (at awakening, 30 minutes later and in the late afternoon), and blood was sampled for analysis of NT-proBNP.. Results: Within the whole group of participants, a statistically significant positive correlation between morning salivary α-amylase activity levels and serum NT-proBNP could be found, which was strongest for the measurement taken 30 minutes after awakening, as well as a significant ...
http://www.diva-portal.org/smash/record.jsf?pid=diva2:588790
RCSB PDB - 1G1Y: CRYSTAL STRUCTURE OF ALPHA-AMYLASE II (TVAII) FROM THERMOACTINOMYCES VULGARIS R-47 AND BETA...RCSB PDB - 1G1Y: CRYSTAL STRUCTURE OF ALPHA-AMYLASE II (TVAII) FROM THERMOACTINOMYCES VULGARIS R-47 AND BETA...
1G1Y: Studies on the hydrolyzing mechanism for cyclodextrins of Thermoactinomyces vulgaris R-47 alpha-amylase 2 (TVAII). X-ray structure of the mutant E354A complexed with beta-cyclodextrin, and kinetic analyses on cyclodextrins.
http://www.rcsb.org/pdb/explore/derivedData.do?structureId=1G1Y
RCSB PDB - 1IZK: Thermoactinomyces vulgaris R-47 alpha-amylase 1 mutant enzyme w398vRCSB PDB - 1IZK: Thermoactinomyces vulgaris R-47 alpha-amylase 1 mutant enzyme w398v
As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
https://www.rcsb.org/structure/1IZK
Alpha-amylase functions as a salivary gland-specific self T cell ...: Ingenta ConnectAlpha-amylase functions as a salivary gland-specific self T cell ...: Ingenta Connect
Analyses of T cell receptors (TCR) on T cells infiltrating labial salivary glands of patients with Sjögrens syndrome (SS) indicate that the cells expand by antigen stimulation in context of major histocompatibility complex (MHC). To elucidate the autoantigens recognized by T cells infiltrating in labial salivary glands from patients with SS, proteins derived from human salivary gland cDNA libraries were screened by West-Western method using TCR-CDR3 probe, which is antigen recognition region of TCR on T cells. 13 cDNA clones were detected as proteins binding to TCR-CDR3 region. One was a human alpha-amylase salivary precursor (AA54-407), suggesting that alpha-amylase might be a salivary gland-specific autoantigen. To examine whether alpha-amylase acts as an antigen in labial salivary glands, PBL from 11 patients with SS were incubated with 9 different synthetic amino acids of alpha-amylase or salivary alpha-amylase. SSCP analysis on TCR clearly showed that alpha-amylase reactive T cells were ...
https://www.ingentaconnect.com/content/sp/ijmm/1999/00000003/00000005/art00005
Amylase Inhibitors | PeaceHealthAmylase Inhibitors | PeaceHealth
How to Use It Depending on the potency of the amylase inhibitors , typical intake is 1,500 to 6,000 mg before meals. Where to Find It Amylase inhibitors can be extracted from several types of plants, especially those in the legume family. Currently available Amylase inhibitors are extracted from either white kidney bean...
https://www.peacehealth.org/medical-topics/id/hn-3979008
Dr. Oz Pumps White Kidney Bean Extract, Pharmachem Warns that Only Its Phase 2 Brand Is Clinically SupportedDr. Oz Pumps White Kidney Bean Extract, Pharmachem Warns that Only Its Phase 2 Brand Is Clinically Supported
Television personality Dr. Oz has been promoting white kidney bean extract as an effective ingredient for reducing starch digestion and aiding in weight control. However, Phase 2 brand white kidney bean extract supplier Pharmachem Laboratories Inc. (Kearny, NJ) is reminding consumers that only its patented formula has been clinically studied and shown to support these effects.. Simple, generic white kidney bean extracts do not offer adequate potency or stability to perform like Phase 2 and will not provide the benefits nor the safety as described on the Dr. Oz program, stated Mitch Skop, Pharmachems director of new product development. We are ecstatic over the coverage…and worked with Dr. Ozs diet and fitness expert, Lisa Lynn, providing background for her interviews, and are pleased with the attention. However, of late we have become concerned about interesting new products labeled simply as white kidney bean extract.. While the company believes Dr. Oz promoted the benefits white ...
https://www.nutritionaloutlook.com/view/dr-oz-pumps-white-kidney-bean-extract-pharmachem-warns-only-its-phase-2-brand-clinically-supported
Alpha-amylase | definition of alpha-amylase by Medical dictionaryAlpha-amylase | definition of alpha-amylase by Medical dictionary
Looking for online definition of alpha-amylase in the Medical Dictionary? alpha-amylase explanation free. What is alpha-amylase? Meaning of alpha-amylase medical term. What does alpha-amylase mean?
http://medical-dictionary.thefreedictionary.com/Alpha-Amylase
Cloning of a gene encoding cold-adapted alpha-Amylase from the psychrotrophic bacterium Pseudoalteromonas haloplanctis strain...Cloning of a gene encoding cold-adapted alpha-Amylase from the psychrotrophic bacterium Pseudoalteromonas haloplanctis strain...
Cloning of a gene encoding cold-adapted alpha-Amylase from the psychrotrophic bacterium Pseudoalteromonas haloplanctis strain 505
http://vjs.ac.vn/index.php/vjbio/article/view/6936
Bliss Welness On The Go White Kidney Bean Carb Blocker Vegan Extract Ready to Sprinkle Sachets Cheese Flavor- 20 Sachets | Dr....Bliss Welness On The Go White Kidney Bean Carb Blocker Vegan Extract Ready to Sprinkle Sachets Cheese Flavor- 20 Sachets | Dr....
Bliss Welness offers CarbBliss Pure ready-to-eat Cheese Flavor sachets powered offers high potency completely veg sourced finest carb blockers for effective weight management by controlling carbohydrate absorption by our body. Carb blockers are known for patent weight loss supplements and the Holy Grail for carb lovers. They are known for alpha-amylase inhibition. They work by blocking the enzymes released by our body to digest complex carbs that are found in foods like pizzas, burgers, potatoes, rice and starchy vegetables. These are then passed into the large intestine without being digested or absorbed. The main action of this weight loss supplement is that the contribution of complex carbs to any calorie intake or raise in blood sugar is significantly lower.Helps Naturally Block Carbohydrate ...
https://www.anupamghose.com/shop/bliss-welness-on-the-go-white-kidney-bean-carb-blocker-vegan-extract-ready-to-sprinkle-sachets-cheese-flavor-20-sachets/
Native Phaseolus vulgaris Alpha-Amylase Inhibitor - Creative EnzymesNative Phaseolus vulgaris Alpha-Amylase Inhibitor - Creative Enzymes
A proteinaceous inhibitor of the digestive enzyme alpha-amylase (1,4-a-D-Glucan glucanohydrolase; EC 3.2.1.1) has been isolated and purified from kidney beans Phaseolus v
https://www.creative-enzymes.com/product/Native-Phaseolus-Vulgaris-AlphaAmylase-Inhibitor_1829.html
CAZy - CBM34CAZy - CBM34
Modules of approx. 120 residues. Granular starch-binding function has been demonstrated in the case of Thermoactinomyces vulgaris R-47 α-amylase 1 (TVAI ...
http://www.cazy.org/CBM34_bacteria.html?debut_TAXO=600
Subject: recombinant DNA / Journal: Proceedings of the National Academy of Sciences of the United States of America /...Subject: recombinant DNA / Journal: Proceedings of the National Academy of Sciences of the United States of America /...
The codon usage of a hybrid bacterial gene encoding a thermostable (1,3-1,4)-beta-glucanase was modified to match that of the barley (1,3-1,4)-beta-glucanase isoenzyme EII gene. Both the modified and unmodified bacterial gene were fused to a DNA segment encoding the barley high-pI alpha-amylase signal peptide downstream of the barley (1,3-1,4)-beta-glucanase isoenzyme EII gene promoter. When intro ...
https://pubag.nal.usda.gov/?f%5Bjournal_name%5D%5B%5D=Proceedings+of+the+National+Academy+of+Sciences+of+the+United+States+of+America&f%5Bpublication_year_rev%5D%5B%5D=8004-1996&f%5Bsubject_term%5D%5B%5D=promoter+regions&q=%22recombinant+DNA%22&search_field=subject&sort=relevance
SPINDLYs role in the gibberellin response pathway Pages 1 - 6 - Flip PDF Download | FlipHTML5SPINDLYs role in the gibberellin response pathway Pages 1 - 6 - Flip PDF Download | FlipHTML5
Check Pages 1 - 6 of SPINDLYs role in the gibberellin response pathway in the flip PDF version. SPINDLYs role in the gibberellin response pathway was published by on 2016-02-16. Find more similar flip PDFs like SPINDLYs role in the gibberellin response pathway. Download SPINDLYs role in the gibberellin response pathway PDF for free.
https://fliphtml5.com/olpx/hutd/basic
White Kidney Bean - Definition and Cooking Information - RecipeTips.comWhite Kidney Bean - Definition and Cooking Information - RecipeTips.com
White Kidney Bean cooking information, facts and recipes. A white oval bean with a thin skin and mild flavor. It is also known as the Cannellini bean and is available canned or dried.
http://www.recipetips.com/glossary-term/t--34704/white-kidney-bean.asp
Pure White Kidney Bean Extract- 100% Effective and Optimized for Weight Loss - Carb Blocker and Prevents Fat From Forming - USA...Pure White Kidney Bean Extract- 100% Effective and Optimized for Weight Loss - Carb Blocker and Prevents Fat From Forming - USA...
Shrink that waistline in a flash! White Kidney Bean extract is one of the worlds most successful weight loss supplements, and the ideal complement to anyones fat burning efforts. Natures Design offers the purest, most potent Wh...
http://healthcorral.com/pure-white-kidney-bean-extract-100-effective-and-optimized-for-weight-loss-carb-blocker-and-prevents-fat-from-forming-usa-made-by-natures-design/
Celery Stuffed with Chick Pea and White Kidney Bean DipCelery Stuffed with Chick Pea and White Kidney Bean Dip
Celery Stuffed with Chick Pea and White Kidney Bean Dip is a vegan recipe treat for serving as an appetizer, Horderve, or snack
http://www.all-creatures.org/recipes/celery-stuf-cpwkb.html
NAVER Academic | Location of the α-amylase gene in rumenStreptococcus bovis strains distinguished by unstable amylase activityNAVER Academic | Location of the α-amylase gene in rumenStreptococcus bovis strains distinguished by unstable amylase activity
Genetic stability of amylase activity after serial subcultivation experiments with amylolytic ruminalStreptococcus bovis strains was investigated. Two strains Amy+ and Amy− were obtained. Loss of amylase activity connected with the loss of plasmid DNA was not found in these strains. The presence of the gene responible for the amylase activity in the chromosome of these strains was revealed by hybridization of the α-amylase gene on pJK108 against chromosomal DNA ofS. bovis andBacillus subtilis after a complete restriction withEcoRI.
http://academic.naver.com/article.naver?doc_id=34670475
Engineering of vesicle trafficking improves heterologous protein secretion in Saccharomyces cerevisiaeEngineering of vesicle trafficking improves heterologous protein secretion in Saccharomyces cerevisiae
The yeast Saccharomyces cerevisiae is a widely used platform for the production of heterologous proteins of medical or industrial interest. However, heterologous protein productivity is often restricted due to the limitations of the host strain. In the protein secretory pathway, the protein trafficking between different organelles is catalyzed by the soluble NSF (N-ethylmaleimide-sensitive factor) receptor (SNARE) complex and regulated by the Secl/Munc18 (SM) proteins. In this study, we report that over-expression of the SM protein encoding genes SEC1 and SLY1, improves the protein secretion in S. cerevisiae. Engineering Sec1p, the SM protein that is involved in vesicle trafficking from Golgi to cell membrane, improves the secretion of heterologous proteins human insulin precursor and alpha-amylase, and also the secretion of an endogenous protein invertase. Enhancing Sly1p, the SM protein regulating the vesicle fusion from endoplasmic reticulum (ER) to Golgi, increases alpha-amylase production only. Our
https://research.chalmers.se/publication/156980
AMYLASE ENZYME 1 OZ - House of HomebrewAMYLASE ENZYME 1 OZ - House of Homebrew
Amylase Enzyme is a food-grade bacterial alpha-amylase enzyme produced by fermentation of a non-GMO strain of bacillus. In the brewing process it is used for liquefaction of grain mashes and malt extracts for increased fermentability. Amylase Enzyme is typically used by all-grain brewers to add to a high adjunct mash t
https://www.houseofhomebrew.com/products/amylase-enzyme
Genetically controlled electrophoretic variants of a starch-degrading enzyme in zea mays<...Genetically controlled electrophoretic variants of a starch-degrading enzyme in zea mays<...
TY - JOUR. T1 - Genetically controlled electrophoretic variants of a starch-degrading enzyme in zea mays. AU - FINNEGAN, D J AU - Finnegan, David. PY - 1969. Y1 - 1969. M3 - Comment/debate. VL - 22. SP - 1055. JO - Australian journal of biological sciences. JF - Australian journal of biological sciences. SN - 0004-9417. IS - 4. ER - ...
https://www.research.ed.ac.uk/en/publications/genetically-controlled-electrophoretic-variants-of-a-starch-degra
Health LibraryHealth Library
Technically, starch blockers are amylase inhibitors. Amylase is one of the main enzymes the body uses to digest starch. In theory, when amylase is blocked, starch can pass through the body undigested. If the body is unable to digest a part of the meal the calorie intake will be lower which can aid in weight loss. However, theory is one thing, reality another and clinical studies of amylase inhibitors have not established definitive benefits.1-3 For example, one published study failed to find that use of a phaseolus product reduced the usual blood sugar rise that follows a meal.7 Several possible reasons for this discrepancy have been proposed, such as that the amylase inhibitor may be broken down and made ineffective in the stomach, the product may supply enough of its own amylase to counteract any benefit, and that another enzyme, glucoamylase, may be able to take over when amylase cant do the job. However, according to the manufacturer of a current product, more concentrated extracts of ...
https://healthlibrary.epnet.com/GetContent.aspx?token=c5987b1e-add7-403a-b817-b3efe6109265&chunkiid=111713
Salivary alpha-Amylases | Colorado PROFILESSalivary alpha-Amylases | Colorado PROFILES
Arch JJ, Brown KW, Dean DJ, Landy LN, Brown KD, Laudenslager ML. Self-compassion training modulates alpha-amylase, heart rate variability, and subjective responses to social evaluative threat in women. Psychoneuroendocrinology. 2014 Apr; 42:49-58 ...
https://profiles.ucdenver.edu/display/200622
Native Bacillus amyloliquefaciens Protease - Creative EnzymesNative Bacillus amyloliquefaciens Protease - Creative Enzymes
Bacterial protease produced by submerged fermentation of a selected strain of Bacillus amyloliquefaciens. Secretion of protease by Bacillus amyloliquefaciens can be inhib
https://www.creative-enzymes.com/product/Native-Bacillus-Amyloliquefaciens-Protease_935.html
Dako alpha amylase msds sheetsDako alpha amylase msds sheets
Dako alpha amylase msds sheets, Alpha-amylase (aep) | 2000 mg/kg ( Rat ) - - Symptoms related to the physical, chemical and toxicological characteristics Symptoms No information available. Delayed and immediate effects and also chronic effects from short and long term exposure Sensitization No information available. Mutagenic Effects No information available.
https://ruck.l0l.in.net/gold-prices-december-2015.html
Sodium in the structure of Structure of Bacillus Halmapalus Alpha-Amylase, Crystallized With the Substrate Analogue Acarbose...Sodium in the structure of Structure of Bacillus Halmapalus Alpha-Amylase, Crystallized With the Substrate Analogue Acarbose...
Mono- and Stereopictres of 5.0 Angstrom coordination sphere of Sodium atom in PDB 2gjp: Structure of Bacillus Halmapalus Alpha-Amylase, Crystallized With the Substrate Analogue Acarbose and Maltose
http://sodium.atomistry.com/pdb2gjp.html
White kidney bean exs Profile - PixdausWhite kidney bean exs Profile - Pixdaus
Pixdaus.com is an environmental photo-bookmarking and sharing service. All the pictures are uploaded by users and the copyrights belong to the rightholders. You can request a removal using the Copyright flag link below each image if you find an image that shouldnt belong here ...
http://pixdaus.com/white-kidney-bean-ex/user/profile/293819/
Characterization of Factors From Bacillus Amyloliquefaciens Strain PFR1 that Caused Adventitious Antheridia and Catenulate...Characterization of Factors From Bacillus Amyloliquefaciens Strain PFR1 that Caused Adventitious Antheridia and Catenulate...
Products, termed Antheridiogen Factor (AF), and vesicle like sac formation factor (VLS-F) were present in a culture of Bacillus amyloliquefaciens stra..
https://www.longdom.org/abstract/characterization-of-factors-from-embacillus-amyloliquefaciensem-strain-pfr1-that-caused-adventitious-antheridia-and-cate-7301.html
Evaluation of Bacillus amyloliquefaciens H57 as a probiotic in livestock | Australian Centre for EcogenomicsEvaluation of Bacillus amyloliquefaciens H57 as a probiotic in livestock | Australian Centre for Ecogenomics
Bacillus amyloliquefaciens strain H57 was initially isolated for its ability to inhibit the growth of fungi that causes livestock feed to spoil. When applied to feed, H57 markedly reduces fungal growth for up to three months.
https://ecogenomic.org/evaluation-bacillus-amyloliq
Characterizing Starch Pasting with a Modular Compact Rheometer<...Characterizing Starch Pasting with a Modular Compact Rheometer<...
Standards have been created with well-defined mixing, heating, holding, and cooling phases to characterize the gelatinization and pasting behavior of starches. In the following tests, the pasting behavior is studied according to the ICC 162 standard.This standard is applicable for native and modified starches, flours, and cereal grains (after appropriate grinding) to analyze the pasting properties and study the effect of alpha-amylase on starch-water or flour-water suspensions during heating and cooling. ...
https://www.anton-paar.com/corp-en/services-support/document-finder/application-reports/characterizing-starch-pasting-with-a-modular-compact-rheometer/
METALNEWS.DE - CD-REVIEW: Placenta - Fixed Action PatternMETALNEWS.DE - CD-REVIEW: Placenta - Fixed Action Pattern
Mit ihrem zweiten Werk Fixed Action Pattern [davor gab es noch die Human Abyss-Scheibe im Jahre 2007, die man sich ber die MySpace-Page der Band gratis downloaden kann] zeigen die Berliner, dass sie auf jeden Fall berregional konkurrenzf hig sind, aber leider auch, dass sie noch l ngst nicht zu den [ganz] Gro en geh ren. Die Jungs m hen sich zwar redlich ab, aber es fehlt noch ein letztes St ck Finesse f r die erste Liga. PLACENTA versuchen zwar sich durch viele interessante Parts [z.b. einige Clean Vocals-Einlagen, die allerdings wenig mit Emo-Gejammer zu tun haben, sonstige Melodik wie in Simon Says sowie einige Schlenker in Richtung MESHUGGAH] oder elektronische Interludes [Pinocchio Stretches Woodenly In The Forest] von der Masse abzuheben, aber leider sind meisten Songs selbst einfach nicht au ergew hnlich genug, um wirklich gegen die Vorbilder bestehen zu k nnen. Au erdem wirkt Fixed Action Pattern etwas zu lang, was durch die drei gut gemeinten Bonustracks, die allesamt der ...
http://www.metalnews.de/cds/Placenta+-+Fixed+Action+Pattern.4240.html
Starch Blockers | The Diabetes Forum Support Community For Diabetics OnlineStarch Blockers | The Diabetes Forum Support Community For Diabetics Online
I have found an interesting research paper on a dietry suppliment, white kidney bean. Basically it inhibits the breakdown of complex carbohydrates. Looks...
https://www.diabetesforum.com/threads/starch-blockers.7381/
CiNii Articles - Sumitani Jun-ichiCiNii Articles - Sumitani Jun-ichi
The Conserved Tryptophan-Arginine-Tyrosine Motif of .ALPHA. Proteinaceous .ALPHA.-Amylase Inhibitor T-76 from Streptomyces nitrosporeus Is Important for Inhibition of Animal .ALPHA.-Amylases but not for an .ALPHA.-Amylase from Bacillus sp. No. 195. （2000 ...
https://ci.nii.ac.jp/author?q=Sumitani+Jun-ichi
Source Naturals Phase 2 Carbohydrate Blocker 500mg 120 tablet -- VitaGloSource Naturals Phase 2 Carbohydrate Blocker 500mg 120 tablet -- VitaGlo
Source Naturals Phase 2 Carbohydrate Blocker 500mg 120 tablet ource Naturals Carbohydrate Blocker contains Phase 2(R) white kidney bean extract. Phase 2(R) works ...
http://www.vitaglo.com/sn1561.html
Sde 0573 - Alpha-amylase - Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) - Sde 0573 gene & proteinSde 0573 - Alpha-amylase - Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) - Sde 0573 gene & protein
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class=publication>Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href=http://www.nrbook.com/b/bookcpdf.php>Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
http://www.uniprot.org/uniprot/Q21N92
Amylase | MedTest DXAmylase | MedTest DX
α-Amylase hydrolyzes the 2-chloro-p-nitrophenyl-α-D-maltotrioside (CNPG3) to release 2-chloro-nitrophenol and form 2-chloro-p-nitrophenyl-α-D-maltoside (CNPG2), maltotriose (G3) and glucose (G). The rate of increase in absorbance is measured at 405 nm and is proportional to the α-amylase activity in the sample.(G). The rate of increase in absorbance is measured at 405 nm and is proportional to the α-amylase activity in the sample.. ...
http://www.medtestdx.com/product/15
Green revolution genes encode mutant gibberellin response...Green revolution genes encode mutant gibberellin response...
World wheat grain yields increased substantially in the 1960s and 1970s because farmers rapidly adopted the new varieties and cultivation methods of the so-called green revolution. The new varieties are shorter, increase grain yield at the expense of straw biomass, and are more resistant to damage …
https://pubmed.ncbi.nlm.nih.gov/10421366/?dopt=Abstract
Fôrtilsetningsstoff - regjeringen.noFôrtilsetningsstoff - regjeringen.no
Kommisjonens gjennomføringsforordning (EU) 2017/173 av 1. februar 2017 om endring av forordning (EF) nr. 1292/2008 og gjennomføringsforordning (EU) nr. 887/2011 hva angår navnet på innehaveren av godkjenningen av Bacillus amyloliquefaciens CECT 5940 og...
https://www.regjeringen.no/no/sub/eos-notatbasen/notatene/2017/jan/fortilsetningsstoff/id2537330/
Amy Reese, D.D.S.​ | Bridges​ in Big Spring​Amy Reese, D.D.S.​ | Bridges​ in Big Spring​
Amy Reese, D.D.S.​ providing professional dental care. Dr. Amy​ Reese​ is a Big Spring​ Dentist, call us today at 432-267-4102​!!
https://www.amyreesedds.com/bridges
Amy Winehouse Rehab (live)Amy Winehouse Rehab (live)
Amy Winehouse Rehab (live) - Amy performing her hit Rehab at a 2007 award show. Parents seek naloxone to help their adult kids Filed under: drug tr
http://drugtreatmentcentersstlouis.com/amy-winehouse-rehab-live/
AMY ANDERSSEN OUTCALL & INCALL PornStar Services BUST 34EE - 24 - 34 @ Nadyas Vips !AMY ANDERSSEN OUTCALL & INCALL PornStar Services BUST 34EE - 24 - 34 @ Nadyas Vips !
Guy`s , Experience PornStar Services wiTh a Genuine PornStar Her name ... `````` Amy Anderssen `````` Amy is available ```` OUTCALL & INCALL ```` TodaY Tuesday From 4.00pm to 2.00am !!! First in Class PSE Services : PSE, GFE, DFK, , COB, MSOG, MPOS
https://merb.cc/vbulletin/showthread.php?59225-AMY-ANDERSSEN-OUTCALL-amp-INCALL-PornStar-Services-BUST-34EE-24-34-Nadya-s-Vips-
AmylaseAmylase
α-Amylase[edit]. Main article: Alpha-amylase. The α-amylases (EC 3.2.1.1 ) (CAS 9014-71-5) (alternative names: 1,4-α-D-glucan ... The optimum pH for β-amylase is 4.0-5.0[4] γ-Amylase[edit]. γ-Amylase (EC 3.2.1.3 ) (alternative names: Glucan 1,4-a- ... β-Amylase[edit]. Another form of amylase, β-amylase (EC 3.2.1.2 ) (alternative names: 1,4-α-D-glucan maltohydrolase; ... The pancreas and salivary gland make amylase (alpha amylase) to hydrolyse dietary starch into disaccharides and trisaccharides ...
https://en.wikipedia.org/wiki/E1100
Plant defensinPlant defensin
Richardson M, Bloch Jr C (1991). "A new family of small (5 kDa) protein inhibitors of insect alpha-amylases from seeds or ... Inhibitors of insect alpha-amylases from sorghum. Probable protease inhibitor P322 from Solanum tuberosum (potato). A ... "Plant α-amylase inhibitors and their interaction with insect α-amylases: Structure, function and potential for crop protection ... Some plant defensins have also been identified as enzyme inhibitors of α-amylase or trypsin. It is believed that these are ...
https://en.wikipedia.org/wiki/Plant_defensin
AMY1CAMY1C
The human AMY1C gene encodes the protein Amylase, alpha 1C (salivary). Amylases are secreted proteins that hydrolyze 1,4-alpha- ... "Entrez Gene: Amylase, alpha 1C (salivary)". Retrieved 2013-02-14. [provided by RefSeq, Jul 2008]. ##RefSeq-Attributes-START## ... This gene encodes an amylase isoenzyme produced by the salivary gland. See also Amylase § Evolution. GRCh38: Ensembl release 89 ... Human Alpha-amylase 1) at the PDBe-KB. v t e. ... The human genome has a cluster of several amylase genes that ...
https://en.wikipedia.org/wiki/AMY1C
Edmond H. FischerEdmond H. Fischer
Fischer worked on alpha-amylase. After his PhD, Fischer went to the United States in 1950 for postdoctoral research. He was ...
https://en.wikipedia.org/wiki/Edmond_H._Fischer
StarchStarch
Alpha-amylases are found in plants and in animals. Human saliva is rich in amylase, and the pancreas also secretes the enzyme. ... This process is important in the digestion of starch and is also used in brewing, where amylase from the skin of seed grains is ... Glucose molecules are bound in starch by the easily hydrolyzed alpha bonds. The same type of bond is found in the animal ... The enzyme starch synthase then adds the ADP-glucose via a 1,4-alpha glycosidic bond to a growing chain of glucose residues, ...
https://en.wikipedia.org/wiki/Starch
Streptomyces corchorusiiStreptomyces corchorusii
MURAO, Sawao; OOUCHI, Naoki; GOTO, Akira; ARAI, MOTOO (1983). "New proteinaceous .ALPHA.-amylase inhibitor (Paim) from ...
https://en.wikipedia.org/wiki/Streptomyces_corchorusii
ExoenzymeExoenzyme
Organisms can either by alpha-hemolytic, beta-hemolytic, or gamma-hemolytic (non-hemolytic). Amylases are a group of ... The different classes of amylases are α-amylases, β-amylases, and glucoamylases. The α-amylases hydrolyze starch by randomly ... Sharma A, Satyanarayana T (2013). "Microbial acid-stable alpha-amylases: Characteristics, genetic engineering and applications ... Amylase breaks down carbohydrates into mono- and disaccharides, so a starch agar must be used for this assay. Once the bacteria ...
https://en.wikipedia.org/wiki/Exoenzyme
AMY2BAMY2B
Alpha-amylase 2B is an enzyme that in humans is encoded by the AMY2B gene. Amylases are secreted proteins that hydrolyze 1,4- ... "Entrez Gene: AMY2B amylase, alpha 2B (pancreatic)". Human AMY2B genome location and AMY2B gene details page in the UCSC Genome ... Koyama I, Komine S, Iino N, Hokari S, Igarashi S, Alpers DH, Komoda T (July 2001). "alpha-Amylase expressed in human liver is ... Groot PC, Bleeker MJ, Pronk JC, Arwert F, Mager WH, Planta RJ, Eriksson AW, Frants RR (July 1989). "The human alpha-amylase ...
https://en.wikipedia.org/wiki/AMY2B
Glycoside hydrolaseGlycoside hydrolase
For example, a combination of alpha-amylase and cellulase was shown to degrade polymicrobial bacterial biofilms from both in ... Other examples include lactase, amylase, chitinase, sucrase, maltase, neuraminidase, invertase, hyaluronidase and lysozyme. ... amylase), in anti-bacterial defense strategies (e.g., lysozyme), in pathogenesis mechanisms (e.g., viral neuraminidases) and in ... amylase for production of maltodextrins), and in the paper and pulp industry (xylanases for removing hemicelluloses from paper ...
https://en.wikipedia.org/wiki/Glycoside_hydrolase
IcodextrinIcodextrin
There it is broken down into oligosaccharides by the enzyme alpha-amylase. In patients with intact kidney function, both ...
https://en.wikipedia.org/wiki/Icodextrin
Glycogen debranching enzymeGlycogen debranching enzyme
Their catalyses are similar to that of alpha-amylase and glucoamylase, respectively. Their active sites are selective towards ... In E. coli, Glucose transfer is performed by 4-alpha-glucanotransferase, a 78.5 kDa protein coded for by the gene malQ. A ... "4-alpha-glucanotransferase - Escherichia coli (strain K12)". "Glycogen debranching enzyme - Escherichia coli O139:H28 (strain ... Yamamoto E, Makino Y, Omichi K (May 2007). "Active site mapping of amylo-alpha-1,6-glucosidase in porcine liver glycogen ...
https://en.wikipedia.org/wiki/Glycogen_debranching_enzyme
AMY1AAMY1A
1988). "Primary structure of human pancreatic alpha-amylase gene: its comparison with human salivary alpha-amylase gene". Gene ... Alpha-amylase 1 is an enzyme that in humans is encoded by the AMY1A gene. This gene is found in many organisms. Amylases are ... "Entrez Gene: AMY1A amylase, alpha 1A; salivary". Human AMY1A genome location and AMY1A gene details page in the UCSC Genome ... 1989). "The human alpha-amylase multigene family consists of haplotypes with variable numbers of genes". Genomics. 5 (1): 29-42 ...
https://en.wikipedia.org/wiki/AMY1A
AMY2AAMY2A
1994). "The active center of a mammalian alpha-amylase. Structure of the complex of a pancreatic alpha-amylase with a ... 1988). "Primary structure of human pancreatic alpha-amylase gene: its comparison with human salivary alpha-amylase gene" (PDF ... Pancreatic alpha-amylase is an enzyme that in humans is encoded by the AMY2A gene. Amylases are secreted proteins that ... "Entrez Gene: AMY2A amylase, alpha 2A; pancreatic". Human AMY2A genome location and AMY2A gene details page in the UCSC Genome ...
https://en.wikipedia.org/wiki/AMY2A
PolysaccharidePolysaccharide
They can be digested by breaking the alpha-linkages (glycosidic bonds). Both humans and other animals have amylases, so they ... Starch is a glucose polymer in which glucopyranose units are bonded by alpha-linkages. It is made up of a mixture of amylose ( ... This carbohydrate can react with water (hydrolysis) using amylase enzymes as catalyst, which produces constituent sugars ( ...
https://en.wikipedia.org/wiki/Polysaccharide
Raymond L. RodriguezRaymond L. Rodriguez
... and organization of the rice alpha-amylase multigene family. One of the outcomes of this research was the use of alpha-amylase ... Sequence-specific interactions of a nuclear protein factor with the promoter of a rice gene for alpha-amylase, RAamy3D.. Nucl. ... Metabolic regulation of rice alpha-amylase and sucrose synthase genes in planta. The Plant Journal, 2(4):517-523. Huang, N., ... Organization, structure and expression of the rice alpha-amylase multigene family. In, Rice Genetics II. Manila, pp. 417-429. ...
https://en.wikipedia.org/wiki/Raymond_L._Rodriguez
3,5-Dinitrosalicylic acid3,5-Dinitrosalicylic acid
It is mainly used in assay of alpha-amylase. However, enzymatic methods are usually preferred due to DNS lack of specificity. 3 ...
https://en.wikipedia.org/wiki/3,5-Dinitrosalicylic_acid
Thermococcus hydrothermalisThermococcus hydrothermalis
"Tyrosine 39 of GH13 alpha-amylase from Thermococcus hydrothermalis contributes to its thermostability". Biologia (Bratislava). ...
https://en.wikipedia.org/wiki/Thermococcus_hydrothermalis
Dental plaqueDental plaque
Some salivary components are crucial for plaques ecosystem, such as salivary alpha-amylase which plays a role in binding and ... Scannapieco FA, Torres G, Levine MJ (1993). "Salivary alpha-amylase: role in dental plaque and caries formation". Critical ...
https://en.wikipedia.org/wiki/Dental_plaque
Streptomyces tendaeStreptomyces tendae
Also said to be the source of Tendamistat (HOE 467), an alpha amylase inhibitor. Dionigi, Christopher P.; Ingram, Daphne A. ( ...
https://en.wikipedia.org/wiki/Streptomyces_tendae
Bacillus amyloliquefaciensBacillus amyloliquefaciens
... amylase (amylo). Alpha amylase from B. amyloliquefaciens is often used in starch hydrolysis. It is also a source of subtilisin ... J. Fukumoto (1943). "Studies on the production of bacterial amylase. I. Isolation of bacteria secreting potent amylases and ...
https://en.wikipedia.org/wiki/Bacillus_amyloliquefaciens
DiastaseDiastase
... alpha and beta amylase, and, to a lesser extent, gamma amylase (together, the amylases), although many other enzymes are also ... Alpha amylase degrades starch to a mixture of the disaccharide maltose; the trisaccharide maltotriose, which contains three α ( ... Today, "diastase" refers to any α-, β-, or γ-amylase (all of which are hydrolases) that can break down carbohydrates. The ... When used as a pharmaceutical drug, diastase has the ATC code A09AA01 (WHO). Amylases can also be extracted from other sources ...
https://en.wikipedia.org/wiki/Diastase
Parotid glandParotid gland
Additionally, the alpha amylase has been suggested to prevent bacterial attachment to oral surfaces and to enable bacterial ... The parotid gland also secretes salivary alpha-amylase (sAA), which is the first step in the decomposition of starches during ... With the inflammation of mumps or obstruction of the ducts, increased levels of the salivary alpha amylase secreted by the ... ISBN 978-1-4377-1730-3. Arhakis A, Karagiannis V, Kalfas S (2013). "Salivary alpha-amylase activity and salivary flow rate in ...
https://en.wikipedia.org/wiki/Parotid_gland
IsomaltaseIsomaltase
... its alpha 1-4 linkages having already been broken down by amylase). The product of the enzymatic digestion of alpha-limit ... Isomaltase helps amylase to digest alpha-limit dextrin to produce maltose. The human sucrase-isomaltase is a dual-function ... It digests polysaccharides at the alpha 1-6 linkages. Its substrate, alpha-limit dextrin, is a product of amylopectin digestion ... and oligosaccharide alpha-1,6-glucohydrolase. This enzyme catalyses the following chemical reaction Hydrolysis of (1->6)-alpha- ...
https://en.wikipedia.org/wiki/Isomaltase
Genetically modified food controversiesGenetically modified food controversies
"Transgenic expression of bean alpha-amylase inhibitor in peas results in altered structure and immunogenicity". Journal of ...
https://en.wikipedia.org/wiki/Genetically_modified_food_controversies
Glycogen branching enzymeGlycogen branching enzyme
Buisson G, Duée E, Haser R, Payan F (December 1987). "Three dimensional structure of porcine pancreatic alpha-amylase at 2.9 A ... 4-alpha-D-glucan:1,4-alpha-D-glucan 6-alpha-D-(1,4-alpha-D-glucano)-transferase. Other names in common use include branching ... 4-alpha-glucan branching enzyme 1, plant branching enzyme, alpha-1,4-glucan:alpha-1,4-glucan-6-glycosyltransferase, and starch ... Glycogen branching enzyme belongs to the α-amylase family of enzymes, which include α-amylases, pullulanas/isoamylase, ...
https://en.wikipedia.org/wiki/Glycogen_branching_enzyme
DefensinDefensin
doi:10.1007/978-3-642-27603-3_5. ISBN 978-3-642-27602-6. Williams LK, Brayer GD (2015-11-25). "Porcine pancreatic alpha-amylase ... The alpha defensin peptides are increased in chronic inflammatory conditions. Alpha defensin are increased in several cancers, ... "Novel insights on the mechanism of action of alpha-amylase inhibitors from the plant defensin family". Proteins. 73 (3): 719-29 ... Only alpha and beta defensins are expressed in humans. Although the most well-studied defensins are from vertebrates, a family ...
https://en.wikipedia.org/wiki/Defensin
Occupational asthmaOccupational asthma
Fungal alpha-amylase Food technologists, laboratory workers Papain Pharmacists Gentian powder, flaviastase ...
https://en.m.wikipedia.org/wiki/Occupational_asthma
Glucan 1,4-a-glucosidaseGlucan 1,4-a-glucosidase
... gamma-amylase, lysosomal alpha-glucosidase, acid maltase, exo-1,4-alpha-glucosidase, glucose amylase, gamma-1,4-glucan ... It was also known as γ-Amylase. Amylase French D, Knapp DW (December 1950). "The maltase of Clostridium acetobutylicum; its ... Glucan+1,4-alpha-glucosidase at the US National Library of Medicine Medical Subject Headings (MeSH) Biology portal. ... Jeffrey PL, Brown DH, Brown BI (March 1970). "Studies of lysosomal alpha-glucosidase. I. Purification and properties of the rat ...
https://en.wikipedia.org/wiki/Glucan_1,4-a-glucosidase
Saliva testingSaliva testing
Subsequent findings reveal a relationship between α-amylase and competition. Results showed that alpha amylase levels changed ... Alpha amylase, on the other hand, spikes quickly when confronted with a stressor and returns to baseline soon after the stress ... Alpha amylase levels in saliva provide a non-invasive way to examine sympathoadrenal medullary (SAM) activity, which can ... Salivary alpha amylase levels have been found to correlate with heightened autonomic nervous system activity levels, reacting ...
https://en.wikipedia.org/wiki/Saliva_testing
Αμινά Γκουρίμπ - ΒικιπαίδειαΑμινά Γκουρίμπ - Βικιπαίδεια
Screening of traditional antidiabetic medicinal plants of Mauritius for possible alpha-amylase inhibitory effects in vitro». ...
https://el.wikipedia.org/wiki/Αμινά_Γκουρίμπ
Mash ingredientsMash ingredients
Unconverted starch becomes sugar during the last steps of mashing, through the action of alpha and beta amylases. The oldest ... Germination produces a number of enzymes, such as amylase, that can convert the starch naturally present in barley and other ... Malted barley dried at a sufficiently low temperature contains enzymes such as amylase, which convert starch into sugar. ... requires mashing in multiple steps rather than at simply one temperature as the starches must be de-branched before amylase can ...
https://en.wikipedia.org/wiki/Mash_ingredients
Beta-glucanBeta-glucan
... the soluble fraction of alpha-amylase hydrolyzed oat bran or whole oat flour), whole grain barley and barley beta-fiber. An ...
https://en.wikipedia.org/wiki/Beta-glucans
Acid alpha-glucosidaseAcid alpha-glucosidase
alpha-1,4-glucosidase activity. • alpha-glucosidase activity. Cellular component. • membrane. • lysosomal membrane. • lysosomal ... Acid alpha-glucosidase, also called α-1,4-glucosidase[5] and acid maltase,[6] is an enzyme (EC 3.2.1.20) that helps to break ... maltose alpha-glucosidase activity. • catalytic activity. • hydrolase activity. • carbohydrate binding. • isomaltase. • ... This gene encodes lysosomal alpha-glucosidase, which is essential for the degradation of glycogen to glucose in lysosomes. ...
https://en.wikipedia.org/wiki/Acid_alpha-glucosidase
OatOat
... a soluble fraction of alpha-amylase hydrolyzed oat bran or whole oat flour.[17] ...
https://en.m.wikipedia.org/wiki/Oat
Beta-glucosidaseBeta-glucosidase
Amylase *Alpha-amylase. *Chitinase. *Lysozyme. *Neuraminidase *NEU1. *NEU2. *NEU3. *NEU4. *Bacterial neuraminidase ...
https://en.wikipedia.org/wiki/Beta-glucosidase
DwarfingDwarfing
"Decreased shoot stature and grain alpha-amylase activity following ectopic expression of a gibberellin 2-oxidase gene in ...
https://en.wikipedia.org/wiki/Dwarfing
CellulaseCellulase
McCleary BV (November 1980). "New chromogenic substrates for the assay of alpha-amylase and (1 leads to 4)-beta-D-glucanase". ... by the species Coprinopsis Cinerea consists of seven protein strands in the shape of an enclosed tunnel called a beta/alpha ...
https://en.wikipedia.org/wiki/Cellulase
ThaumatinThaumatin
... alpha-amylase/trypsin inhibitor, and P21 and PWIR2 soybean and wheat leaf proteins. The proteins are involved in systematically ... The similarity between this PR protein and other PR proteins to the maize alpha-amylase/trypsin inhibitor has suggested PR ...
https://en.m.wikipedia.org/wiki/Thaumatin
LactoperoxidaseLactoperoxidase
Die Glucose wiederum kann in Gegenwart des Speichel-Enzyms Amyloglucosidase (γ-Amylase (EC 3.2.1.3)) aus Stärke entstehen. ... The metabolism of 17 alpha-estradiol by lactoperoxidase: a possible source of oxidative stress in breast cancer. . In: ... Amylase) und Glucose-Oxidase enthalten, das Lactoperoxidase-System aktivieren, sind aus jüngster Zeit Studien bekannt, die den ...
https://de.wikipedia.org/wiki/Lactoperoxidase
SalukiSaluki
In 2014, a DNA study compared dogs and wolves for AMY2B (alpha amylase 2B), which is a gene and enzyme that assists with the ...
https://en.m.wikipedia.org/wiki/Saluki
위키백과:모든 언어의 위키백과마다 꼭 있어야 하는 문서 목록/확장판/생물학 및 의과학 - 위키백과, 우리 모두의 백과사전위키백과:모든 언어의 위키백과마다 꼭 있어야 하는 문서 목록/확장판/생물학 및 의과학 - 위키백과, 우리 모두의 백과사전
alpha-amylase → 알파-아밀레이스 (E). *Biomolecule *Biological pigment *Carotenoid → 카로티노이드 (B). *Chlorophyll → 엽록소 (D) ...
https://ko.wikipedia.org/wiki/위키백과:모든_언어의_위키백과마다_꼭_있어야_하는_문서_목록/확장판/생물학_및_의과학
RNA interferenceRNA interference
RNAi silencing of alpha-amylase have also been used to decrease Aspergillus flavus fungal growth in maize which would have ... "RNA interference-based silencing of the alpha-amylase (amy1) gene in Aspergillus flavus decreases fungal growth and aflatoxin ...
https://en.m.wikipedia.org/wiki/RNA_interference
ކުޑަ ގޮހޮރު - ވިކިޕީޑިއާކުޑަ ގޮހޮރު - ވިކިޕީޑިއާ
ކުޑަ ގޮހޮރުގެ ތެރޭގައި ޕެންކްރީއެޓިކް އަމިލޭސް(އިނގިރޭސި ބަހުން: Pancreatic amylase) ގެ އެހީގައި ސްޓާރޗް، މޮލްޓޯސް(އިނގިރޭސި ... އަލްފާ ލިމިޓް ޑެކްސްޓްރިނޭސް(އިނގިރޭސި ބަހުން: Alpha limit dextrinase): މިއީ އަލްފާ ލިމިޓް ޑެކްސްޓްރިން ، ގުލްކޯޒް އަށް ...
https://dv.wikipedia.org/wiki/ކުޑަ_ގޮހޮރު
Lactate dehydrogenaseLactate dehydrogenase
The N-terminus is a Rossmann NAD-binding fold and the C-terminus is an unusual alpha+beta fold.[5][6] ... This consists of a large seven-stranded antiparallel beta-sheet flanked on both sides by alpha-helices. It allows for membrane ... alpha-ketomalonate and tetrahydoNAD". J Mol Biol. 285 (2): 703-12. doi:10.1006/jmbi.1998.2357. PMID 10075524.. ...
https://en.wikipedia.org/wiki/Lactate_dehydrogenase
SucraseSucrase
EC 3.2.1.48 is sucrose alpha-glucosidase. Physiology[edit]. Sucrose intolerance (also known as congenital sucrase-isomaltase ...
https://en.wikipedia.org/wiki/Sucrase
YeastYeast
... or fungal alpha amylase enzymes, to break down the starches into complex sugars. A glucoamylase is then added to break the ...
https://en.m.wikipedia.org/wiki/Yeasts
SoybeanSoybean
... alpha amylase inhibitor, trypsin inhibitors, and prolamin storage proteins of cereals and grasses.[28] ... Vitamin E, alpha-tocopherol (mg) 0.49 0.11 1.01 0.01 0.19 0 0.26 0.39 0 0.14 15 ... Country code; ISO 3166-1 alpha-3, oth 86; other 86 countries. Top 8 countries produced 94.82% in 2016. ...
https://en.m.wikipedia.org/wiki/Soy
Liosta Bithmhóilíní - VicipéidLiosta Bithmhóilíní - Vicipéid
α-Amanatin, see Alpha-amanitin. *Aimínaigéad Amino acid. *Séaróideach anabalach Anabolic steroid ... Aimioláis Amylase (also see α-amylase). *Angiotensinogen. *Anisomycin. *Hormón antafhualach Antidiuretic hormone (ADH) ...
https://ga.wikipedia.org/wiki/Liosta_Bithmhóiliní
Glycoside hydrolaseGlycoside hydrolase
For example, a combination of alpha-amylase and cellulase was shown to degrade polymicrobial bacterial biofilms from both in ... Other examples include lactase, amylase, chitinase, sucrase, maltase, neuraminidase, invertase, hyaluronidase and lysozyme. ... amylase), in anti-bacterial defense strategies (e.g., lysozyme), in pathogenesis mechanisms (e.g., viral neuraminidases) and in ... amylase for production of maltodextrins), and in the paper and pulp industry (xylanases for removing hemicelluloses from paper ...
https://en.m.wikipedia.org/wiki/Glycoside_hydrolase
Coconut oilCoconut oil
Another method for extraction of coconut oil involves the enzymatic action of alpha-amylase, polygalacturonases, and proteases ...
https://en.wikipedia.org/wiki/Virgin_coconut_oil
PancreasPancreas
M3: increases stimulation of alpha cells and beta cells[17]. DigestionEdit. ... Enzymes that breakdown starch and other carbohydrates include amylase.[18]. These enzymes are secreted in a fluid rich in ... Detection of some of these enzymes, such as amylase and lipase in the blood, along with symptoms and findings on medical ... α2: decreases secretion from beta cells, increases secretion from alpha cells, β2: increases secretion from beta cells. ...
https://en.m.wikipedia.org/wiki/Pancreas
BacillusBacillus
... amyloliquefaciens is the source of a natural antibiotic protein barnase (a ribonuclease), alpha amylase used in starch ...
https://en.wikipedia.org/wiki/Bacillus_fragilis
Blood sugar levelBlood sugar level
There are four types of pancreatic islets, alpha (A) cells, beta (B) cells, Delta (D) cells and F cells. Glucagon is secreted ... from alpha cells, while insulin is secreted by beta cells. Together they regulate the blood-glucose levels through negative ...
https://en.wikipedia.org/wiki/Blood_sugar
មូស - វិគីភីឌាមូស - វិគីភីឌា
"The salivary glands of the vector mosquito, Aedes aegypti, express a novel member of the amylase gene family"។ Insect Molecular ... Alpha-glucosidase activity is elevated in the posterior midgut after feeding in response to the blood meal, whereas activity in ... Alpha-glucosidase is active in anterior and posterior midguts before and at all times after feeding. In whole midgut ... "Extracts of mosquito salivary gland inhibit tumour necrosis factor alpha release from mast cells"។ Parasite Immunology 15 (1): ...
https://km.wikipedia.org/wiki/មូស
High-fructose corn syrupHigh-fructose corn syrup
808-813 The first enzyme added is alpha-amylase, which breaks the long chains down into shorter sugar chains - oligosaccharides ...
https://en.wikipedia.org/wiki/High_Fructose_Corn_Syrup
DefensinDefensin
Williams LK, Brayer GD (2015-11-25). "Porcine pancreatic alpha-amylase in complex with helianthamide, a novel proteinaceous ... The alpha defensin peptides are increased in chronic inflammatory conditions. Alpha defensin are increased in several cancers, ... "Novel insights on the mechanism of action of alpha-amylase inhibitors from the plant defensin family". Proteins. 73 (3): 719-29 ... Example defensins with alpha helix in red, beta strands in blue, disulphide bonds in yellow (PDB: 1MR4, 2KOZ, 1FJN, 2LXZ, 1IJV ...
https://en.m.wikipedia.org/wiki/Defensin
Chemical testChemical test
The Phadebas Amylase Test determines alpha-amylase activity. Organic tests[edit]. *The Carbylamine reaction tests for primary ...
https://en.wikipedia.org/wiki/Chemical_test
Stivelse, den frie encyklopædiStivelse, den frie encyklopædi
Properties and applications of starch-converting enzymes of the alpha- amylase family. Journal of Biotechnology, 94(2), 137-155 ...
https://da.wikipedia.org/wiki/Stivelse
Salivary glandSalivary gland
... and amylase to begin the digestion of starches.[6] It is the serous type of gland which secretes alpha-amylase (also known as ... In serous secretions, the main type of protein secreted is alpha-amylase, an enzyme that breaks down starch into maltose and ... The salivary glands of some species are modified to produce proteins - salivary amylase is found in many, but by no means all, ... Examples of other specifically expressed proteins include the digestive amylase enzyme AMY1A, the mucin MUC7 and statherin, all ...
https://en.m.wikipedia.org/wiki/Salivary_gland
Alpha amylase (IPR006046) | InterPro | EMBL-EBIAlpha amylase (IPR006046) | InterPro | EMBL-EBI
Alpha amylase (IPR006046). Short name: Alpha_amylase Overlapping homologous superfamilies *Glycoside hydrolase superfamily ( ... Alpha-amylases, which belong to glycoside hydrolase family 13, are 1,4-alpha-D-glucan glucanohydrolases, which degrade both the ... branched and unbranched forms of starch by cleaving the internal alpha-1,4 bonds connecting the glucose monomers. The products ...
https://www.ebi.ac.uk/interpro/entry/IPR006046
Alpha-amylase - Lactobacillus amylovorusAlpha-amylase - Lactobacillus amylovorus
IPR031319. A-amylase_C. IPR006046. Alpha_amylase. IPR031965. CBM26. IPR006047. Glyco_hydro_13_cat_dom. IPR013780. Glyco_hydro_b ... IPR031319. A-amylase_C. IPR006046. Alpha_amylase. IPR031965. CBM26. IPR006047. Glyco_hydro_13_cat_dom. IPR013780. Glyco_hydro_b ... Alpha-amylaseImported. ,p>Information which has been imported from another database using automatic procedures.,/p> ,p>,a href ... tr,Q48502,Q48502_LACAM Alpha-amylase OS=Lactobacillus amylovorus OX=1604 PE=3 SV=2 ...
http://www.uniprot.org/uniprot/Q48502
Alpha-amylase - WikipediaAlpha-amylase - Wikipedia
Alpha-amylase, (α-amylase) is an enzyme EC 3.2.1.1 that hydrolyses alpha bonds of large, alpha-linked polysaccharides, such as ... The alpha-Amylase Protein alpha-Amylase at the US National Library of Medicine Medical Subject Headings (MeSH) This article ... See amylase for more uses of the amylase family in general. α-Amylase has exhibited efficacy in degrading polymicrobial ... Medical laboratories will usually measure either pancreatic amylase or total amylase. If only pancreatic amylase is measured, ...
https://en.wikipedia.org/wiki/Alpha-amylase
Alpha amylase inhibitor - WikipediaAlpha amylase inhibitor - Wikipedia
In molecular biology, alpha-amylase inhibitor is a protein family which inhibits mammalian alpha-amylases specifically, by ... 1 complex with alpha-amylase. This family of inhibitors has no action on plant and microbial alpha amylases. A crystal ... The binding of tendamistat to alpha-amylase leads to the steric blockage of the active site of the enzyme. The crystal ... König V, Vértesy L, Schneider TR (October 2003). "Structure of the alpha-amylase inhibitor tendamistat at 0.93 A". Acta ...
https://en.wikipedia.org/wiki/Alpha_amylase_inhibitor
What is Alpha Amylase? (with pictures)What is Alpha Amylase? (with pictures)
If a persons alpha amylase levels are too... ... Alpha amylase is a protein that breaks down large molecules of ... Alpha amylase is a protein involved in the digestion of food. This type of digestive enzyme cleaves large molecules of food ... Alpha amylases are enzymes and, by definition, speed up the rate of reactions. In this case, the reaction is to cleave the ... Pancreatic alpha amylase cleaves the linkages of amylose. This compound is a linear form of starch that lacks the side branches ...
https://www.wisegeek.com/what-is-alpha-amylase.htm
alpha amylase, catalytic domain protein [Capnocytophaga sp. oral taxon - Protein - NCBIalpha amylase, catalytic domain protein [Capnocytophaga sp. oral taxon - Protein - NCBI
alpha amylase, catalytic domain protein [Capnocytophaga sp. oral taxon 380 str. F0488]. NCBI Reference Sequence: ZP_19279919.1 ...
https://www.ncbi.nlm.nih.gov/protein/429746575?report=fasta
M)SDS - Alpha Amylase, 2% | Carolina.comM)SDS - Alpha Amylase, 2% | Carolina.com
Introduction to Feeding Preferences in Caenorhabditis elegans The nonparasitic soil nematode Caenorhabditis elegans has served as a model organism for research scientists since the 1960s. This lab introduces students to the organism and provides them with the tools necessary to perform simple experiments. View » ...
https://www.carolina.com/teacher-resources/carolina-labsheets/21801.co?N=2219004719&Nr=&trId=tr-msds-alpha-amylase-2-percent&nore=y
alpha-Amylase antibody | ELISA | A8273 | Sigma-Aldrichalpha-Amylase antibody | ELISA | A8273 | Sigma-Aldrich
Anti-α-Amylase antibody produced in rabbit - Tested Applications: indirect ELISA 1:4,000-1:6,000,Ouchterlony double diffusion ... Anti-α-Amylase antibody produced in rabbit fractionated antiserum, lyophilized powder Synonym: Alpha Amylase Antibody - Anti-α- ... human salivary α-amylase. General description α amylase is an enzyme present in human saliva and pancreatic secretions which ... Anti-α-amylase antibody reacts specifically with α amylase present in human saliva and pancreatic extract but not with other ...
https://www.sigmaaldrich.com/catalog/product/sigma/a8273?lang=en®ion=US
M)SDS - Alpha Amylase, 2% | Carolina.comM)SDS - Alpha Amylase, 2% | Carolina.com
Make your classroom electrifying with activities and information spanning chemistry and physics content. Everything from equilibrium to electricity and reactions to rocketry at your fingertips.. ...
https://www.carolina.com/teacher-resources/life-science/31502.co?N=3495351681&Nr=&nore=y&trId=tr-msds-alpha-amylase-2-percent&nore=y
Alpha-amylase - Tribolium castaneum (Red flour beetle)Alpha-amylase - Tribolium castaneum (Red flour beetle)
IPR006048. A-amylase/branching_C. IPR031319. A-amylase_C. IPR006046. Alpha_amylase. IPR006047. Glyco_hydro_13_cat_dom. ... IPR006048. A-amylase/branching_C. IPR031319. A-amylase_C. IPR006046. Alpha_amylase. IPR006047. Glyco_hydro_13_cat_dom. ... Alpha-amylaseUniRule annotation. ,p>Information which has been generated by the UniProtKB automatic annotation system, without ... Alpha-amylaseSequence analysis. ,p>Information which has been generated by the UniProtKB automatic annotation system, without ...
http://www.uniprot.org/uniprot/Q26855
Alpha-amylase/branching enzyme, C-terminal all beta (IPR006048) | InterPro | EMBL-EBIAlpha-amylase/branching enzyme, C-terminal all beta (IPR006048) | InterPro | EMBL-EBI
Alpha-amylase is an essential enzyme in alpha-glucan metabolism, acting to catalyse the hydrolysis of alpha-1,4-glucosidic ... Alpha-amylase/branching enzyme, C-terminal all beta (IPR006048) *Alpha-amylase, C-terminal domain (IPR031319) ... Evolution of alpha-amylases: architectural features and key residues in the stabilization of the (beta/alpha)(8) scaffold.. Mol ... Alpha-amylase/branching enzyme, C-terminal all beta (IPR006048). Short name: A-amylase/branching_C ...
http://www.ebi.ac.uk/interpro/entry/IPR006048
RCSB PDB - Protein Feature View - Alpha-amylase - P00692 (AMY BACAM)RCSB PDB - Protein Feature View - Alpha-amylase - P00692 (AMY BACAM)
Endohydrolysis of 1->4-alpha-D-glucosidic linkages in polysaccharides containing three or more 1->4-alpha-linked D-glucose ...
http://www.rcsb.org/pdb/protein/P00692
RCSB PDB - 1BLI: BACILLUS LICHENIFORMIS ALPHA-AMYLASE Literature Report PageRCSB PDB - 1BLI: BACILLUS LICHENIFORMIS ALPHA-AMYLASE Literature Report Page
Activation of Bacillus licheniformis alpha-amylase through a disorderorder transition of the substrate-binding site mediated ... ALPHA-AMYLASE A 483 Bacillus licheniformis EC#: 3.2.1.1 IUBMB Mutation: R134L, N190F, Q264S, N265Y, S310G, A320S, E465A Details ...
http://www.rcsb.org/pdb/explore/litView.do?structureId=1BLI
Alpha-amylase inhibitor | GreenMedInfo | Pharmacological ActionAlpha-amylase inhibitor | GreenMedInfo | Pharmacological Action
Alpha-amylase inhibitor, Alpha-glucosidase inhibitor Additional Keywords : Alpha-amylase inhibitor, Alpha-Glucosidase Inhibitor ... Alpha-amylase inhibitor, Alpha-glucosidase inhibitor , Hypoglycemic Agents. Additional Keywords : Alpha-amylase inhibitor, ... Pharmacological Actions : Alpha-amylase inhibitor, Alpha-glucosidase inhibitor , Enzyme Inhibitors: Pancreatic Amylase ... Pharmacological Actions : Alpha-amylase inhibitor, Alpha-glucosidase inhibitor , Enzyme Inhibitors. Additional Keywords : Plant ...
https://www.greenmedinfo.com/pharmacological-action/alpha-amylase-inhibitor
Oramyl (Alpha-Amylase) NovartisOramyl (Alpha-Amylase) Novartis
Oramyl information about active ingredients, pharmaceutical forms and doses by Novartis, Oramyl indications, usages and related health products lists
http://drugs-about.com/drugs-o/oramyl.html
Natural human Pancreatic alpha amylase protein (ab77861)Natural human Pancreatic alpha amylase protein (ab77861)
Buy our Natural human Pancreatic alpha amylase protein. Ab77861 is an active full length protein produced in Nativesyntheticaly ... Natural human Pancreatic alpha amylase protein. See all Pancreatic alpha amylase proteins and peptides. ... from a total amylase concentration in serum of about 120µg/L. Pancreatic amylase and salivary amylase are the products of ... Pancreatic amylase is a digestive enzyme secreted by the pancreas. It consists of a single polypeptide chain with a molecular ...
http://www.abcam.com/natural-human-pancreatic-alpha-amylase-protein-ab77861.html
Biotin Anti-alpha amylase antibody (ab182874) | AbcamBiotin Anti-alpha amylase antibody (ab182874) | Abcam
Rabbit polyclonal alpha amylase antibody conjugated to Biotin. Validated in WB, ELISA, IHC, ICC, Dot and tested in Species ... Full length native protein (purified) corresponding to Bacillus subtilis alpha amylase.. Database link: P00691 ... Anti-alpha amylase antibody (Biotin). See all alpha amylase primary antibodies. * Description. Rabbit polyclonal to alpha ...
https://www.abcam.com/alpha-amylase-antibody-biotin-ab182874.html
Universitätsklinikum Halle(Saale): Alpha-AmylaseUniversitätsklinikum Halle(Saale): Alpha-Amylase
Diese Seite benutzt Cookies, um seinen Besuchern das beste Webseiten-Erlebnis zu ermöglichen. Weiterführende Informationen erhalten Sie in der Datenschutzerklärung der Seiten des UKH ...
https://www.medizin.uni-halle.de/index.php?id=4647&L=556
GM Events withModified alpha amylase| GM Approval Database- ISAAA.orgGM Events withModified alpha amylase| GM Approval Database- ISAAA.org
GM Events with Modified alpha amylase. Event Name and Code. Trade Name. Gene(s) Introduced. ...
https://isaaa.org/gmapprovaldatabase/gmtrait/default.asp?TraitID=22&GMTrait=Modified%20alpha%20amylase
Salivary Alpha-Amylase Activity, a New Biomarker in Heart Failure?Salivary Alpha-Amylase Activity, a New Biomarker in Heart Failure?
Saliva; Salivary !-amylase; Alpha-amylase; Heart failure; National Category Medical and Health Sciences Identifiers. URN: urn: ... Salivary Alpha-Amylase Activity, a New Biomarker in Heart Failure?. Suska, Anke Linköping University, Department of Physics, ... Salivary α-amylase activity is an increasingly investigated biomarker for the activation of the autonomic nervous system. ... Within the control group separately, higher daily salivary α-amylase activity output correlated with increasing levels of NT- ...
http://www.diva-portal.org/smash/record.jsf?pid=diva2:588790
amylase, alpha 1B (salivary) ELISA Kits | Biocompare.comamylase, alpha 1B (salivary) ELISA Kits | Biocompare.com
... alpha 1B (salivary) ELISA Kits from leading suppliers on Biocompare. View specifications, prices, citations, reviews, and more. ... amylase, alpha 1B (salivary) ELISA Kits. The ELISA (enzyme-linked immunosorbent assay) is a well-established antibody-based ... Your search returned 4 amylase, alpha 1B (salivary) ELISA ELISA Kit across 2 suppliers. ...
https://www.biocompare.com/pfu/110627/soids/2-321130/ELISA_Kit/ELISA_amylase_alpha_1B_salivary
Eradicake Alpha-AmylaseEradicake Alpha-Amylase
... alpha-amylase in breaking down filter cake created by starch-based drilling muds. Using Eradicake™ alpha-amylase to break down ... Fuelzyme Alpha-amylase. Industrial Enzyme from USA by Dupont, Verenium. Detalzym GA L-E5 Glucoamylase. Industrial Enzyme from ... Eradicake™ alpha-amylase performs at higher temperatures and across a wider range of operating conditions than competitive ... In support of reservoir clean-up needs, Vereniums Eradicake™ alpha-amylase product addresses the removal of filter cake from ...
http://www.synbioproject.org/cpi/applications/eradicake-alpha-amylase/
1U33: In Situ Extension As An Approach For Identifying Novel Alpha-Amylase Inhibitors - NCBI structure1U33: In Situ Extension As An Approach For Identifying Novel Alpha-Amylase Inhibitors - NCBI structure
A new approach for the discovery and subsequent structural elucidation of oligosaccharide-based inhibitors of alpha-amylases ... based upon autoglucosylation of known alpha-glucosidase inhibitors is presented ... This was transformed from an inhibitor of human pancreatic alpha-amylase with a K(i) value of 18 mm to a trisaccharide analogue ... 1U33: In Situ Extension as an Approach for Identifying Novel Alpha-amylase Inhibitors. Citation: ...
http://www.ncbi.nlm.nih.gov/Structure/mmdb/mmdbsrv.cgi?uid=1u33
Alpha-amylase functions as a salivary gland-specific self T cell ...: Ingenta ConnectAlpha-amylase functions as a salivary gland-specific self T cell ...: Ingenta Connect
One was a human alpha-amylase salivary precursor (AA54-407), suggesting that alpha-amylase might be a salivary gland-specific ... PBL from 11 patients with SS were incubated with 9 different synthetic amino acids of alpha-amylase or salivary alpha-amylase. ... Alpha-amylase functions as a salivary gland-specific self T cell epitope in patients with Sjögrens syndrome. ... SSCP analysis on TCR clearly showed that alpha-amylase reactive T cells were observed in labial salivary glands from 3 of 11 ...
https://www.ingentaconnect.com/content/sp/ijmm/1999/00000003/00000005/art00005
Biochemical, Nutritional and Toxicological Aspects of Alpha-Amylase Inhibitors from Plant Foods | SpringerLinkBiochemical, Nutritional and Toxicological Aspects of Alpha-Amylase Inhibitors from Plant Foods | SpringerLink
... paper is a critical review of the available data on plant protein inhibitors active either on animal or endogenous plant alpha- ... amylases. The First Section is a review of available data on... ... alpha-amylase inhibitor with porcine pancreatic alpha-amylase. ... Some aspects of the mechanism of complexation of red kidney bean alpha-amylase inhibitor and alpha-amylase. Biochemistry, 23, ... Saunders, R.M. (1975). Alpha-amylase inhibitors in wheat and other cereals. Cereal Fd. World, 20, 282-285.Google Scholar ...
https://link.springer.com/chapter/10.1007/978-1-4757-0022-0_28
Inhibitory Effect of Heracleum persicum and Ziziphus jujuba on Activity of Alpha-AmylaseInhibitory Effect of Heracleum persicum and Ziziphus jujuba on Activity of Alpha-Amylase
... Reza Afrisham,1 Mohammad Aberomand,2 ... J.-S. Kim, C.-S. Kwon, and K. H. Son, "Inhibition of alpha-glucosidase and amylase by leuteolin, a flavanoid," Bioscience, ... R. S. Abu Soud, I. I. Hamdan, and F. U. Afifi, "Alpha amylase inhibitory activity of some plant extracts with hypoglycemic ... K. Karthic, K. S. Kirthiram, S. Sadasivam, B. Thayumanavan, and T. Palvannan, "Identification of alpha amylase inhibitors from ...
https://www.hindawi.com/journals/jb/2015/824683/ref/
Novozymes releases new alpha-amylase effective at low pH : Biofuels DigestNovozymes releases new alpha-amylase effective at low pH : Biofuels Digest
Novozymes releases new alpha-amylase effective at low pH. September 22, 2015 , Meghan Sapp ... Liquozyme LpH is an alpha-amylase effective at low pH that thins the mash by breaking down starch into shorter dextrin chains. ...
http://www.biofuelsdigest.com/bdigest/2015/09/22/novozymes-releases-new-alpha-amylase-effective-at-low-ph/
Alpha-amylase | definition of alpha-amylase by Medical dictionaryAlpha-amylase | definition of alpha-amylase by Medical dictionary
... alpha-amylase explanation free. What is alpha-amylase? Meaning of alpha-amylase medical term. What does alpha-amylase mean? ... Looking for online definition of alpha-amylase in the Medical Dictionary? ... alpha-amylase. Also found in: Dictionary, Thesaurus, Encyclopedia, Wikipedia.. Related to alpha-amylase: Amyloglucosidase, ... Alpha-amylase , definition of alpha-amylase by Medical dictionary https://medical-dictionary.thefreedictionary.com/alpha- ...
https://medical-dictionary.thefreedictionary.com/alpha-amylase
Alpha-Amylase pharmaceutical drugs and health productsAlpha-Amylase pharmaceutical drugs and health products
Alpha-Amylase indications and usages ATC and ICD codes, combinations with other active ingredients and trade names information ... Alpha-Amylase. Lipase. Protease Dipan 9 - Thorne Research Alpha-Amylase. Papain Neopeptine Liquid - Raptakos Brett. Zymowin - ... Alpha-Amylase. Ampicillin Angicilin - Grupo Vita / Vita Cientifica Alpha-Amylase. Anise Oil. Caraway Oil. Dill Oil. Papain ... Alpha-Amylase Alfa-Amylase - Biogaran. Alfa-Amylase BGR - Ferlux Laboratoire. Maxilase - Sanofi-Aventis. Megamylase - Leurquin ...
https://drugs-about.com/ing/alpha-amylase.html
WO2015165472A3 - Cold-active alpha-amylase - Google PatentsWO2015165472A3 - Cold-active alpha-amylase - Google Patents
Functional, biochemical analysis has documented that the alpha-amylase is cold-adapted with a temperature optimum at 10 °C to ... Sequence analysis has indicated that the alpha-amylase is related to Clostridia , and has revealed classical characteristics of ... There is provided a novel cold-active alpha-amylase identified by a functional metagenomic approach expressed in E. coli and ... WO2015165472A3 - Cold-active alpha-amylase - Google Patents. Cold-active alpha-amylase Download PDF Info. Publication number. ...
https://patents.google.com/patent/WO2015165472A3/en?oq=WO%2F2015%2F165472
EnZymesStarchInhibitorsInhibitorBacillusBeta-AmylaseSalivaPancreatic amylaseEnzyme alpha-amylasePancreasCortisol and alpha-amylaseAntibodyProteinAMY2AInhibitionReactivityHydrolysisCharacterizationLipaseForm of amylaseProteinsGeneAspergillusActivityTotal amylaseIsoenzymesFamily 13Amino acidsAbstractThermostableDigestiveLinkagesMicrobialBiomarkersAMY2BGlucoseMaltoseGlobal Alpha-AmylaseBacterial alpha-amylaseSalivary alpha-AmylasesFungiELISASubstratePsychosocial stressInhibitMaltogenicAssaysProduce amylaseGlucosidaseXylanaseHuman
EnZymes20
  • Alpha amylases are enzymes and, by definition, speed up the rate of reactions. (wisegeek.com)
  • Verenium Corporation (Nasdaq: VRNM), an industrial biotechnology company focused on the development and commercialisation of high-performance enzymes, has launched VEREFLOW alpha-amylase , a unique enzyme for the removal of filter cake in drilling operations. (thefreedictionary.com)
  • Sequence analysis has indicated that the alpha-amylase is related to Clostridia , and has revealed classical characteristics of cold-adapted enzymes. (google.com)
  • Enzymes α -amylase and α -glucosidase found in saliva and the brush border of the small intestine, respectively, act on hydrolysis oligosaccharides and disaccharides to produce easy absorption monosaccharides such as glucose. (hindawi.com)
  • High Temperature Alpha Amylase Brewing Enzymes Non - GMO For Soy Sauce Brewing Food Grade Heat-stable Alpha - Amylase LIQMEI FD A robust and cost-effective high - temperature almylase produced from non-genetic modified strains of Bacillus licheniformis enables. (spintoband.com)
  • EXPLANATION Enzymes used for the hydrolysis of starch, generally called amylases, have a long history of use by the food industry. (inchem.org)
  • Enzymes containing this domain, such as alpha-amylase, belong to family 13 of the glycosyl hydrolases. (embl.de)
  • Additionally, enzymes such as alpha-amylase , a high-fructose corn syrup, and maltogenic alpha-amylase , which is used for anti-staling in bread, are already used commercially. (thefreedictionary.com)
  • Typically the plant polyphenols slow down absorption of dietary starch, releasing the glucose less rapidly into the blood stream by impairing the activity of digestive enzymes, such as alpha-amylase and alpha-glucosidase. (thefreedictionary.com)
  • Due to the large amount of data available on alpha-amylase, Anfinsen believed that the enzyme was a 'favorable' choice for the comparison of mesophilic, or optimal temperature-loving, and Thermophilic enzymes. (nih.gov)
  • Amylase enzymes are used to metabolize starch into sugars like glucose and maltose [2]. (coursehero.com)
  • One therapeutic approach for treating diabetes is decreasing post-prandial hyperglycemia by delaying glucose absorption through carbohydrate-hydrolyzing enzymes inhibition, α-glucosidase and α-amylase in the digestive tract. (scialert.net)
  • en] Permanently cold environments, like polar regions, have been colonized by a great variety of psychrophilic organisms producing enzymes adapted to function efficiently at low temperatures. (ac.be)
  • The blocking group in BPNPG7 prevents hydrolysis of this substrate by exo -acting enzymes such as amyloglucosidase, α-glucosidase, and β-amylase. (megazyme.com)
  • Alpha-glucosidase enzymes are located in the brush border of the small intestines. (biomedcentral.com)
  • These types of alpha-amylase sources are used in combination with other enzymes including xylanase, fungal alpha-amylase and lipase to secure optimum crumb softness during bread baking processes. (abnewswire.com)
  • However, the high operational cost incurred to produce alpha-amylase by using maltogenic and other enzymes is expected to limit the usage of maltogenic alpha-amylase enzymes over the forecast period. (abnewswire.com)
  • The pancreas and salivary gland make amylase ( alpha amylase ) to hydrolyse dietary starch into disaccharides and trisaccharides which are converted by other enzymes to glucose to supply the body with energy. (wikipedia.org)
  • Alpha amylases can be found in a variety of body fluids and they are some of the few enzymes that can be found in urine from healthy individuals 7 . (aaltoscientific.com)
  • Amylases are important hydrolase enzymes which have been widely used since many decades. (foodelphi.com)
Starch35
  • Alpha-amylases, which belong to glycoside hydrolase family 13, are 1,4-alpha-D-glucan glucanohydrolases, which degrade both the branched and unbranched forms of starch by cleaving the internal alpha-1,4 bonds connecting the glucose monomers. (ebi.ac.uk)
  • Alpha-amylase, (α-amylase) is an enzyme EC 3.2.1.1 that hydrolyses alpha bonds of large, alpha-linked polysaccharides, such as starch and glycogen, yielding shorter chains thereof, dextrins, and maltose. (wikipedia.org)
  • Amylase is found in saliva and breaks starch into maltose and dextrin. (wikipedia.org)
  • Alpha-amylase is an essential enzyme in alpha-glucan metabolism, acting to catalyse the hydrolysis of alpha-1,4-glucosidic bonds of glycogen, starch and related polysaccharides. (ebi.ac.uk)
  • Branching enzyme catalyses the formation of alpha-1,6 branch points in either glycogen or starch. (ebi.ac.uk)
  • Laboratory and field tests have shown the effectiveness of Eradicake™ alpha-amylase in breaking down filter cake created by starch-based drilling muds. (synbioproject.org)
  • Liquozyme LpH is an alpha-amylase effective at low pH that thins the mash by breaking down starch into shorter dextrin chains. (biofuelsdigest.com)
  • CARBOHYDRASE (alpha-AMYLASE) FROM BACILLUS LICHENFORMIS EXPLANATION Carbohydrase is an enzyme that catalyzes the hydrolysis of alpha-1,4-glycosidic linkages of starch. (inchem.org)
  • The novel alpha-amylases are useful in hydrolyzing and/or liquefying starch and due to their stability at low pH values they can be used in conjunction with other acid stable amylases such as gluco-amylase in either a soluble or an immobilized form. (freepatentsonline.com)
  • 2. The alpha-amylase enzyme of claim 1, wherein said enzyme is capable of retaining at least about 50% of its initial alpha-amylase activity at a temperature of 85° C. and at a pH of 4.55 for 30 minutes in the presence of 5 mM of calcium ion and 22.5%, by weight, starch, d.s. (freepatentsonline.com)
  • 6. The process of claim 3, wherein the starch hydrolysate is heated to a temperature above 100° C. and thereafter cooled and treated with additional alpha-amylase. (freepatentsonline.com)
  • The maltogenic alpha-amylase is an enzyme which catalyses hydrolysis of (1-4)-alpha-D-glucosidic linkages in polysaccharides so as to remove successive alpha-maltose residues from the non-reducing ends of the chains in the conversion of starch to maltose. (embl.de)
  • To generate dietary glucose from starch, salivary and pancreatic alpha-amylase as well as gut mucosal alpha-glucosidases must be involved in the digestive process. (thefreedictionary.com)
  • Best known as the enzyme that begins the process of degrading starch molecules in our food, it is now becoming clear that alpha-amylase plays an additional role in the maintenance of oral health. (salimetrics.com)
  • Add the 4 g sachet of Alpha-Amylase and bring your starch slurry to the boil and maintain for 30 minutes, then reduce the heat and simmer for 1-2 hours to break down your starch. (stillspirits.com)
  • Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. (acris-antibodies.com)
  • 2009). Amylases also help endophytes to degrade the available starch when the plant reaches senescence (Sunitha, Devi & Srinivas, 2013). (thefreelibrary.com)
  • Non-cereal additives such as the starch-degrading enzyme alpha-amylase from Aspergillus oryzae are today regularly present in baking flours. (phadia.com)
  • The starch-degrading enzyme alpha-amylase from Aspergillus oryzae and soybean flour (Glycine max) are examples of such additives that, together with the cereal components, are responsible for sensitization and IgE-mediated symptoms in bakers and others exposed to baking flours (1). (phadia.com)
  • In this article, Anfinsen, et al, reported that they had purified to homogeneity the alpha-amylase, an enzyme that degrades starch, from the hyperthermophilic archaebacterium Pyrococcus furiosus. (nih.gov)
  • This will be used to determine, indirectly, how much starch amylase consumes. (coursehero.com)
  • Byacting at random locations along the starch chain, human AMY1A breaks downlong-chain carbohydrates, ultimately yielding maltotriose and maltose fromamylose, or maltose, glucose and 'limit dextrin' from amylopectin.Because human salivary amylase can act anywhere on the substrate, human AMY1Atends to be faster acting than beta amylase enzyme. (creativebiomart.net)
  • A powder Alpha-Amylase suitable for the production of starch sugar, can liquefy starch materials under low pH conditions and decrease viscosity of starch quickly. (xuijs.com)
  • It is an endoamylase which can rapidly decrease the viscosity of gelatinous starch solution by randomly hydrolyzing starch, glycogen and its degradation products within the alpha-D-1, 4 glucosidic bonds to produce soluble dextrin and oligosaccharides. (xuijs.com)
  • One unit amount of inhibitor which, after preincubation for 20 minutes at 25° C, pH 6.9 will reduce the activity of two units of human salivary alpha-amylase by 50% (one unit of alpha-amylase will liberate, from soluble starch, one micromole of maltose per minute at 25° C, pH 6.9). (creative-enzymes.com)
  • Definition of Unit: 1 unit of Fungal α-Amylase equals to the amount of enzyme which hydrolyzes soluble starch to get 10mg reducing sugar (in glucose) at 40℃ and pH5.0 in 30min. (sunsonchinaenzymes.com)
  • An amylase ( / ˈ æ m ɪ l eɪ z / ) is an enzyme that catalyses the hydrolysis of starch (Latin amylum ) into sugars . (wikipedia.org)
  • Foods that contain large amounts of starch but little sugar, such as rice and potatoes , may acquire a slightly sweet taste as they are chewed because amylase degrades some of their starch into sugar. (wikipedia.org)
  • By acting at random locations along the starch chain, α-amylase breaks down long-chain saccharides , ultimately yielding either maltotriose and maltose from amylose , or maltose, glucose and "limit dextrin" from amylopectin . (wikipedia.org)
  • During the ripening of fruit , β-amylase breaks starch into maltose, resulting in the sweet flavor of ripe fruit. (wikipedia.org)
  • α- and β-amylases are important in brewing beer and liquor made from sugars derived from starch . (wikipedia.org)
  • Alpha-amylase (α-amylase) which also has alternate names of 1,4-α-D-glucan glucanohydrolase and glycogenase, is a digestive enzyme which is responsible for breaking down starch to maltose, this can be carried out by hydrolysing alpha-1,4 bonds of large polysaccharides such as starch and glycogen and yielding smaller by-products such as glucose and maltose. (elisakits.co.uk)
  • The strong amylolytic power of Alpha Amylase Enzyme - allows rapid conversion of the starch size into dextrins, which are easily removed by rinsing following impregnation with enzyme. (alpha-amylaseenzyme.com)
  • Whether the end-product is high fructose syrup, dextrose, maltose, maltodextrin or polyols, the process starts with an alpha-amylase for starch liquefaction that can be applied under a wide range of conditions. (in.net)
  • SuperLIQ™ X5 Alpha-amylase is designed for starch-based feedstock ethanol production. (bestzyme.com)
Inhibitors30
  • This family of inhibitors has no action on plant and microbial alpha amylases. (wikipedia.org)
  • A new approach for the discovery and subsequent structural elucidation of oligosaccharide-based inhibitors of alpha-amylases based upon autoglucosylation of known alpha-glucosidase inhibitors is presented. (nih.gov)
  • The three-dimensional structure of this complex was determined by x-ray crystallography and represents the first such structure determined with this class of inhibitors in any alpha-glycosidase. (nih.gov)
  • This approach to the discovery and structural analysis of amylase inhibitors should be generally applicable to other endoglucosidases and readily adaptable to a high throughput format. (nih.gov)
  • This paper is a critical review of the available data on plant protein inhibitors active either on animal or endogenous plant alpha-amylases. (springer.com)
  • The Second Section deals with properties of amylase-inhibitor complexes and parameters controlling the interaction between amylases and inhibitors. (springer.com)
  • The Third Section discusses possible roles of these inhibitors in the plant, whereas Section Four focusses on nutritional and toxicological significance of amylase inhibitors for human beings and other mammals. (springer.com)
  • Lastly Section Five examines some applications in medicine of alpha-amylase inhibitors from plants. (springer.com)
  • Characterization of chicken pancreas alpha-amylase isozymes and interaction with protein inhibitors from wheat kernel. (springer.com)
  • Interaction of wheat monomeric and dimeric protein inhibitors with alpha-amylase from yellow mealworm (Tenebrio molitor L. Larva). (springer.com)
  • Wheat protein inhibitors of alpha-amylase. (springer.com)
  • Affinity column purification of amylases on protein inhibitors from wheat kernel. (springer.com)
  • I. Funke and M. F. Melzig, "Traditionally used plants in diabetes therapy: phytotherapeutics as inhibitors of α -amylase activity," Revista Brasileira de Farmacognosia , vol. 16, no. 1, pp. 1-5, 2006. (hindawi.com)
  • Type 2 Diabetes mellitus, inhibitors of a -amylase activity, plants traditionally used in diabetes treatment, polyphenolic compounds. (scielo.br)
  • Frels JM, Rupnow JH: Purification and partial characterization of two alpha-amylase inhibitors from black bean (Phaseolus vulgaris). (thefreedictionary.com)
  • The alpha-glucosidase inhibitors are competitive, reversible inhibitors of alpha-amylase from the pancreas and alpha-glucosidase, which is found in the brush border of the small intestine. (thefreedictionary.com)
  • Alpha-Glucosidase inhibitors. (thefreedictionary.com)
  • A nutritional supplement composition contains inhibitors of alpha-glucosidase and alpha-amylase substantially in the absence of lipase inhibitors. (google.com)
  • The present invention relates to nutritional supplement compositions containing alpha-glucosidase and alpha-amylase inhibitors. (google.com)
  • More specifically, the invention relates to nutritional supplement compositions that include effective amounts of alpha-glucosidase and alpha-amylase inhibitors substantially in the absence of lipase inhibitor. (google.com)
  • Two inhibitors, acarbose and cyclodextrins (CD), were used to investigate the active site structure and function of barley alpha-amylase isozymes, AMY1 and AMY2. (dtu.dk)
  • alpha-CD inhibited the AMY1 and AMY2 catalysed hydrolysis of amylose, but was a very weak inhibitor compared to acarbose.beta- and gamma-CD are not inhibitors. (dtu.dk)
  • These modified substrates may be used for the detection and kinetic analysis of a-amylases, and are useful in rapidly screening for novel a-amylase inhibitors and for subsequent kinetic characterisation. (ubc.ca)
  • Wheat grains accumulate a variety of low molecular weight proteins that are inhibitors of alpha-amylases and proteases and play an important protective role in the grain. (biomedcentral.com)
  • The alpha-amylase/protease inhibitors also are of interest because they cause IgE-mediated occupational and food allergies and thereby impact human health. (biomedcentral.com)
  • The complement of genes encoding alpha-amylase/protease inhibitors expressed in the US bread wheat Butte 86 was characterized by analysis of expressed sequence tags (ESTs). (biomedcentral.com)
  • These included two monomeric (WMAI), four dimeric (WDAI), and six tetrameric (WTAI) inhibitors of exogenous alpha-amylases, two inhibitors of endogenous alpha-amylases (WASI), four putative trypsin inhibitors (CMx and WTI), and one putative chymotrypsin inhibitor (WCI). (biomedcentral.com)
  • A number of other proteins share structural similarities to the alpha-amylase inhibitors but are active against specific proteases. (biomedcentral.com)
  • These products include alpha-amylase and glucosidase inhibitors. (biomedcentral.com)
  • Similar alpha-amylase inhibitors also occur in wheat, rye and some other beans. (creative-enzymes.com)
Inhibitor20
  • In molecular biology, alpha-amylase inhibitor is a protein family which inhibits mammalian alpha-amylases specifically, by forming a tight stoichiometric 1:1 complex with alpha-amylase. (wikipedia.org)
  • A crystal structure has been determined for tendamistat, the 74-amino acid inhibitor produced by Streptomyces tendae that targets a wide range of mammalian alpha-amylases. (wikipedia.org)
  • Structure of the alpha-amylase inhibitor tendamistat at 0.93 A". Acta Crystallogr. (wikipedia.org)
  • This concept, highly analogous to what is hypothesized to occur with acarbose, is demonstrated with the known alpha-glucosidase inhibitor, d-gluconohydroximino-1,5-lactam. (nih.gov)
  • This was transformed from an inhibitor of human pancreatic alpha-amylase with a K(i) value of 18 mm to a trisaccharide analogue with a K(i) value of 25 mum. (nih.gov)
  • Inactivation of Phaseolamin, an alpha-amylase inhibitor from Phaseolus vulgaris by gastric acid and digestive proteases. (springer.com)
  • Inhibitor test for amylase isoenzymes. (springer.com)
  • Interaction of Tenebrio molitor L. alpha-amylase with a wheat flour protein inhibitor. (springer.com)
  • Purification and properties of an alpha-amylase tetrameric inhibitor from wheat kernel. (springer.com)
  • The composition can include touchi extract and phaseolamin as the alpha-glucosidase and alpha-amylase inhibitor, respectively. (google.com)
  • Interestingly, further studies showed that the selected CBD variants were capable of competing with the binding of the amylase inhibitor acarbose to the enzyme. (diva-portal.org)
  • alpha-Amylase was purified to apparent homogeneity from normal pancreas and a transplantable pancreatic acinar carcinoma of the rat by affinity chromatography on alpha-glucohydrolase inhibitor (alpha-GHI) bound to aminohexyl-Sepharose 4B. (curehunter.com)
  • This protein functions both as an alpha-amylase inhibitor and as a chitinase. (mybiosource.com)
  • Below are the list of possible Alpha-amylase inhibitor/endochitinase products. (mybiosource.com)
  • Also known as Alpha-amylase inhibitor/endochitinase (Fragments). (mybiosource.com)
  • Information on the spectrum of alpha-amylase/protease inhibitor genes and proteins expressed in a single wheat cultivar is central to understanding the importance of these proteins in both plant defense mechanisms and human allergies and facilitates both breeding and biotechnology approaches for manipulating the composition of these proteins in plants. (biomedcentral.com)
  • All of the mature alpha-amylase/protease inhibitor proteins contain 10 cysteine residues that form five disulfide bonds. (biomedcentral.com)
  • Heterologous expression of an α-amylase inhibitor from common bean ( Phaseolus vulgaris ) in Kluyveromyces lactis and Saccharomyces cerevisiae . (megazyme.com)
  • Phaseolamin or α-amylase inhibitor 1 (αAI) is a glycoprotein from common beans ( Phaseolus vulgaris L.) that inhibits some insect and mammalian α-amylases. (megazyme.com)
  • The common white bean (Phaseolus vulgaris) produces an alpha-amylase inhibitor, which has been characterized and tested in numerous clinical studies. (biomedcentral.com)
Bacillus17
  • Crystal structure of calcium-depleted Bacillus licheniformis alpha-amylase at 2.2 A resolution. (ebi.ac.uk)
  • Full length native protein (purified) corresponding to Bacillus subtilis alpha amylase. (abcam.com)
  • The preferred alpha-amylases are prepared by culturing a strain of a Bacillus stearothermophilus microorganism in a suitable culture medium. (freepatentsonline.com)
  • 8. A heat and acid-stable alpha-amylase enzyme characterized as having a pH optimum between 4.0 and 5.2 and as being derived from a strain of Bacillus stearothermophilus which is a member selected from the group consisting of ATCC Nos. (freepatentsonline.com)
  • High - Temperature Alpha - Amylase (Powder) High - temperature alpha - amylase is made from the best strain of Bacillus licheniformis through deep fermentation and extraction technique. (spintoband.com)
  • Bacterial (Bacillus subtilis) alpha- amylase has been in common use to control the viscosity of chocolate syrup since 1929 and in the brewing industry since 1936. (inchem.org)
  • This alpha-amylase from Bacillus subtilis B1-109 (ATCC 39,701) containing plasmid pCPC 800 [amylase gene from B. megaterium (NCIB 11568)] and regulating sequences from alpha-amylase of B. stearothermophilus (see Appendix 2) has not been previously evaluated by the Committee. (inchem.org)
  • 2.2.2 Short term studies 2.2.2.1 Rat Groups of 5 male and 5 female rat (Fischer 344) were exposed to enzyme levels of either 0.0, 20.0, 60.0 or 100.0 U/g Bacillus megaterium for 14 days (equivalent to 0, 1, 3 or 5% liquid use product or approximately 0, 0.32, 0.99 or 1.57 g/kg b.w./day), in the diet (alpha-amylase 6000 U/g). (inchem.org)
  • 2.2.2.2 Dog Groups of 1 male and 1 female dog (Beagle dogs, 6-7 months of age) were exposed to enzyme levels of either 0.0, 20.0, 60.0 or 100.0 U/g Bacillus megaterium for 15 days (approximately 0, 0.12, 0.29 or 0.74 g/kg b.w./day) in the diet (alpha-amylase 6000 U/g). (inchem.org)
  • Groups of 4 male and 4 female dogs (Beagle dogs, 6-7 months of age) were exposed to enzyme at levels of 0, 20, 60 or 100 U/g Bacillus megaterium amylase based on 5100 units of amylase/g of test material for 13 weeks in the diet (approximately 0, 0.12, 0.32 or 0.57 g/kg b.w./day). (inchem.org)
  • In contrast, the corresponding mesophilic (Bacillus amyloliquefaciens) and thermostable (B. licheniformis) alpha-amylases showed a 39 and 46% decrease in activity respectively. (ac.be)
  • In this study, Alpha amylase from Bacillus subtilis was immobilized by entrapment in Calcium Alginate beads (CA). To improve the properties of these beads, alginate was blended with Cellulosic Residue (CR) obtained from sorghumstarch extraction. (pagepress.org)
  • Heat stable Alpha-Amylase HT-0400 is a powder enzyme preparation derived from Bacillus licheniformis through submerged fermentation and refining extraction process. (xuijs.com)
  • Heat-Resistant Alpha- Amylase is a clear brown liquid made of Bacillus Subtilis cultures with excellent heat resistance. (ulprospector.com)
  • The α-amylase form is also found in plants, fungi ( ascomycetes and basidiomycetes ) and bacteria ( Bacillus ). (wikipedia.org)
  • Most of the Bacillus species can synthesis and secret extracellular alpha amylase. (foodelphi.com)
  • Due to this ability of Bacillus spesies we use Bacillus in order to obtain alpha amylase. (foodelphi.com)
Beta-Amylase3
  • Introduction The two most common amylases in nature are alpha-amylase and beta-amylase [1]. (coursehero.com)
  • Beta amylase tends to be more prevalent among bacteria, yeast and mold [1]. (coursehero.com)
  • Structure of barley beta-amylase. (wikipedia.org)
Saliva13
  • Although found in many tissues, amylase is most prominent in pancreatic juice and saliva, each of which has its own isoform of human α-amylase. (wikipedia.org)
  • Anti-α-amylase antibody reacts specifically with α amylase present in human saliva and pancreatic extract but not with other proteins of saliva and pancreatic extract. (sigmaaldrich.com)
  • The antiserum is specific for human a-amylase found in human saliva and human pancreatic extract. (sigmaaldrich.com)
  • Purified alpha-amylase from human parotid saliva was radiolabeled and found to bind to strains of S. sanguis genotypes 1 and 3 and S. mitis genotype 2, but not to strains of other species of oral bacteria. (asm.org)
  • This study assayed cotinine (a metabolite of nicotine), cortisol, and alpha-amylase (sAA) in the saliva of mother-infant dyads from 197 low income and ethnically diverse families. (biomedsearch.com)
  • We investigated whether exposure to blue light during daytime could be an efficient countermeasure to limit sleep restriction's impact on relevant behavioral (stress, sleepiness, sustained attention, and memory performance) and physiological (saliva cortisol, testosterone, and alpha-amylase) markers. (monash.edu)
  • A subclass of alpha-amylase ISOENZYMES that are secreted into SALIVA. (uchicago.edu)
  • Amylase is present in the saliva of humans and some other mammals, where it begins the chemical process of digestion . (wikipedia.org)
  • Alpha amylase is predominately synthesised in the acinar cells of the saliva glands and can be stored in secretory granules inside the cells. (elisakits.co.uk)
  • Alpha-amylase production by saliva glands can be elevated in response to physical and psychological stress via interactions with the autonomic nervous system. (elisakits.co.uk)
  • Alpha amylase saliva ELISA kit is an accurate in vitro quantitative method for detecting alpha-amylase (α-amylase) in human saliva samples. (elisakits.co.uk)
  • The minimum sensitivity detection limit of alpha-amylase (α-amylase) using this human alpha amylase saliva ELISA kit was approximately 3.6 U/ml. (elisakits.co.uk)
  • Increased salivary immunoglobulin A and reduced α-amylase activity in whole saliva from spastic cerebral palsy individuals. (elisakits.co.uk)
Pancreatic amylase9
  • Medical laboratories will usually measure either pancreatic amylase or total amylase. (wikipedia.org)
  • If only pancreatic amylase is measured, an increase will not be noted with mumps or other salivary gland trauma. (wikipedia.org)
  • Pancreatic amylase is a digestive enzyme secreted by the pancreas. (abcam.com)
  • Pancreatic amylase occurs in serum at a concentration of about 60µg/L, from a total amylase concentration in serum of about 120µg/L. Pancreatic amylase and salivary amylase are the products of separate genes and, although they share 98% amino acid sequence homology, they differ in molecular size, isoelectric point and antigenic properties. (abcam.com)
  • S. Shobana, Y. N. Sreerama, and N. G. Malleshi, "Composition and enzyme inhibitory properties of finger millet ( Eleusine coracana L.) seed coat phenolics: mode of inhibition of α -glucosidase and pancreatic amylase," Food Chemistry , vol. 115, no. 4, pp. 1268-1273, 2009. (hindawi.com)
  • Pancreatic Amylase Alpha Monoclonal antibody specifically detects Pancreatic Amylase Alpha in Rat samples. (fishersci.com)
  • Pancreatic Amylase Alpha Monoclonal antibody specifically detects Pancreatic Amylase Alpha in Human samples. (fishersci.com)
  • 1 µg of coated antigen can be sensitively detected by anti-Rat Pancreatic Amylase antibody, clone B5 used at 30 pg/well concentration. (acris-antibodies.com)
  • 9. Moridani, M.Y. and Bromberg, I.L. Lipase and Pancreatic Amylase versus Total Amylase as Biomarkers of Pancreatitis: An Analytical Investigation. (aaltoscientific.com)
Enzyme alpha-amylase3
  • Since the release of salivary enzyme alpha-amylase was reported to react to physiological and psychological stressors, we set out to investigate human salivary alpha-amylase changes employing a reliable laboratory stress protocol to investigate the reactivity of salivary alpha-amylase to a brief period of psychosocial stress. (nih.gov)
  • One such protein is the salivary enzyme alpha-amylase. (salimetrics.com)
  • The enzyme alpha-amylase, also referred to as allergen Asp o 2, loses its enzyme activity when heated. (phadia.com)
Pancreas6
  • The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. (acris-antibodies.com)
  • Recovery was 95-100% for both pancreas and tumour alpha-amylases . (curehunter.com)
  • More than 95% of the alpha-amylase activity in the pancreas and in the tumour was absorbed by an excess amount of either antibody, indicating that normal and tumour alpha-amylases are immunologically identical. (curehunter.com)
  • Amylase is secreted into the small intestines by the pancreas. (biomedcentral.com)
  • Although many tissues can produce alpha amylase 3 , the forms found in serum are most often from the pancreas and salivary glands 2 . (aaltoscientific.com)
  • This can be made more specific by testing for amylase isoenzymes specific to the pancreas 6,8,9 . (aaltoscientific.com)
Cortisol and alpha-amylase2
  • Individual differences in salivary cortisol and alpha-amylase in mothers and their infants: relation to tobacco smoke exposure. (biomedsearch.com)
  • We demonstrate: (1) procedures for collection of salivary samples in cognitive impaired older adults by family caregivers in the home setting, (2) procedures for measuring stress activity via salivary cortisol and alpha amylase, and (3) representative profiles. (jove.com)
Antibody5
  • Mouse pancreatic sections were fixed in 4% paraformaldehyde and used for immunohistochemistry using rabbit anti-amylase antibody at a dilution of 1:100. (sigmaaldrich.com)
  • This antibody is specific for Homo sapiens amylase, alpha 2A (pancreatic) (AMY2A). (fishersci.com)
  • The antibody detects the Rat Amylase at the expected molecular weight i.e. at ~54kDa in the pancreatic lysate and recombinant protein at ~ 60 kDa. (acris-antibodies.com)
  • Monoclonal antibody that specifically binds to alpha-amylase and is useful for detecting weather damage (i.e. pre-harvest sprouting) in cereal grain. (in.net)
  • Benefits: Efficient Dextrose Equivalent development - when high DE development in a short time is a key parameter ER alpha was detected at ~66 kD (left panel) using an ER alpha monoclonal antibody (Product # MA5-13191) at a dilution of 1:500 in blocking buffer overnight at 4C on a rocking platform, followed by an HRP-conjugated goat anti-mouse IgG secondary antibody (Product # 31430) at a dilution of 1:40,000. (in.net)
Protein5
  • The number of gene copies correlates with the levels of salivary amylase, as measured by protein blot assays using antibodies to human amylase. (wikipedia.org)
  • Alpha amylase is a protein involved in the digestion of food. (wisegeek.com)
  • alpha amylase, catalytic domain protein [Capnocytophaga sp. (nih.gov)
  • This protein is involved in the endohydrolysis of 1,4-alpha-glucosidic linkages in oligosaccharides and polysaccharides. (ptglab.com)
  • Below are the list of possible Alpha-amylase-related protein products. (mybiosource.com)
AMY2A2
  • salivary - AMY1A, AMY1B, AMY1C pancreatic - AMY2A, AMY2B α-Amylase activity in grain is measured by, for instance, the Hagberg-Perten Falling Number, a test to assess sprout damages, or the Phadebas method. (wikipedia.org)
  • Human amylases (Amy1, Amy2A, and Amy2B) commonly have two potential N-glycosylation sites (N427 and N476) in their C-terminal region (S Takashima, J Amano, 2012). (ptglab.com)
Inhibition8
  • Inhibition of alpha-amylase purified from Octopus vulgaris Lam. (springer.com)
  • For the above mentioned, delaying absorption of glucose through inhibition of enzymatic hydrolysis of carbohydrates, carried out by alpha amylase and alpha glucosidase, could be another form of combating DM [ 4 ]. (hindawi.com)
  • The inhibition of a -amylase activity is only one possibility to lower postprandial blood glucose levels. (scielo.br)
  • T. coadunate and A. precatorius showed effective results with an IC50 value of 80.89 and 70.29 µg/ml respectively in α-amylase inhibition test. (academicjournals.org)
  • One of the strategies is maintaining postprandial glucose level through inhibition of α-amylase and α-glucosidase and preventing the hydrolysis of Glucagon Like Peptide-1 (GLP-1) through inhibition of Dipeptidyl peptidase IV. (scialert.net)
  • This study showed us that some extracts have inhibition activity of α-glucosidase, α-amylase and DPP-IV. (scialert.net)
  • The first report of alpha-amylase inhibition by purified wheat proteins was by Silano et al. (biomedcentral.com)
  • During purification, specific alpha-amylase inhibitory activities were increased about 3.4-fold, and the 50% inhibition value was 5.71 micrograms/mL in the Sephadex LH-20 fraction (SE-fraction). (usda.gov)
Reactivity1
  • We therefore set out here to examining salivary alpha-amylase (sAA) reactivity in relation with childhood adversity. (uzh.ch)
Hydrolysis4
  • The amylase catalyzes the hydrolysis of 1,4 alpha-glucosidic linkages in common polysaccharide. (inchem.org)
  • Human Salivary alpha Amylase enzyme Unit Definition: One unitwill catalyze the hydrolysis of one micromole of malto pentaose, whichthrough coupled reactions results in the formation of 5 micromoles ofglucose=6-phosphate per minute at 37°C. Measured at 340 nm as an equimolaramount of NADH produced by a coupled reaction. (creativebiomart.net)
  • Working from the non-reducing end, β-amylase catalyzes the hydrolysis of the second α-1,4 glycosidic bond, cleaving off two glucose units ( maltose ) at a time. (wikipedia.org)
  • Although no useful spectrophotometric changes occur during the amylase catalyzed hydrolysis of these glycosidic bonds, the release of glucose can be coupled to an enzyme such as hexokinase. (aaltoscientific.com)
Characterization2
  • Characterization of salivary alpha-amylase binding to Streptococcus sanguis. (asm.org)
  • Purification and characterization of alpha-amylase from rat pancreatic acinar carcinoma. (curehunter.com)
Lipase3
  • The test for amylase is easier to perform than that for lipase, making it the primary test used to detect and monitor pancreatitis. (wikipedia.org)
  • 6. ott, J.A. and Lu, C.J. Lipase Isoforms and Amylase Isoenzymes: Assays and Applications in the Diagnosis of Acute Pancreatitis. (aaltoscientific.com)
  • 8. Leclerc, P. and Forest, J.C. Variations in Amylase Isoenzymes and Lipase during Acute Pancreatitis, and in Other Disorders Causing Hyperamylasemia. (aaltoscientific.com)
Form of amylase3
  • It is the major form of amylase found in humans and other mammals. (wikipedia.org)
  • This form of amylase is also called "ptyalin" /ˈtaɪəlɪn/, which was named by Swedish chemist Jöns Jacob Berzelius. (wikipedia.org)
  • Amylase may also play a role in diagnosing cancers other than pancreatic cancer, such as multiple myeloma and ovarian cancer, although it appears that at least in some of these cases the salivary form may be the more important form of amylase 11,12,13 . (aaltoscientific.com)
Proteins2
  • Wheat kernels accumulate a variety of low molecular weight proteins that inhibit amylases and/or proteases from different sources. (biomedcentral.com)
  • Specific amylase proteins are designated by different Greek letters. (wikipedia.org)
Gene9
  • Optimum pH - 7.0 Human body temperature[citation needed] Presence of certain anions and activators: Chloride and bromide - most effective Iodide - less effective Sulfate and phosphate - least effective The salivary amylase gene has undergone duplication during evolution, and DNA hybridization studies indicate many individuals have multiple tandem repeats of the gene. (wikipedia.org)
  • For example, a Japanese individual had 14 copies of the amylase gene (one allele with 10 copies, and a second allele with four copies). (wikipedia.org)
  • Perry and colleagues speculated the increased copy number of the salivary amylase gene may have enhanced survival coincident to a shift to a starchy diet during human evolution. (wikipedia.org)
  • Expressing an RNAi construct in maize kernels that targets the gene for alpha-amylase in Aspergillus flavus resulted in suppression of alpha-amylase ( amy1 ) gene expression and decreased fungal growth during in situ infection resulting in decreased aflatoxin production. (springer.com)
  • Here, we demonstrate that maize inbred B104 expressing an RNAi construct targeting the A. flavus alpha-amylase gene amy1 effectively reduces amy1 gene expression resulting in decreased fungal colonization and aflatoxin accumulation in kernels. (springer.com)
  • They have spliced the Vitreoscilla hemoglobin gene into another bacterial strain that has been genetically engineered to produce alpha-amylase , an enzyme used in the commercial production of high-fructose corn syrup. (thefreedictionary.com)
  • This gene encodes an amylase isoenzyme produced by the pancreatic gland. (acris-antibodies.com)
  • Metabolic regulation of α-amylase gene expression in transgenic cell cultures of rice (Oryza sativa L. (semanticscholar.org)
  • In December 2014, DSM NV filed for a patent on the development of alpha-amylase from newly identified polynucleotide sequence from gene-based alicyclobacillus pohliae. (abnewswire.com)
Aspergillus6
  • concentrated fungal alpha - amylase made from the strain of Aspergillus oryzal var through cultivation, submerged liquid fermentation and extraction. (spintoband.com)
  • An [alpha]-amylase from Aspergillus oryzae was the first microbial enzyme manufactured for sale (Gupta, Gupta, Modi, & Yadava, 2008). (thefreelibrary.com)
  • This assumption is supported by the observation of common epitopes in amylase and extracts of Aspergillus oryzae (13). (phadia.com)
  • Bread made from flour containing alpha-amylase from Aspergillus oryzae can trigger allergic reactions in sensitized subjects (16-17). (phadia.com)
  • However, it has been shown to retain some allergenic activity even at 200° C (14-15) and bread made from flour containing alpha -amylase from Aspergillus oryzae can trigger allergic reactions in sensitized subjects (16-17). (phadia.com)
  • High purity α-Amylase ( Aspergillus oryzae ) for use in research, biochemical enzyme assays and in vitro diagnostic analysis. (megazyme.com)
Activity38
  • In gastric juice adjusted to pH 3.3, ptyalin was totally inactivated in 20 minutes at 37 °C. In contrast, 50% of amylase activity remained after 150 minutes of exposure to gastric juice at pH 4.3. (wikipedia.org)
  • Salivary α-amylase has been used as a biomarker for stress and as a surrogate marker of sympathetic nervous system (SNS) activity that does not require a blood draw. (wikipedia.org)
  • Tea inhibited the activity of salivary amylase. (greenmedinfo.com)
  • Salivary Alpha-Amylase Activity, a New Biomarker in Heart Failure? (diva-portal.org)
  • Salivary α-amylase activity is an increasingly investigated biomarker for the activation of the autonomic nervous system. (diva-portal.org)
  • Autonomic imbalance is associated to several diseases, one of which is heart failure, and the aim of the present study was to test if salivary α-amylase activity might be a new biomarker in patients with chronic heart failure. (diva-portal.org)
  • Results: Within the whole group of participants, a statistically significant positive correlation between morning salivary α-amylase activity levels and serum NT-proBNP could be found, which was strongest for the measurement taken 30 minutes after awakening, as well as a significant negative correlation of awakening α-amylase activity levels with arterial blood pressure. (diva-portal.org)
  • Within the control group separately, higher daily salivary α-amylase activity output correlated with increasing levels of NT-proBNP, while within the patients, the strongest association of α-amylase activity measures were found to be a negative correlation with blood pressure. (diva-portal.org)
  • Alpha-amylase activity was determined by Bernfeld method [5]. (thefreedictionary.com)
  • Human salivary alpha-amylase Trp58 situated at subsite-2 is critical for enzyme activity. (thefreedictionary.com)
  • In case of α -amylase and α -glycosidase assays, IC 50 (inhibitory concentration 50) refers to necessary extract amounts to inhibit 50% of enzymatic activity. (hindawi.com)
  • and (3) capable of retaining at least about 50% of its initial alpha-amylase activity when held at 80° C. and at a pH of 4.5 for 10 minutes in the presence of 5 mM of calcium ion. (freepatentsonline.com)
  • 2.2 Toxicological studies 2.2.1 Acute toxicity studies 2.2.1.1 Rat Groups of 6 male and 6 female rats (Fischer 344) were dosed by gavage with the enzyme as an aqueous suspension at dose levels ranging from 0 to 12 g/kg b.w. (alpha-amylase activity 5130 U/g). (inchem.org)
  • And, because the secretion of alpha-amylase from the salivary glands is directly controlled by nervous signals, it appears that it can also serve as a valuable indicator of activity in the sympathetic nervous system. (salimetrics.com)
  • However in AMY1, as already shown for amylases of animal and bacterial origin, in addition to the active site, one secondary carbohydrate binding site (s1) was necessary for activity whereas two secondary sites (s1 and s2) were required for the AMY2 activity. (dtu.dk)
  • Pancreatic and tumour-derived alpha-amylases had similar Km and Ki (alpha-GHI) values, but the specific activity of the tumour alpha-amylase was approximately two-thirds that of the normal alpha-amylase . (curehunter.com)
  • The aim of this study was to determine in vitro inhibitory activity of α-glucosidase, α-amylase and Dipeptidyl peptidase IV from 42 ethanolic extract s of selected Indonesian plants. (scialert.net)
  • α-amylase activity was measured at λ = 540 nm, α-glucosidase activity and the DPP-IV activity were measured at λ = 405 nm. (scialert.net)
  • This study was conducted to find inhibitory activity of α-amylase, α-glucosidase and DPP-IV from Indonesian plants. (scialert.net)
  • Aleurones from a Barley with Low [alpha]-Amylase Activity Become Highly Responsive to Gibberellin When Detached from the Starchy Endosperm. (semanticscholar.org)
  • Measurement of α-amylase activity in white wheat flour, milled malt, and microbial enzyme preparations, using the ceralpha assay: Collaborative study. (megazyme.com)
  • This study was conducted to evaluate the method performance of a rapid procedure for the measurement of α-amylase activity in flours and microbial enzyme preparations. (megazyme.com)
  • In some instances, different procedures have been developed for the measurement of the same enzyme activity (e.g. α-amylase) in a range of different materials (e.g. malt, cereal grains and fungal preparations). (megazyme.com)
  • CATALYTIC ACTIVITY: Endohydrolysis of (1->4)-alpha-D-glucosidic linkages in polysaccharides containing three or more (1->4)-alpha-linked D-glucose units. (mybiosource.com)
  • Effects of Pulsed Electric Field (PEF) Treatment on Enhancing Activity and Conformation of alpha-Amylase. (emf-portal.org)
  • In summary, Phase 2 has the potential to induce weight loss and reduce spikes in blood sugar caused by carbohydrates through its alpha-amylase inhibiting activity. (biomedcentral.com)
  • The process is halted in the stomach due to the high acid environment destroying the amylase activity. (biomedcentral.com)
  • Maximum inhibitory activity, against alpha-amylase, occurs at 37° C and pH 5.5. (creative-enzymes.com)
  • Alpha amylase requires calcium for activity, although complete activity only occurs in the presence of certain anions such as Cl-, Phosphate and others 2 . (aaltoscientific.com)
  • Amylase: A Disease Activity Index in Multiple Myeloma? (aaltoscientific.com)
  • The present disclosure relates to isolated polypeptides having alpha-amylase activity, polynucleotides encoding the polypeptides, nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing the polypeptides, and method of using polypeptides, including in ethanol production processes. (patentsencyclopedia.com)
  • and (e) a fragment of the polypeptide of (a), (b) or (c) that has alpha-amylase activity. (patentsencyclopedia.com)
  • For detection and quantification of alpha amylase activity we use DNS method as mentioned below. (foodelphi.com)
  • Salivary α-amylase exhibits a diurnal rhythm, displaying a pronounced decrease within an hour of waking up, followed by a steady increase in its activity throughout the course of the day. (elisakits.co.uk)
  • The determination of salivary alpha-amylase levels has been helpful as biomarkers of ANS activity in various fields of bio-behavioural research. (elisakits.co.uk)
  • The invention relates to a variant of a parent Termamyl-like alpha-amylase, which variant exhibits altered properties, in particular reduced capability of cleaving a substrate close to the branching point, and improved substrate specificity and/or improved specific activity relative to the parent alpha-amylase. (patentsencyclopedia.com)
  • 8. A variant of claim 1, which further exhibits improved substrate specificity and/or improved specific activity relative to the parent Termamyl-like alpha-amylase. (patentsencyclopedia.com)
  • SuperLIQ™ X5 Alpha-amylase is a kind of thermostable α-amylase with high activity. (bestzyme.com)
Total amylase2
  • Increased plasma levels in humans are found in: Salivary trauma (including anaesthetic intubation) Mumps - due to inflammation of the salivary glands Pancreatitis - because of damage to the cells that produce amylase Kidney failure - due to reduced excretion Total amylase readings of over 10 times the upper limit of normal (ULN) are suggestive of pancreatitis. (wikipedia.org)
  • However total amylase is still a very valuable diagnostic tool. (aaltoscientific.com)
Isoenzymes3
  • Isoelectric focusing of both normal and tumour alpha-amylases resolved each into two major isoenzymes , with pI 8.3 and 8.7. (curehunter.com)
  • 4. Skude, G. and Skude, G. Clinical Chemistry: Electrophoretic Separation, Detection and Variation of Amylase Isoenzymes. (aaltoscientific.com)
  • The Isoenzymes of Parotid Amylase. (aaltoscientific.com)
Family 131
  • Alpha-amylase is classified as family 13 of the glycosyl hydrolases and is present in archaea, bacteria, plants and animals. (ebi.ac.uk)
Amino acids1
  • To examine whether alpha-amylase acts as an antigen in labial salivary glands, PBL from 11 patients with SS were incubated with 9 different synthetic amino acids of alpha-amylase or salivary alpha-amylase. (ingentaconnect.com)
Abstract1
  • abstract = "Amylases possess short, conserved regions near functional side chains. (dtu.dk)
Thermostable2
  • SuperLIQ® X5 is a liquid enzyme containing outstanding thermostable α-amylase. (bestzyme.com)
  • SuperLIQ® X5 is a kind of thermostable α-amylase and shows stable performance at wide pH range. (bestzyme.com)
Digestive2
  • An amylase that has been used clinically as a digestive aid. (thefreedictionary.com)
  • Animal tissues do not contain β-amylase, although it may be present in microorganisms contained within the digestive tract . (wikipedia.org)
Linkages5
  • Pancreatic α-amylase randomly cleaves the α(1-4) glycosidic linkages of amylose to yield dextrin, maltose, or maltotriose. (wikipedia.org)
  • Pancreatic alpha amylase cleaves the linkages of amylose. (wisegeek.com)
  • Endohydrolysis of (1->4)-alpha-D-glucosidic linkages in polysaccharides containing three or more (1->4)-alpha-linked D-glucose units. (uniprot.org)
  • 4)-alpha-D-glucosidic linkages in oligosaccharides and polysaccharides. (acris-antibodies.com)
  • It is suggested that amylases, alpha-glucosidases, and transglucanosylases acting on 1,4- and 1,6-alpha-glucosidic linkages share key structural features in the active centres. (dtu.dk)
Microbial3
  • α-Amylase can be produced by plant or microbial sources. (foodelphi.com)
  • Due to the advantages that microbial production offers, α-Amylase from microorganisms has been focused upon and preferred to other sources for production. (foodelphi.com)
  • This report focuses on the microbial production of α-Amylase and its applications. (foodelphi.com)
Biomarkers1
  • Salivary cortisol and α- amylase were selected as reliable noninvasive biomarkers for HPA axis and SNS function and were measured in the samples obtained. (nih.gov)
AMY2B1
  • AMY2B(alpha-amylase 2B) belongs to the glycosyl hydrolase 13 family. (ptglab.com)
Glucose3
  • Blocking alpha-amylase inhibits the breakdown of starches and slows the rate at which free sugars are absorbed, thereby blunting glucose spikes. (thefreedictionary.com)
  • By inhibiting α-amylase, α-glucosidase and DPP-IV, glucose levels can be controlled to maintain normal blood sugar level. (scialert.net)
  • When the substrate is cleaved by endo-acting α-amylase, the nitrophenyl oligosaccharide is immediately and completely hydrolyzed to p -nitrophenol and free glucose by the excess quantities of α-glucosidase present in the substrate mixture. (megazyme.com)
Maltose1
  • Derivatives of maltose and maltotriose were chemically synthesised as substrates for human pancreatic alpha-amylases and subjected to kinetic analysis. (ubc.ca)
Global Alpha-Amylase8
  • In this report, the global Alpha-Amylase (a-Amylase) market is valued at USD XX million in 2016 and is expected to reach USD XX million by the end of 2022, growing at a CAGR of XX% between 2016 and 2022. (qyresearchreports.com)
  • The research report studies the global Global alpha amylase a amylase sales market report 2017 market on the basis of several criteria, including type, application, and geography to provide a better understanding to the readers. (qyresearchreports.com)
  • The report also sheds light on the current trends related to the demand, supply, and sales of Global alpha amylase a amylase sales market report 2017, along with the recent developments in the field. (qyresearchreports.com)
  • The research report takes into consideration the drivers, restraints, trends, and opportunities of the global Global alpha amylase a amylase sales market report 2017 market in order to identify the future of the market. (qyresearchreports.com)
  • The report also provides an estimation of the overall market size in terms of both value and volume and offers qualitative and quantitative insights into the key segments and the geographical subdivisions of the Global alpha amylase a amylase sales market report 2017 market. (qyresearchreports.com)
  • According to the report, equipment and raw material are two primary components of the manufacturing process of Global alpha amylase a amylase sales market report 2017. (qyresearchreports.com)
  • Therefore, the report provides a 360-degree view of the global Global alpha amylase a amylase sales market report 2017 market. (qyresearchreports.com)
  • The report also performs a methodical examination of the vendor landscape of the global Global alpha amylase a amylase sales market report 2017 market by analyzing the company profiles of prominent companies operating in the market. (qyresearchreports.com)
Bacterial alpha-amylase1
Salivary alpha-Amylases3
  • Salivary alpha-Amylases" is a descriptor in the National Library of Medicine's controlled vocabulary thesaurus, MeSH (Medical Subject Headings) . (uchicago.edu)
  • This graph shows the total number of publications written about "Salivary alpha-Amylases" by people in this website by year, and whether "Salivary alpha-Amylases" was a major or minor topic of these publications. (uchicago.edu)
  • Below are the most recent publications written about "Salivary alpha-Amylases" by people in Profiles. (uchicago.edu)
Fungi3
  • Heat Resistant Amylase and Prostease from Thermophilic Fungi", Chem. (freepatentsonline.com)
  • Use of agro-industrial wastes as substrates for [alpha]-amylase production by endophytic fungi isolated from Piper hispidum Sw/Uso de residuos agroindustriais para a producao de [alpha]-amilase por fungos endofiticos isolados de Piper hispidum Sw. (thefreelibrary.com)
  • saccharogen amylase) is also synthesized by bacteria , fungi , and plants . (wikipedia.org)
ELISA1
  • Your search returned 4 amylase, alpha 1B (salivary) ELISA ELISA Kit across 2 suppliers. (biocompare.com)
Substrate6
  • Chloride ion and N298 also appear to stabilize a helical region of polypeptide chain from which projects the flexible substrate binding loop unique to chloride-dependent alpha-amylases. (ubc.ca)
  • Comparative analyses show that the chloride-independent a-amylases compensate for the absence of bound chloride by substituting a hydrophobic core, altering the manner in which substrate interactions are made and shifting the placement of N298. (ubc.ca)
  • Aliquots of diluted extract (containing α-amylase) were incubated with substrate mixture under defined conditions of pH, temperature, and time. (megazyme.com)
  • Because it can act anywhere on the substrate , α-amylase tends to be faster-acting than β-amylase. (wikipedia.org)
  • Since it has the ability to act anywhere on the substrate, α-amylase is found to be faster acting when compared to than β-amylase. (elisakits.co.uk)
  • 7. A variant of claim 1, wherein said variant has a reduced capability of cleaving an oligo-saccharide substrate close to the branching point as compared to the parent alpha-amylase. (patentsencyclopedia.com)
Psychosocial stress1
  • We discuss the role of salivary alpha-amylase as a promising candidate for a reliable, noninvasive marker of psychosocial stress. (nih.gov)
Inhibit3
  • ethanolic extract increase mRNA expression of PPAR γ , inhibit α -amylase and α -glucosidase, and increase lipid accumulation. (hindawi.com)
  • In our in-vitro studies we could demonstrate that different plants, mostly traditionally used in common diabetic therapy in Africa or Europe, are able to inhibit a -amylase, which is responsible for the breakdown of oligosaccharides into monosaccharides which are absorbed. (scielo.br)
  • Eight extracts inhibit both α-glucosidase and α-amylase better than acarbose as a positive control. (scialert.net)
Maltogenic1
  • Maltogenic alpha-amylase is capable of providing high shelf life for bread and cakes. (abnewswire.com)
Assays1
  • Purchase high purity Ceralpha: α-Amylase Reagent - 4 vials for the measurement of α-amylase for research, biochemical enzyme assays and in vitro diagnostic analysis. (megazyme.com)
Produce amylase2
  • Plants and some bacteria also produce amylase. (wikipedia.org)
  • Many microbes also produce amylase to degrade extracellular starches. (wikipedia.org)
Glucosidase3
  • on mRNA expression of PPAR γ on cell line 3T3-L1, its effect on alpha amylase and alpha glucosidase, lipid accumulation during adipogenesis, and cell viability on VERO cells were evaluated. (hindawi.com)
  • Tôi đang cần mua alpha-amylase và alpha-glucosidase, bạn nào bán hoặc biết địa chỉ giới thiệu giúp ( [email protected] ). (sinhhocvietnam.com)
  • One Unit of α-amylase is the amount of enzyme required to release one µmole of p -nitrophenol from blocked p -nitrophenyl-maltoheptaoside per minute (in the presence of excess α-glucosidase), pH 5.4 at 40 o C, and is termed a Ceralpha Unit. (megazyme.com)
Xylanase4
  • Verenium has granted DSM exclusive licenses to its alpha-amylase and xylanase enzyme products for use in the food and beverage markets. (thefreedictionary.com)
  • As part of the agreement Verenium has agreed to manufacture Purifine PLC, alpha-amylase and xylanase products for DSM. (thefreedictionary.com)
  • New developments in the measurement of α-amylase, endo -protease, β-glucanase and β-xylanase. (megazyme.com)
  • In this presentation, we will present information on our most up-to-date procedures for the measurement of α-amylase, endo -protease, β-glucanase and β-xylanase, with special reference to the use of particular assay formats in particular applications. (megazyme.com)
Human5
  • human salivary α-amylase. (sigmaaldrich.com)
  • One was a human alpha-amylase salivary precursor (AA54-407), suggesting that alpha-amylase might be a salivary gland-specific autoantigen. (ingentaconnect.com)
  • Study of the human salivary alpha-amylase on 2-chloro-4-nitrophenyl-[alpha]-maltotrioside in the presence of potassium thiocyanate. (thefreedictionary.com)
  • The mechanism of allosteric activation of alpha-amylase by chloride has been studied through structural and kinetic experiments focusing on the chloride-dependent N298S variant of human pancreatic alpha-amylase (HPA) and a chloride-independent TAKA-amylase. (ubc.ca)
  • In human physiology, both the salivary and pancreatic amylases are α-amylases. (wikipedia.org)
Bioenergy
Bioenergy (basf.com)
Uses Enzymes, Uses Enzymes Suppliers and Manufacturers at Alibaba.com
Uses Enzymes, Uses Enzymes Suppliers and Manufacturers at Alibaba.com (alibaba.com)
What is Alpha Amylase? (with pictures)
What is Alpha Amylase? (with pictures) (wisegeek.com)
Diabetics can benefit from dog-rose - NaturalNews.com
Diabetics can benefit from dog-rose - NaturalNews.com (naturalnews.com)
RCSB PDB - 7TAA: FAMILY 13 ALPHA AMYLASE IN COMPLEX WITH ACARBOSE
RCSB PDB - 7TAA: FAMILY 13 ALPHA AMYLASE IN COMPLEX WITH ACARBOSE (rcsb.org)
1e43.1 | SWISS-MODEL Template Library
1e43.1 | SWISS-MODEL Template Library (swissmodel.expasy.org)
Should I use Amylase? | Page 2 | HomeBrewTalk.com - Beer, Wine, Mead, & Cider Brewing Discussion Community.
Should I use Amylase? | Page 2 | HomeBrewTalk.com - Beer, Wine, Mead, & Cider Brewing Discussion Community. (homebrewtalk.com)
Inhibitory activities of three Malaysian edible seaweeds on lipase and α-amylase | SpringerLink
Inhibitory activities of three Malaysian edible seaweeds on lipase and α-amylase | SpringerLink (link.springer.com)
Anti-Pancreatic Amylase Alpha, Clone: 6D4, Novus Biologicals 0.1mL; Unlabeled:Life | Fisher Scientific
Anti-Pancreatic Amylase Alpha, Clone: 6D4, Novus Biologicals 0.1mL; Unlabeled:Life | Fisher Scientific (fishersci.com)
Amazing Grass Green Superfood Review (UPDATE: 2020) | 18 Things You Need to Know
Amazing Grass Green Superfood Review (UPDATE: 2020) | 18 Things You Need to Know (dietspotlight.com)
Novozymes releases new alpha-amylase effective at low pH : Biofuels Digest
Novozymes releases new alpha-amylase effective at low pH : Biofuels Digest (biofuelsdigest.com)
Anti-Pancreatic Amylase Alpha, Clone: RPA-B5, Novus Biologicals 0.1mg; | Fisher Scientific
Anti-Pancreatic Amylase Alpha, Clone: RPA-B5, Novus Biologicals 0.1mg; | Fisher Scientific (fishersci.com)
Computer graphics of enzyme amylase - Stock Image - A605/0029 - Science Photo Library
Computer graphics of enzyme amylase - Stock Image - A605/0029 - Science Photo Library (sciencephoto.com)
EWG's Guide to Healthy Cleaning | method Dishwasher Packs, Lemon Mint Cleaner Rating
EWG's Guide to Healthy Cleaning | method Dishwasher Packs, Lemon Mint Cleaner Rating (ewg.org)
Saliva in dentistry
Saliva in dentistry (slideshare.net)
EWG's Guide to Healthy Cleaning | Kirkland Signature Ultra Clean Premium Laundry Detergent, Fresh Scent Cleaner Rating
EWG's Guide to Healthy Cleaning | Kirkland Signature Ultra Clean Premium Laundry Detergent, Fresh Scent Cleaner Rating (ewg.org)
Biochemical, Nutritional and Toxicological Aspects of Alpha-Amylase Inhibitors from Plant Foods | SpringerLink
Biochemical, Nutritional and Toxicological Aspects of Alpha-Amylase Inhibitors from Plant Foods | SpringerLink (link.springer.com)
Amylase, α- - Regulatory management option analysis - ECHA
Amylase, α- - Regulatory management option analysis - ECHA (echa.europa.eu)
GRAS Notices
GRAS Notices (accessdata.fda.gov)
Amylase | Lab Tests Online
Amylase | Lab Tests Online (labtestsonline.org)
Coconut Husk/Fiber | GreenMedInfo | Substance | Natural Medicine
Coconut Husk/Fiber | GreenMedInfo | Substance | Natural Medicine (greenmedinfo.com)
Fluoranthene Biodegradation by Serratia sp. AC-11 Immobilized into Chitosan Beads | SpringerLink
Fluoranthene Biodegradation by Serratia sp. AC-11 Immobilized into Chitosan Beads | SpringerLink (link.springer.com)
Anaesthesia and Intensive Care A-Z | ElsevierAsia - English
Anaesthesia and Intensive Care A-Z | ElsevierAsia - English (slideshare.net)
BAY43-9006 (Sorafenib) Versus Interferon Alpha-2a in Patients With Unresectable and/or Metastatic Renal Cell Carcinoma -...
BAY43-9006 (Sorafenib) Versus Interferon Alpha-2a in Patients With Unresectable and/or Metastatic Renal Cell Carcinoma -... (clinicaltrials.gov)
Industrial Enzymes Production, Industrial Enzymes Production Suppliers and Manufacturers at Alibaba.com
Industrial Enzymes Production, Industrial Enzymes Production Suppliers and Manufacturers at Alibaba.com (alibaba.com)