AnatomyOrganismsDiseasesChemicals and DrugsAnalytical, Diagnostic and Therapeutic Techniques and EquipmentPhenomena and ProcessesDisciplines and OccupationsInformation ScienceHealth Care
Alkaline PhosphatasePhosphoprotein PhosphatasesAcid PhosphataseProtein Tyrosine PhosphatasesProtein Phosphatase 2Protein Phosphatase 1Phosphoric Monoester HydrolasesGlucose-6-PhosphataseIsoenzymesHypophosphatasiaBone and BonesOsteoblastsPhosphorylationPhosphatesOsteocalcinCalcification, PhysiologicDual-Specificity PhosphatasesProtein Tyrosine Phosphatase, Non-Receptor Type 11cdc25 PhosphatasesProtein Tyrosine Phosphatase, Non-Receptor Type 1PlacentaMolecular Sequence DataOkadaic AcidOsteogenesisProtein Tyrosine Phosphatase, Non-Receptor Type 6Amino Acid SequenceMyosin-Light-Chain PhosphataseKineticsTetramisoleProtein Tyrosine Phosphatases, Non-ReceptorPhosphorylase PhosphataseLiverHomoarginineHistocytochemistryReceptor-Like Protein Tyrosine Phosphatases, Class 2gamma-GlutamyltransferaseEthers, CyclicEscherichia coliCell LinePhosphatidate PhosphataseLevamisoleCell DifferentiationCells, CulturedIntestinesDual Specificity Phosphatase 1NitrophenolsBase SequencePhosphorusSignal TransductionEnzyme ActivationClinical Enzyme TestsSubstrate SpecificityNucleotidasesAspartate AminotransferasesElectrophoresis, Polyacrylamide GelElectrophoresis, Cellulose AcetateCalciumReceptor-Like Protein Tyrosine Phosphatases, Class 3Cell MembraneTartratesBone Morphogenetic Protein 2MutationReceptor-Like Protein Tyrosine Phosphatases, Class 4ZincOsteomalaciaMitogen-Activated Protein Kinase PhosphatasesOsteitis DeformansMolecular WeightVanadatesHydrogen-Ion ConcentrationBone DiseasesEnzyme InhibitorsParathyroid HormoneCore Binding Factor Alpha 1 SubunitCloning, MolecularOrganophosphorus CompoundsDual Specificity Phosphatase 6Protein Tyrosine Phosphatase, Non-Receptor Type 2Recombinant Fusion ProteinsCalcineurinEnzyme InductionOxazolesMagnesiumPhosphoric Diester HydrolasesProtein BindingBone Matrix4-NitrophenylphosphataseSH2 Domain-Containing Protein Tyrosine PhosphatasesRNA, MessengerTime FactorsMicrovilliCattleBiological MarkersBone RemodelingChoriocarcinomaCollagen Type ILiver Function TestsBilirubinAlanine TransaminaseRecombinant Proteins
Alkaline Phosphatase
An enzyme that catalyzes the conversion of an orthophosphoric monoester and water to an alcohol and orthophosphate. EC 3.1.3.1.
Phosphoprotein Phosphatases
A group of enzymes removing the SERINE- or THREONINE-bound phosphate groups from a wide range of phosphoproteins, including a number of enzymes which have been phosphorylated under the action of a kinase. (Enzyme Nomenclature, 1992)
Acid Phosphatase
An enzyme that catalyzes the conversion of an orthophosphoric monoester and water to an alcohol and orthophosphate. EC 3.1.3.2.
Protein Tyrosine Phosphatases
An enzyme group that specifically dephosphorylates phosphotyrosyl residues in selected proteins. Together with PROTEIN-TYROSINE KINASE, it regulates tyrosine phosphorylation and dephosphorylation in cellular signal transduction and may play a role in cell growth control and carcinogenesis.
Protein Phosphatase 2
A phosphoprotein phosphatase subtype that is comprised of a catalytic subunit and two different regulatory subunits. At least two genes encode isoforms of the protein phosphatase catalytic subunit, while several isoforms of regulatory subunits exist due to the presence of multiple genes and the alternative splicing of their mRNAs. Protein phosphatase 2 acts on a broad variety of cellular proteins and may play a role as a regulator of intracellular signaling processes.
Protein Phosphatase 1
A eukayrotic protein serine-threonine phosphatase subtype that dephosphorylates a wide variety of cellular proteins. The enzyme is comprised of a catalytic subunit and regulatory subunit. Several isoforms of the protein phosphatase catalytic subunit exist due to the presence of multiple genes and the alternative splicing of their mRNAs. A large number of proteins have been shown to act as regulatory subunits for this enzyme. Many of the regulatory subunits have additional cellular functions.
Phosphoric Monoester Hydrolases
A group of hydrolases which catalyze the hydrolysis of monophosphoric esters with the production of one mole of orthophosphate. EC 3.1.3.
Glucose-6-Phosphatase
An enzyme that catalyzes the conversion of D-glucose 6-phosphate and water to D-glucose and orthophosphate. EC 3.1.3.9.
Isoenzymes
Structurally related forms of an enzyme. Each isoenzyme has the same mechanism and classification, but differs in its chemical, physical, or immunological characteristics.
Hypophosphatasia
A genetic metabolic disorder resulting from serum and bone alkaline phosphatase deficiency leading to hypercalcemia, ethanolamine phosphatemia, and ethanolamine phosphaturia. Clinical manifestations include severe skeletal defects resembling vitamin D-resistant rickets, failure of the calvarium to calcify, dyspnea, cyanosis, vomiting, constipation, renal calcinosis, failure to thrive, disorders of movement, beading of the costochondral junction, and rachitic bone changes. (From Dorland, 27th ed)
Bone and Bones
A specialized CONNECTIVE TISSUE that is the main constituent of the SKELETON. The principle cellular component of bone is comprised of OSTEOBLASTS; OSTEOCYTES; and OSTEOCLASTS, while FIBRILLAR COLLAGENS and hydroxyapatite crystals form the BONE MATRIX.
Osteoblasts
Bone-forming cells which secrete an EXTRACELLULAR MATRIX. HYDROXYAPATITE crystals are then deposited into the matrix to form bone.
Phosphorylation
The introduction of a phosphoryl group into a compound through the formation of an ester bond between the compound and a phosphorus moiety.
Phosphates
Inorganic salts of phosphoric acid.
Osteocalcin
Vitamin K-dependent calcium-binding protein synthesized by OSTEOBLASTS and found primarily in BONES. Serum osteocalcin measurements provide a noninvasive specific marker of bone metabolism. The protein contains three residues of the amino acid gamma-carboxyglutamic acid (Gla), which, in the presence of CALCIUM, promotes binding to HYDROXYAPATITE and subsequent accumulation in BONE MATRIX.
Calcification, Physiologic
Process by which organic tissue becomes hardened by the physiologic deposit of calcium salts.
Dual-Specificity Phosphatases
A sub-class of protein tyrosine phosphatases that contain an additional phosphatase activity which cleaves phosphate ester bonds on SERINE or THREONINE residues that are located on the same protein.
Protein Tyrosine Phosphatase, Non-Receptor Type 11
A subtype of non-receptor protein tyrosine phosphatases that contain two SRC HOMOLOGY DOMAINS. Mutations in the gene for protein tyrosine phosphatase, non-receptor type 11 are associated with NOONAN SYNDROME.
cdc25 Phosphatases
A subclass of dual specificity phosphatases that play a role in the progression of the CELL CYCLE. They dephosphorylate and activate CYCLIN-DEPENDENT KINASES.
Protein Tyrosine Phosphatase, Non-Receptor Type 1
A subtype of non-receptor protein tyrosine phosphatases that includes two distinctive targeting motifs; an N-terminal motif specific for the INSULIN RECEPTOR, and a C-terminal motif specific for the SH3 domain containing proteins. This subtype includes a hydrophobic domain which localizes it to the ENDOPLASMIC RETICULUM.
Placenta
A highly vascularized mammalian fetal-maternal organ and major site of transport of oxygen, nutrients, and fetal waste products. It includes a fetal portion (CHORIONIC VILLI) derived from TROPHOBLASTS and a maternal portion (DECIDUA) derived from the uterine ENDOMETRIUM. The placenta produces an array of steroid, protein and peptide hormones (PLACENTAL HORMONES).
Molecular Sequence Data
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
Okadaic Acid
A specific inhibitor of phosphoserine/threonine protein phosphatase 1 and 2a. It is also a potent tumor promoter. (Thromb Res 1992;67(4):345-54 & Cancer Res 1993;53(2):239-41)
Osteogenesis
The process of bone formation. Histogenesis of bone including ossification.
Protein Tyrosine Phosphatase, Non-Receptor Type 6
A Src-homology domain-containing protein tyrosine phosphatase found in the CYTOSOL of hematopoietic cells. It plays a role in signal transduction by dephosphorylating signaling proteins that are activated or inactivated by PROTEIN-TYROSINE KINASES.
Amino Acid Sequence
The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.
Myosin-Light-Chain Phosphatase
A phosphoprotein phosphatase that is specific for MYOSIN LIGHT CHAINS. It is composed of three subunits, which include a catalytic subunit, a myosin binding subunit, and a third subunit of unknown function.
Kinetics
The rate dynamics in chemical or physical systems.
Tetramisole
Protein Tyrosine Phosphatases, Non-Receptor
A subcategory of protein tyrosine phosphatases that occur in the CYTOPLASM. Many of the proteins in this category play a role in intracellular signal transduction.
Phosphorylase Phosphatase
An enzyme that deactivates glycogen phosphorylase a by releasing inorganic phosphate and phosphorylase b, the inactive form. EC 3.1.3.17.
Liver
A large lobed glandular organ in the abdomen of vertebrates that is responsible for detoxification, metabolism, synthesis and storage of various substances.
Homoarginine
Histocytochemistry
Study of intracellular distribution of chemicals, reaction sites, enzymes, etc., by means of staining reactions, radioactive isotope uptake, selective metal distribution in electron microscopy, or other methods.
Receptor-Like Protein Tyrosine Phosphatases, Class 2
A subclass of receptor-like protein tryosine phosphatases that contain multiple extracellular immunoglobulin G-like domains and fibronectin type III-like domains. An additional memprin-A5-mu domain is found on some members of this subclass.
gamma-Glutamyltransferase
An enzyme, sometimes called GGT, with a key role in the synthesis and degradation of GLUTATHIONE; (GSH, a tripeptide that protects cells from many toxins). It catalyzes the transfer of the gamma-glutamyl moiety to an acceptor amino acid.
Ethers, Cyclic
Compounds of the general formula R-O-R arranged in a ring or crown formation.
Escherichia coli
A species of gram-negative, facultatively anaerobic, rod-shaped bacteria (GRAM-NEGATIVE FACULTATIVELY ANAEROBIC RODS) commonly found in the lower part of the intestine of warm-blooded animals. It is usually nonpathogenic, but some strains are known to produce DIARRHEA and pyogenic infections. Pathogenic strains (virotypes) are classified by their specific pathogenic mechanisms such as toxins (ENTEROTOXIGENIC ESCHERICHIA COLI), etc.
Cell Line
Established cell cultures that have the potential to propagate indefinitely.
Phosphatidate Phosphatase
A phosphomonoesterase involved in the synthesis of triacylglycerols. It catalyzes the hydrolysis of phosphatidates with the formation of diacylglycerols and orthophosphate. EC 3.1.3.4.
Levamisole
An antihelminthic drug that has been tried experimentally in rheumatic disorders where it apparently restores the immune response by increasing macrophage chemotaxis and T-lymphocyte function. Paradoxically, this immune enhancement appears to be beneficial in rheumatoid arthritis where dermatitis, leukopenia, and thrombocytopenia, and nausea and vomiting have been reported as side effects. (From Smith and Reynard, Textbook of Pharmacology, 1991, p435-6)
Cell Differentiation
Progressive restriction of the developmental potential and increasing specialization of function that leads to the formation of specialized cells, tissues, and organs.
Cells, Cultured
Cells propagated in vitro in special media conducive to their growth. Cultured cells are used to study developmental, morphologic, metabolic, physiologic, and genetic processes, among others.
Intestines
The section of the alimentary canal from the STOMACH to the ANAL CANAL. It includes the LARGE INTESTINE and SMALL INTESTINE.
Dual Specificity Phosphatase 1
A dual specificity phosphatase subtype that plays a role in intracellular signal transduction by inactivating MITOGEN-ACTIVATED PROTEIN KINASES. It has specificity for P38 MITOGEN-ACTIVATED PROTEIN KINASES and JNK MITOGEN-ACTIVATED PROTEIN KINASES.
Nitrophenols
Base Sequence
The sequence of PURINES and PYRIMIDINES in nucleic acids and polynucleotides. It is also called nucleotide sequence.
Phosphorus
A non-metal element that has the atomic symbol P, atomic number 15, and atomic weight 31. It is an essential element that takes part in a broad variety of biochemical reactions.
Signal Transduction
The intracellular transfer of information (biological activation/inhibition) through a signal pathway. In each signal transduction system, an activation/inhibition signal from a biologically active molecule (hormone, neurotransmitter) is mediated via the coupling of a receptor/enzyme to a second messenger system or to an ion channel. Signal transduction plays an important role in activating cellular functions, cell differentiation, and cell proliferation. Examples of signal transduction systems are the GAMMA-AMINOBUTYRIC ACID-postsynaptic receptor-calcium ion channel system, the receptor-mediated T-cell activation pathway, and the receptor-mediated activation of phospholipases. Those coupled to membrane depolarization or intracellular release of calcium include the receptor-mediated activation of cytotoxic functions in granulocytes and the synaptic potentiation of protein kinase activation. Some signal transduction pathways may be part of larger signal transduction pathways; for example, protein kinase activation is part of the platelet activation signal pathway.
Enzyme Activation
Conversion of an inactive form of an enzyme to one possessing metabolic activity. It includes 1, activation by ions (activators); 2, activation by cofactors (coenzymes); and 3, conversion of an enzyme precursor (proenzyme or zymogen) to an active enzyme.
Clinical Enzyme Tests
Analyses for a specific enzyme activity, or of the level of a specific enzyme that is used to assess health and disease risk, for early detection of disease or disease prediction, diagnosis, and change in disease status.
Substrate Specificity
A characteristic feature of enzyme activity in relation to the kind of substrate on which the enzyme or catalytic molecule reacts.
Nucleotidases
A class of enzymes that catalyze the conversion of a nucleotide and water to a nucleoside and orthophosphate. EC 3.1.3.-.
Aspartate Aminotransferases
Enzymes of the transferase class that catalyze the conversion of L-aspartate and 2-ketoglutarate to oxaloacetate and L-glutamate. EC 2.6.1.1.
Electrophoresis, Polyacrylamide Gel
Electrophoresis in which a polyacrylamide gel is used as the diffusion medium.
Electrophoresis, Cellulose Acetate
Electrophoresis in which cellulose acetate is the diffusion medium.
Calcium
A basic element found in nearly all organized tissues. It is a member of the alkaline earth family of metals with the atomic symbol Ca, atomic number 20, and atomic weight 40. Calcium is the most abundant mineral in the body and combines with phosphorus to form calcium phosphate in the bones and teeth. It is essential for the normal functioning of nerves and muscles and plays a role in blood coagulation (as factor IV) and in many enzymatic processes.
Receptor-Like Protein Tyrosine Phosphatases, Class 3
A subclass of receptor-like protein tryosine phosphatases that contain a single cytosolic protein tyrosine phosphate domain and multiple extracellular fibronectin III-like domains.
Cell Membrane
The lipid- and protein-containing, selectively permeable membrane that surrounds the cytoplasm in prokaryotic and eukaryotic cells.
Tartrates
Bone Morphogenetic Protein 2
A potent osteoinductive protein that plays a critical role in the differentiation of osteoprogenitor cells into OSTEOBLASTS.
Mutation
Any detectable and heritable change in the genetic material that causes a change in the GENOTYPE and which is transmitted to daughter cells and to succeeding generations.
Receptor-Like Protein Tyrosine Phosphatases, Class 4
A subclass of receptor-like protein tryosine phosphatases that contain short highly glycosylated extracellular domains and two active cytosolic protein tyrosine phosphatase domains.
Zinc
A metallic element of atomic number 30 and atomic weight 65.38. It is a necessary trace element in the diet, forming an essential part of many enzymes, and playing an important role in protein synthesis and in cell division. Zinc deficiency is associated with ANEMIA, short stature, HYPOGONADISM, impaired WOUND HEALING, and geophagia. It is known by the symbol Zn.
Osteomalacia
Disorder caused by an interruption of the mineralization of organic bone matrix leading to bone softening, bone pain, and weakness. It is the adult form of rickets resulting from disruption of VITAMIN D; PHOSPHORUS; or CALCIUM homeostasis.
Mitogen-Activated Protein Kinase Phosphatases
A subcategory of phosphohydrolases that are specific for MITOGEN-ACTIVATED PROTEIN KINASES. They play a role in the inactivation of the MAP KINASE SIGNALING SYSTEM.
Osteitis Deformans
A disease marked by repeated episodes of increased bone resorption followed by excessive attempts at repair, resulting in weakened, deformed bones of increased mass. The resultant architecture of the bone assumes a mosaic pattern in which the fibers take on a haphazard pattern instead of the normal parallel symmetry.
Molecular Weight
The sum of the weight of all the atoms in a molecule.
Vanadates
Oxyvanadium ions in various states of oxidation. They act primarily as ion transport inhibitors due to their inhibition of Na(+)-, K(+)-, and Ca(+)-ATPase transport systems. They also have insulin-like action, positive inotropic action on cardiac ventricular muscle, and other metabolic effects.
Hydrogen-Ion Concentration
The normality of a solution with respect to HYDROGEN ions; H+. It is related to acidity measurements in most cases by pH = log 1/2[1/(H+)], where (H+) is the hydrogen ion concentration in gram equivalents per liter of solution. (McGraw-Hill Dictionary of Scientific and Technical Terms, 6th ed)
Bone Diseases
Diseases of BONES.
Enzyme Inhibitors
Compounds or agents that combine with an enzyme in such a manner as to prevent the normal substrate-enzyme combination and the catalytic reaction.
Parathyroid Hormone
A polypeptide hormone (84 amino acid residues) secreted by the PARATHYROID GLANDS which performs the essential role of maintaining intracellular CALCIUM levels in the body. Parathyroid hormone increases intracellular calcium by promoting the release of CALCIUM from BONE, increases the intestinal absorption of calcium, increases the renal tubular reabsorption of calcium, and increases the renal excretion of phosphates.
Core Binding Factor Alpha 1 Subunit
A transcription factor that dimerizes with CORE BINDING FACTOR BETA SUBUNIT to form core binding factor. It contains a highly conserved DNA-binding domain known as the runt domain and is involved in genetic regulation of skeletal development and CELL DIFFERENTIATION.
Cloning, Molecular
The insertion of recombinant DNA molecules from prokaryotic and/or eukaryotic sources into a replicating vehicle, such as a plasmid or virus vector, and the introduction of the resultant hybrid molecules into recipient cells without altering the viability of those cells.
Organophosphorus Compounds
Organic compounds that contain phosphorus as an integral part of the molecule. Included under this heading is broad array of synthetic compounds that are used as PESTICIDES and DRUGS.
Dual Specificity Phosphatase 6
A dual specificity phosphatase subtype that plays a role in intracellular signal transduction by inactivating MITOGEN-ACTIVATED PROTEIN KINASES. It has specificity for EXTRACELLULAR SIGNAL-REGULATED MAP KINASES and is primarily localized to the CYTOSOL.
Protein Tyrosine Phosphatase, Non-Receptor Type 2
A subtype of non-receptor protein tyrosine phosphatase that is closely-related to PROTEIN TYROSINE PHOSPHATASE, NON-RECEPTOR TYPE 1. Alternative splicing of the mRNA for this phosphatase results in the production at two gene products, one of which includes a C-terminal nuclear localization domain that may be involved in the transport of the protein to the CELL NUCLEUS. Although initially referred to as T-cell protein tyrosine phosphatase the expression of this subtype occurs widely.
Recombinant Fusion Proteins
Recombinant proteins produced by the GENETIC TRANSLATION of fused genes formed by the combination of NUCLEIC ACID REGULATORY SEQUENCES of one or more genes with the protein coding sequences of one or more genes.
Calcineurin
A CALCIUM and CALMODULIN-dependent serine/threonine protein phosphatase that is composed of the calcineurin A catalytic subunit and the calcineurin B regulatory subunit. Calcineurin has been shown to dephosphorylate a number of phosphoproteins including HISTONES; MYOSIN LIGHT CHAIN; and the regulatory subunits of CAMP-DEPENDENT PROTEIN KINASES. It is involved in the regulation of signal transduction and is the target of an important class of immunophilin-immunosuppressive drug complexes.
Enzyme Induction
An increase in the rate of synthesis of an enzyme due to the presence of an inducer which acts to derepress the gene responsible for enzyme synthesis.
Oxazoles
Five-membered heterocyclic ring structures containing an oxygen in the 1-position and a nitrogen in the 3-position, in distinction from ISOXAZOLES where they are at the 1,2 positions.
Magnesium
A metallic element that has the atomic symbol Mg, atomic number 12, and atomic weight 24.31. It is important for the activity of many enzymes, especially those involved in OXIDATIVE PHOSPHORYLATION.
Phosphoric Diester Hydrolases
A class of enzymes that catalyze the hydrolysis of one of the two ester bonds in a phosphodiester compound. EC 3.1.4.
Protein Binding
The process in which substances, either endogenous or exogenous, bind to proteins, peptides, enzymes, protein precursors, or allied compounds. Specific protein-binding measures are often used as assays in diagnostic assessments.
Bone Matrix
Extracellular substance of bone tissue consisting of COLLAGEN fibers, ground substance, and inorganic crystalline minerals and salts.
4-Nitrophenylphosphatase
An enzyme that catalyzes the hydrolysis of nitrophenyl phosphates to nitrophenols. At acid pH it is probably ACID PHOSPHATASE (EC 3.1.3.2); at alkaline pH it is probably ALKALINE PHOSPHATASE (EC 3.1.3.1). EC 3.1.3.41.
SH2 Domain-Containing Protein Tyrosine Phosphatases
A subcategory of protein tyrosine phosphatases that contain SH2 type SRC HOMOLOGY DOMAINS. Many of the proteins in this class are recruited to specific cellular targets such as a cell surface receptor complexes via their SH2 domain.
RNA, Messenger
RNA sequences that serve as templates for protein synthesis. Bacterial mRNAs are generally primary transcripts in that they do not require post-transcriptional processing. Eukaryotic mRNA is synthesized in the nucleus and must be exported to the cytoplasm for translation. Most eukaryotic mRNAs have a sequence of polyadenylic acid at the 3' end, referred to as the poly(A) tail. The function of this tail is not known for certain, but it may play a role in the export of mature mRNA from the nucleus as well as in helping stabilize some mRNA molecules by retarding their degradation in the cytoplasm.
Time Factors
Elements of limited time intervals, contributing to particular results or situations.
Microvilli
Minute projections of cell membranes which greatly increase the surface area of the cell.
Cattle
Domesticated bovine animals of the genus Bos, usually kept on a farm or ranch and used for the production of meat or dairy products or for heavy labor.
Biological Markers
Measurable and quantifiable biological parameters (e.g., specific enzyme concentration, specific hormone concentration, specific gene phenotype distribution in a population, presence of biological substances) which serve as indices for health- and physiology-related assessments, such as disease risk, psychiatric disorders, environmental exposure and its effects, disease diagnosis, metabolic processes, substance abuse, pregnancy, cell line development, epidemiologic studies, etc.
Bone Remodeling
The continuous turnover of BONE MATRIX and mineral that involves first an increase in BONE RESORPTION (osteoclastic activity) and later, reactive BONE FORMATION (osteoblastic activity). The process of bone remodeling takes place in the adult skeleton at discrete foci. The process ensures the mechanical integrity of the skeleton throughout life and plays an important role in calcium HOMEOSTASIS. An imbalance in the regulation of bone remodeling's two contrasting events, bone resorption and bone formation, results in many of the metabolic bone diseases, such as OSTEOPOROSIS.
Choriocarcinoma
A malignant metastatic form of trophoblastic tumors. Unlike the HYDATIDIFORM MOLE, choriocarcinoma contains no CHORIONIC VILLI but rather sheets of undifferentiated cytotrophoblasts and syncytiotrophoblasts (TROPHOBLASTS). It is characterized by the large amounts of CHORIONIC GONADOTROPIN produced. Tissue origins can be determined by DNA analyses: placental (fetal) origin or non-placental origin (CHORIOCARCINOMA, NON-GESTATIONAL).
Collagen Type I
The most common form of fibrillar collagen. It is a major constituent of bone (BONE AND BONES) and SKIN and consists of a heterotrimer of two alpha1(I) and one alpha2(I) chains.
Liver Function Tests
Blood tests that are used to evaluate how well a patient's liver is working and also to help diagnose liver conditions.
Bilirubin
A bile pigment that is a degradation product of HEME.
Alanine Transaminase
An enzyme that catalyzes the conversion of L-alanine and 2-oxoglutarate to pyruvate and L-glutamate. (From Enzyme Nomenclature, 1992) EC 2.6.1.2.
Recombinant Proteins
Proteins prepared by recombinant DNA technology.
Binding Sites
The parts of a macromolecule that directly participate in its specific combination with another molecule.
Liver Diseases
Pathological processes of the LIVER.
Sucrase
PTEN Phosphohydrolase
A lipid phosphatase that acts on phosphatidylinositol-3,4,5-trisphosphate to regulate various SIGNAL TRANSDUCTION PATHWAYS. It modulates CELL GROWTH PROCESSES; CELL MIGRATION; and APOPTOSIS. Mutations in PTEN are associated with COWDEN DISEASE and PROTEUS SYNDROME as well as NEOPLASTIC CELL TRANSFORMATION.
GPI-Linked Proteins
A subclass of lipid-linked proteins that contain a GLYCOSYLPHOSPHATIDYLINOSITOL LINKAGE which holds them to the CELL MEMBRANE.
Bacterial Proteins
Proteins found in any species of bacterium.
Protein Kinases
A family of enzymes that catalyze the conversion of ATP and a protein to ADP and a phosphoprotein.
Glycerophosphates
Any salt or ester of glycerophosphoric acid.
Glycogen-Synthase-D Phosphatase
An enzyme that catalyzes the conversion of phosphorylated, inactive glycogen synthase D to active dephosphoglycogen synthase I. EC 3.1.3.42.
Membrane Proteins
Proteins which are found in membranes including cellular and intracellular membranes. They consist of two types, peripheral and integral proteins. They include most membrane-associated enzymes, antigenic proteins, transport proteins, and drug, hormone, and lectin receptors.
Rickets
Disorders caused by interruption of BONE MINERALIZATION manifesting as OSTEOMALACIA in adults and characteristic deformities in infancy and childhood due to disturbances in normal BONE FORMATION. The mineralization process may be interrupted by disruption of VITAMIN D; PHOSPHORUS; or CALCIUM homeostasis, resulting from dietary deficiencies, or acquired, or inherited metabolic, or hormonal disturbances.
Bone Resorption
Bone loss due to osteoclastic activity.
Gene Expression Regulation, Enzymologic
Any of the processes by which nuclear, cytoplasmic, or intercellular factors influence the differential control of gene action in enzyme synthesis.
Pyrophosphatases
A group of enzymes within the class EC 3.6.1.- that catalyze the hydrolysis of diphosphate bonds, chiefly in nucleoside di- and triphosphates. They may liberate either a mono- or diphosphate. EC 3.6.1.-.
Hot Temperature
Presence of warmth or heat or a temperature notably higher than an accustomed norm.
Bone Density
The amount of mineral per square centimeter of BONE. This is the definition used in clinical practice. Actual bone density would be expressed in grams per milliliter. It is most frequently measured by X-RAY ABSORPTIOMETRY or TOMOGRAPHY, X RAY COMPUTED. Bone density is an important predictor for OSTEOPOROSIS.
Diphosphates
Inorganic salts of phosphoric acid that contain two phosphate groups.
Microcystins
Cyclic heptapeptides found in MICROCYSTIS and other CYANOBACTERIA. Hepatotoxic and carcinogenic effects have been noted. They are sometimes called cyanotoxins, which should not be confused with chemicals containing a cyano group (CN) which are toxic.
Phosphoproteins
Electrophoresis
An electrochemical process in which macromolecules or colloidal particles with a net electric charge migrate in a solution under the influence of an electric current.
Osteopontin
A negatively-charged extracellular matrix protein that plays a role in the regulation of BONE metabolism and a variety of other biological functions. Cell signaling by osteopontin may occur through a cell adhesion sequence that recognizes INTEGRIN ALPHA-V BETA-3.
Sequence Homology, Amino Acid
The degree of similarity between sequences of amino acids. This information is useful for the analyzing genetic relatedness of proteins and species.
Receptor-Like Protein Tyrosine Phosphatases, Class 5
A subclass of receptor-like protein tryosine phosphatases that contain an extracellular fibronectin III-like domain along with a carbonic anhydrase-like domain.
Intracellular Signaling Peptides and Proteins
Proteins and peptides that are involved in SIGNAL TRANSDUCTION within the cell. Included here are peptides and proteins that regulate the activity of TRANSCRIPTION FACTORS and cellular processes in response to signals from CELL SURFACE RECEPTORS. Intracellular signaling peptide and proteins may be part of an enzymatic signaling cascade or act through binding to and modifying the action of other signaling factors.
Rabbits
The species Oryctolagus cuniculus, in the family Leporidae, order LAGOMORPHA. Rabbits are born in burrows, furless, and with eyes and ears closed. In contrast with HARES, rabbits have 22 chromosome pairs.
Leucyl Aminopeptidase
A zinc containing enzyme of the hydrolase class that catalyzes the removal of the N-terminal amino acid from most L-peptides, particularly those with N-terminal leucine residues but not those with N-terminal lysine or arginine residues. This occurs in tissue cell cytosol, with high activity in the duodenum, liver, and kidney. The activity of this enzyme is commonly assayed using a leucine arylamide chromogenic substrate such as leucyl beta-naphthylamide.
Pyruvate Dehydrogenase (Lipoamide)-Phosphatase
(Pyruvate dehydrogenase (lipoamide))-phosphate phosphohydrolase. A mitochondrial enzyme that catalyzes the hydrolytic removal of a phosphate on a specific seryl hydroxyl group of pyruvate dehydrogenase, reactivating the enzyme complex. EC 3.1.3.43.
Catalytic Domain
The region of an enzyme that interacts with its substrate to cause the enzymatic reaction.
Cantharidin
A toxic compound, isolated from the Spanish fly or blistering beetle (Lytta (Cantharis) vesicatoria) and other insects. It is a potent and specific inhibitor of protein phosphatases 1 (PP1) and 2A (PP2A). This compound can produce severe skin inflammation, and is extremely toxic if ingested orally.
Protein Tyrosine Phosphatase, Non-Receptor Type 12
A subtype of non-receptor protein tyrosine phosphatases that is characterized by the presence of a N-terminal catalytic domain and a large C-terminal domain that is enriched in PROLINE, GLUTAMIC ACID, SERINE, and THREONINE residues (PEST sequences). The phosphatase subtype is ubiquitously expressed and implicated in the regulation of a variety of biological processes such as CELL MOVEMENT; CYTOKINESIS; focal adhesion disassembly; and LYMPHOCYTE ACTIVATION.
Pregnancy
The status during which female mammals carry their developing young (EMBRYOS or FETUSES) in utero before birth, beginning from FERTILIZATION to BIRTH.
Intestine, Small
The portion of the GASTROINTESTINAL TRACT between the PYLORUS of the STOMACH and the ILEOCECAL VALVE of the LARGE INTESTINE. It is divisible into three portions: the DUODENUM, the JEJUNUM, and the ILEUM.
Dual Specificity Phosphatase 3
A dual specificity phosphatase subtype that plays a role in intracellular signal transduction by inactivating MITOGEN-ACTIVATED PROTEIN KINASES. It has specificity for EXTRACELLULAR SIGNAL-REGULATED MAP KINASES.
Enzyme Repression
The interference in synthesis of an enzyme due to the elevated level of an effector substance, usually a metabolite, whose presence would cause depression of the gene responsible for enzyme synthesis.
Subcellular Fractions
Components of a cell produced by various separation techniques which, though they disrupt the delicate anatomy of a cell, preserve the structure and physiology of its functioning constituents for biochemical and ultrastructural analysis. (From Alberts et al., Molecular Biology of the Cell, 2d ed, p163)
Proteins
Linear POLYPEPTIDES that are synthesized on RIBOSOMES and may be further modified, crosslinked, cleaved, or assembled into complex proteins with several subunits. The specific sequence of AMINO ACIDS determines the shape the polypeptide will take, during PROTEIN FOLDING, and the function of the protein.
Kidney
Body organ that filters blood for the secretion of URINE and that regulates ion concentrations.
Cholestasis
Impairment of bile flow due to obstruction in small bile ducts (INTRAHEPATIC CHOLESTASIS) or obstruction in large bile ducts (EXTRAHEPATIC CHOLESTASIS).
Transfection
The uptake of naked or purified DNA by CELLS, usually meaning the process as it occurs in eukaryotic cells. It is analogous to bacterial transformation (TRANSFORMATION, BACTERIAL) and both are routinely employed in GENE TRANSFER TECHNIQUES.
Dysgerminoma
A malignant ovarian neoplasm, thought to be derived from primordial germ cells of the sexually undifferentiated embryonic gonad. It is the counterpart of the classical seminoma of the testis, to which it is both grossly and histologically identical. Dysgerminomas comprise 16% of all germ cell tumors but are rare before the age of 10, although nearly 50% occur before the age of 20. They are generally considered of low-grade malignancy but may spread if the tumor extends through its capsule and involves lymph nodes or blood vessels. (Dorland, 27th ed; DeVita Jr et al., Cancer: Principles & Practice of Oncology, 3d ed, p1646)
Blotting, Western
Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
Wheat Germ Agglutinins
Lectins purified from the germinating seeds of common wheat (Triticum vulgare); these bind to certain carbohydrate moieties on cell surface glycoproteins and are used to identify certain cell populations and inhibit or promote some immunological or physiological activities. There are at least two isoforms of this lectin.
Minerals
Native, inorganic or fossilized organic substances having a definite chemical composition and formed by inorganic reactions. They may occur as individual crystals or may be disseminated in some other mineral or rock. (Grant & Hackh's Chemical Dictionary, 5th ed; McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
Osteosarcoma
A sarcoma originating in bone-forming cells, affecting the ends of long bones. It is the most common and most malignant of sarcomas of the bones, and occurs chiefly among 10- to 25-year-old youths. (From Stedman, 25th ed)
Tyrosine
A non-essential amino acid. In animals it is synthesized from PHENYLALANINE. It is also the precursor of EPINEPHRINE; THYROID HORMONES; and melanin.
Receptor-Like Protein Tyrosine Phosphatases
A subcategory of protein tyrosine phosphatases that are bound to the cell membrane. They contain cytoplasmic tyrosine phosphatase domains and extracellular protein domains that may play a role in cell-cell interactions by interacting with EXTRACELLULAR MATRIX components. They are considered receptor-like proteins in that they appear to lack specific ligands.
Chromatography, Gel
Chromatography on non-ionic gels without regard to the mechanism of solute discrimination.
Dose-Response Relationship, Drug
The relationship between the dose of an administered drug and the response of the organism to the drug.
Gene Expression
The phenotypic manifestation of a gene or genes by the processes of GENETIC TRANSCRIPTION and GENETIC TRANSLATION.
Protein Structure, Tertiary
The level of protein structure in which combinations of secondary protein structures (alpha helices, beta sheets, loop regions, and motifs) pack together to form folded shapes called domains. Disulfide bridges between cysteines in two different parts of the polypeptide chain along with other interactions between the chains play a role in the formation and stabilization of tertiary structure. Small proteins usually consist of only one domain but larger proteins may contain a number of domains connected by segments of polypeptide chain which lack regular secondary structure.
Renal Osteodystrophy
Decalcification of bone or abnormal bone development due to chronic KIDNEY DISEASES, in which 1,25-DIHYDROXYVITAMIN D3 synthesis by the kidneys is impaired, leading to reduced negative feedback on PARATHYROID HORMONE. The resulting SECONDARY HYPERPARATHYROIDISM eventually leads to bone disorders.
Butyric Acid
A four carbon acid, CH3CH2CH2COOH, with an unpleasant odor that occurs in butter and animal fat as the glycerol ester.
Microscopy, Electron
Microscopy using an electron beam, instead of light, to visualize the sample, thereby allowing much greater magnification. The interactions of ELECTRONS with specimens are used to provide information about the fine structure of that specimen. In TRANSMISSION ELECTRON MICROSCOPY the reactions of the electrons that are transmitted through the specimen are imaged. In SCANNING ELECTRON MICROSCOPY an electron beam falls at a non-normal angle on the specimen and the image is derived from the reactions occurring above the plane of the specimen.
Protein Tyrosine Phosphatase, Non-Receptor Type 13
A subtype of non-receptor protein tyrosine phosphatases that is characterized by the presence of an amino-terminal FERM domain, an intervening region containing five different PDZ domains, and a carboxyl-terminal phosphatase domain. In addition to playing a role as a regulator of the FAS RECEPTOR activity this subtype interacts via its PDZ and FERM domains with a variety of INTRACELLULAR SIGNALING PROTEINS and CYTOSKELETAL PROTEINS.
Carrier Proteins
Transport proteins that carry specific substances in the blood or across cell membranes.
Hydrolysis
The process of cleaving a chemical compound by the addition of a molecule of water.
Blood Chemical Analysis
An examination of chemicals in the blood.
Protein Tyrosine Phosphatase, Non-Receptor Type 3
A subtype of non-receptor protein tyrosine phosphatases that is characterized by the presence of an amino-terminal FERM domain, an intervening region containing one or more PDZ domains, and a carboxyl-terminal phosphatase domain. Expression of this phosphatase subtype has been observed in BONE MARROW; fetal LIVER; LYMPH NODES; and T LYMPHOCYTES.
Plasmids
Extrachromosomal, usually CIRCULAR DNA molecules that are self-replicating and transferable from one organism to another. They are found in a variety of bacterial, archaeal, fungal, algal, and plant species. They are used in GENETIC ENGINEERING as CLONING VECTORS.
Catalysis
The facilitation of a chemical reaction by material (catalyst) that is not consumed by the reaction.
L-Lactate Dehydrogenase
A tetrameric enzyme that, along with the coenzyme NAD+, catalyzes the interconversion of LACTATE and PYRUVATE. In vertebrates, genes for three different subunits (LDH-A, LDH-B and LDH-C) exist.
Protein-Serine-Threonine Kinases
A group of enzymes that catalyzes the phosphorylation of serine or threonine residues in proteins, with ATP or other nucleotides as phosphate donors.
Phosphatidylinositol Diacylglycerol-Lyase
A phosphorus-oxygen lyase found primarily in BACTERIA. The enzyme catalyzes the cleavage of a phosphoester linkage in 1-phosphatidyl-1D-myo-inositol to form 1D-myo-inositol 1,2-cyclic phosphate and diacylglycerol. The enzyme was formerly classified as a phosphoric diester hydrolase (EC 3.1.4.10) and is often referred to as a TYPE C PHOSPHOLIPASES. However it is now known that a cyclic phosphate is the final product of this enzyme and that water does not enter into the reaction.
Glycosylphosphatidylinositols
Compounds containing carbohydrate or glycosyl groups linked to phosphatidylinositols. They anchor GPI-LINKED PROTEINS or polysaccharides to cell membranes.
5'-Nucleotidase
A glycoprotein enzyme present in various organs and in many cells. The enzyme catalyzes the hydrolysis of a 5'-ribonucleotide to a ribonucleoside and orthophosphate in the presence of water. It is cation-dependent and exists in a membrane-bound and soluble form. EC 3.1.3.5.
Phenylalanine
An essential aromatic amino acid that is a precursor of MELANIN; DOPAMINE; noradrenalin (NOREPINEPHRINE), and THYROXINE.
Mesenchymal Stromal Cells
Bone-marrow-derived, non-hematopoietic cells that support HEMATOPOETIC STEM CELLS. They have also been isolated from other organs and tissues such as UMBILICAL CORD BLOOD, umbilical vein subendothelium, and WHARTON JELLY. These cells are considered to be a source of multipotent stem cells because they include subpopulations of mesenchymal stem cells.
Tumor Cells, Cultured
Cells grown in vitro from neoplastic tissue. If they can be established as a TUMOR CELL LINE, they can be propagated in cell culture indefinitely.
Integrin-Binding Sialoprotein
A highly glycosylated and sulfated phosphoprotein that is found almost exclusively in mineralized connective tissues. It is an extracellular matrix protein that binds to hydroxyapatite through polyglutamic acid sequences and mediates cell attachment through an RGD sequence.
Phenotype
The outward appearance of the individual. It is the product of interactions between genes, and between the GENOTYPE and the environment.
Cell Division
The fission of a CELL. It includes CYTOKINESIS, when the CYTOPLASM of a cell is divided, and CELL NUCLEUS DIVISION.
Butyrates
Derivatives of BUTYRIC ACID. Included under this heading are a broad variety of acid forms, salts, esters, and amides that contain the carboxypropane structure.
Cartilage
A non-vascular form of connective tissue composed of CHONDROCYTES embedded in a matrix that includes CHONDROITIN SULFATE and various types of FIBRILLAR COLLAGEN. There are three major types: HYALINE CARTILAGE; FIBROCARTILAGE; and ELASTIC CARTILAGE.
Phosphorus Radioisotopes
Unstable isotopes of phosphorus that decay or disintegrate emitting radiation. P atoms with atomic weights 28-34 except 31 are radioactive phosphorus isotopes.
Immunoenzyme Techniques
Immunologic techniques based on the use of: (1) enzyme-antibody conjugates; (2) enzyme-antigen conjugates; (3) antienzyme antibody followed by its homologous enzyme; or (4) enzyme-antienzyme complexes. These are used histologically for visualizing or labeling tissue specimens.
Bone Development
The growth and development of bones from fetus to adult. It includes two principal mechanisms of bone growth: growth in length of long bones at the epiphyseal cartilages and growth in thickness by depositing new bone (OSTEOGENESIS) with the actions of OSTEOBLASTS and OSTEOCLASTS.
DNA Primers
Short sequences (generally about 10 base pairs) of DNA that are complementary to sequences of messenger RNA and allow reverse transcriptases to start copying the adjacent sequences of mRNA. Primers are used extensively in genetic and molecular biology techniques.
Bone Morphogenetic Proteins
Bone-growth regulatory factors that are members of the transforming growth factor-beta superfamily of proteins. They are synthesized as large precursor molecules which are cleaved by proteolytic enzymes. The active form can consist of a dimer of two identical proteins or a heterodimer of two related bone morphogenetic proteins.
Saccharomyces cerevisiae
A species of the genus SACCHAROMYCES, family Saccharomycetaceae, order Saccharomycetales, known as "baker's" or "brewer's" yeast. The dried form is used as a dietary supplement.
Peptides
Members of the class of compounds composed of AMINO ACIDS joined together by peptide bonds between adjacent amino acids into linear, branched or cyclical structures. OLIGOPEPTIDES are composed of approximately 2-12 amino acids. Polypeptides are composed of approximately 13 or more amino acids. PROTEINS are linear polypeptides that are normally synthesized on RIBOSOMES.
Intestinal Mucosa
Lining of the INTESTINES, consisting of an inner EPITHELIUM, a middle LAMINA PROPRIA, and an outer MUSCULARIS MUCOSAE. In the SMALL INTESTINE, the mucosa is characterized by a series of folds and abundance of absorptive cells (ENTEROCYTES) with MICROVILLI.
Precipitin Tests
Serologic tests in which a positive reaction manifested by visible CHEMICAL PRECIPITATION occurs when a soluble ANTIGEN reacts with its precipitins, i.e., ANTIBODIES that can form a precipitate.
Disaccharidases
Bone Neoplasms
Tumors or cancer located in bone tissue or specific BONES.
Skull
The SKELETON of the HEAD including the FACIAL BONES and the bones enclosing the BRAIN.
Rats, Wistar
A strain of albino rat developed at the Wistar Institute that has spread widely at other institutions. This has markedly diluted the original strain.
Serine
A non-essential amino acid occurring in natural form as the L-isomer. It is synthesized from GLYCINE or THREONINE. It is involved in the biosynthesis of PURINES; PYRIMIDINES; and other amino acids.
Rats, Sprague-Dawley
A strain of albino rat used widely for experimental purposes because of its calmness and ease of handling. It was developed by the Sprague-Dawley Animal Company.
Rats, Inbred Strains
Genetically identical individuals developed from brother and sister matings which have been carried out for twenty or more generations or by parent x offspring matings carried out with certain restrictions. This also includes animals with a long history of closed colony breeding.
Phosphotyrosine
An amino acid that occurs in endogenous proteins. Tyrosine phosphorylation and dephosphorylation plays a role in cellular signal transduction and possibly in cell growth control and carcinogenesis.
Cell Proliferation
All of the processes involved in increasing CELL NUMBER including CELL DIVISION.
Digoxigenin
3 beta,12 beta,14-Trihydroxy-5 beta-card-20(22)-enolide. A cardenolide which is the aglycon of digoxin. Can be obtained by hydrolysis of digoxin or from Digitalis orientalis L. and Digitalis lanata Ehrh.
Gene Expression Regulation
Any of the processes by which nuclear, cytoplasmic, or intercellular factors influence the differential control (induction or repression) of gene action at the level of transcription or translation.
Hydrolases
Any member of the class of enzymes that catalyze the cleavage of the substrate and the addition of water to the resulting molecules, e.g., ESTERASES, glycosidases (GLYCOSIDE HYDROLASES), lipases, NUCLEOTIDASES, peptidases (PEPTIDE HYDROLASES), and phosphatases (PHOSPHORIC MONOESTER HYDROLASES). EC 3.
Cytoplasm
The part of a cell that contains the CYTOSOL and small structures excluding the CELL NUCLEUS; MITOCHONDRIA; and large VACUOLES. (Glick, Glossary of Biochemistry and Molecular Biology, 1990)
Transcription, Genetic
The biosynthesis of RNA carried out on a template of DNA. The biosynthesis of DNA from an RNA template is called REVERSE TRANSCRIPTION.
Models, Biological
Theoretical representations that simulate the behavior or activity of biological processes or diseases. For disease models in living animals, DISEASE MODELS, ANIMAL is available. Biological models include the use of mathematical equations, computers, and other electronic equipment.
Enzymes
Biological molecules that possess catalytic activity. They may occur naturally or be synthetically created. Enzymes are usually proteins, however CATALYTIC RNA and CATALYTIC DNA molecules have also been identified.
Swine
Any of various animals that constitute the family Suidae and comprise stout-bodied, short-legged omnivorous mammals with thick skin, usually covered with coarse bristles, a rather long mobile snout, and small tail. Included are the genera Babyrousa, Phacochoerus (wart hogs), and Sus, the latter containing the domestic pig (see SUS SCROFA).
Amino Acids
Organic compounds that generally contain an amino (-NH2) and a carboxyl (-COOH) group. Twenty alpha-amino acids are the subunits which are polymerized to form proteins.
Chromatography, Ion Exchange
Separation technique in which the stationary phase consists of ion exchange resins. The resins contain loosely held small ions that easily exchange places with other small ions of like charge present in solutions washed over the resins.
Calcinosis
Pathologic deposition of calcium salts in tissues.

The incorporation of 5-iodo-2'-deoxyuridine into the DNA of HeLa cells and the induction of alkaline phosphatase activity. (1/6669)

Inhibition of DNA synthesis during the period of exposure of HeLa cells to 5-iodo-2'-deoxyuridine (IUdR) inhibited the induction of alkaline phosphatase activity. This finding, taken together with previous findings that IUdR did not induce alkaline phosphatase activity in the presence of 2-fold molar excess thymidinemonstrated that IUdR incorporation into DNA is correlated with the increase in alkaline phosphatase activity. With the exception of an interim period described in the text, induction of alkaline phosphatase activity was linearly related to medium concentrations of IUdR of up to at least 3 muM. However, the extent of IUdR substitution in DNA did not appear to be related to the degree of enzyme induction. Alkaline phosphatase activity continued to increase at medium concentrations of IUdR from 1 to 3 muM, while little further substitution of DNA occurred.  (+info)

Enzymes and reproduction in natural populations of Drosophila euronotus. (2/6669)

Populations of Drosophila euronotus, one from southern Louisiana )3 samples), and one from Missouri (2 samples), were classified for allele frequencies at alkaline phosphatase (APH) and acid phosphatase (ACPH) loci. The two populations differed consistently in allele frequencies at both loci. The APH locus is on the inversion-free X chromosome; the chromosomal locus of the autosomal ACPH is unknown, and could involve inversion polymorphism. Wild females from Missouri and Louisiana populations heterozygous at the APH locus carried more sperm at capture than did the corresponding homozygotes. This heterotic association was significant for the combined samples, and whether it was the result of heterosis at the enzyme locus studied, or due to geographically widespread close linkage with other heterotic loci, it should help to maintain heterozygosity at the APH locus. In a Louisiana collection which included large numbers of sperm-free females, simultaneous homozygosity at both enzyme loci was significantly associated with lack of sperm. It is suggested that the latter association is the result of young heterozygous females achieving sexual maturity earlier than do the double homozygotes. The average effective sperm load for 225 wild females was only 29.4, suggesting the necessity for frequent repeat-mating in nature to maintain female fertility. A comparison of the sex-linked APH genotypes of wild females with those of their daughters indicated that among 295 wild-inseminated females from five populations, 35% had mated more than once, and of this 35%, six females had mated at least three times. Because of ascertainment difficulties, it is clear that the true frequency of multiple-mating in nature must have been much higher than the observed 35%. Laboratory studies indicate that multiple-mating in this species does not involve sperm displacement, possibly due to the small number of sperms transmitted per mating, and the fact that the sperm receptacles are only partially filled by a given mating.  (+info)

Polymorphism in a cyclic parthenogenetic species: Simocephalus serrulatus. (3/6669)

A survey of sixteen isozyme loci using electrophoretic techniques was conducted for three isolated natural populations and one laboratory population of the cyclic parthenogenetic species, Simocephalus serrulatus. The proportion of polymorphic loci (33%-60%) and the average number of heterozygous loci per individual (6%-23%) in the three natural populations were found to be comparable to those found in most sexually reproducing organisms. Detailed analyses were made for one of these populations using five polymorphic loci. The results indicated that (1) seasonal changes in genotypic frequencies took place, (2) apomicitic parthenogenesis does not lead to genetic homogeneity, and (3) marked gametic disequilibrium at these five loci was present in the population, indicating that selection acted on coadapted groups of genes.  (+info)

A single membrane-embedded negative charge is critical for recognizing positively charged drugs by the Escherichia coli multidrug resistance protein MdfA. (4/6669)

The nature of the broad substrate specificity phenomenon, as manifested by multidrug resistance proteins, is not yet understood. In the Escherichia coli multidrug transporter, MdfA, the hydrophobicity profile and PhoA fusion analysis have so far identified only one membrane-embedded charged amino acid residue (E26). In order to determine whether this negatively charged residue may play a role in multidrug recognition, we evaluated the expression and function of MdfA constructs mutated at this position. Replacing E26 with the positively charged residue lysine abolished the multidrug resistance activity against positively charged drugs, but retained chloramphenicol efflux and resistance. In contrast, when the negative charge was preserved in a mutant with aspartate instead of E26, chloramphenicol recognition and transport were drastically inhibited; however, the mutant exhibited almost wild-type multidrug resistance activity against lipophilic cations. These results suggest that although the negative charge at position 26 is not essential for active transport, it dictates the multidrug resistance character of MdfA. We show that such a negative charge is also found in other drug resistance transporters, and its possible significance regarding multidrug resistance is discussed.  (+info)

Acetyl-CoA:1-O-alkyl-2-lyso-sn-glycero-3-phosphocholine acetyltransferase is directly activated by p38 kinase. (5/6669)

Acetyl-CoA:1-O-alkyl-2-lyso-sn-glycero-3-phosphocholine acetyltransferase, along with phospholipase A2, is a key regulator of platelet-activating factor biosynthesis via the remodeling pathway. We have now obtained evidence in human neutrophils indicating that this enzyme is regulated by a specific member of the mitogen-activated protein kinases, namely the p38 kinase. We earlier demonstrated that tumor necrosis factor-alpha (TNF-alpha) as well as N-formyl-methionyl-leucyl-phenylalanine treatment leads to increased phosphorylation and activation of p38 kinase in human neutrophils. Strikingly, in the present study these stimuli increased the catalytic activity of acetyltransferase up to 3-fold, whereas 4-phorbol 12-myristate 13-acetate, which activates the extracellular-regulated kinases (ERKs) but not p38 kinase, had no effect. Furthermore, a selective inhibitor of p38 kinase, SB 203580, was able to abolish the TNF-alpha- and N-formyl-methionyl-leucyl-phenylalanine-induced activation of acetyltransferase. The same effect was not observed in the presence of an inhibitor that blocked ERK activation (PD 98059). Complementing the findings in intact cells, we have shown that recombinant, activated p38 kinase added to microsomes in the presence of Mg2+ and ATP increased acetyltransferase activity to the same degree as in microsomes obtained from TNF-alpha-stimulated cells. No activation of acetyltransferase occurred upon treatment of microsomes with either recombinant, activated ERK-1 or ERK-2. Finally, the increases in acetyltransferase activity induced by TNF-alpha could be ablated by treating the microsomes with alkaline phosphatase. Thus acetyltransferase appears to be a downstream target for p38 kinase but not ERKs. These data from whole cells as well as cell-free systems fit a model wherein stimulus-induced acetyltransferase activation is mediated by a phosphorylation event catalyzed directly by p38 kinase.  (+info)

An interpretation of the serum alkaline phosphatase isoenzyme patterns in patients with obstructive liver disease. (6/6669)

Earlier studies have identified two main isoenzymes of alkaline phosphatase in the sera of patients with obstructive liver disease. This paper reports on a study of these isoenzymes in specific types of liver disease where the pathology in relation to bile duct obstruction is known. The results have been used to support the theory that in biliary obstruction the increase in serum alkaline phosphatase is in part due to regurgitation of the biliary isoenzymes.  (+info)

Biochemical indices of osteomalacia in pregnant Asian immigrants in Britain. (7/6669)

Serum calcium, phosphate and alkaline phosphatase, and urinary calcium excretion were examined during the second trimester of uncomplicated normal pregnancy in Asian immigrants to Britain and in local Caucasians. The mean serum calcium was significantly lower in Asians than in Caucasians, and the mean serum alkaline phosphatase was significantly higher in Asians. The geometric mean of the urinary calcium excretion was highly significantly lower in Asians than in Caucasians. The variances of the serum calcium, serum alkaline phosphatase, and urine calcium excretion did not differ significantly in the two populations. This indicates that there is a shift in values of immigrant Asians as a group compared with Caucasians. A comparison with figures obtained on normal nonpregnant persons of both suggests that the shift is not an inherent feature of the Asian population.  (+info)

Antitumor agents. I. Effect of 5-fluorouracil and cyclophosphamide on liver microsomes and thymus of rat. (8/6669)

Effects of antitumor agents on rat liver microsomal drug-metabolizing enzyme activities and thymus lymphocytes were studied in male Wistar rats. High doses of 5-fluorouracil (5-FU) and cyclophosphamide (CP) given parenterally for 6 days caused a partial decrease in whole body weight and the microsomal enzyme content such as cytochrome P-450 and cytochrome b5. Aniline p-hydroxylase and aminopyrine N-demethylase activities also decreased in rats dosed for 5 days decreased compared with the control. Both compounds in the high concentrations produced spectral change of "modified type II". However, the magnitude of the spectral changes observed was independent of the the concentration of substrate added. The addition of NADPH to the microsomes-substrate mixture modified the spectral change. Both drugs caused a considerable decrease in thymus weight and the number of thymus lymphocytes, while the alkaline phosphatase activity was enhanced in 5-FU groups, indicating that the agents cause a significant involution of the thymus. Decrease in the total number of the lymphocytes was greater than that in the blood leucocytes.  (+info)

Bone Alkaline Phosphatase Antibody | Alkaline Phosphatase, Bone | Bone Specific Alkaline Phosphatase (Rat) Polyclonal AntibodyBone Alkaline Phosphatase Antibody | Alkaline Phosphatase, Bone | Bone Specific Alkaline Phosphatase (Rat) Polyclonal Antibody
Bone Alkaline Phosphatase, also known as Bone Specific Alkaline Phosphatase, is expressed in osteoblasts during bone formation and is thought to play a role in skeletal mineralization. Takaras Bone Specific Alkaline Phosphatase (Rat) Polyclonal Antibody was raised against a conjugate of the KLH (keyhole limpet hemocyanin) immunogen and the peptide (20-49) [PEKEKDPKYWRDQAQETLKYALELQKLNTN], which is highly conserved between human and rat bone specific alkaline phosphatase.. ...
http://www.clontech.com/US/Products/Cell_Biology_and_Epigenetics/Bone_Research/Bone_Specific_Alkaline_Phosphatase?sitex=10020:22372:US&PEBCL1=FylXsjknUTYyLnpq8kLRkfpCdY&PEBCL1_pses=ZG42785DCCB4794137CD36DD28CB154F97CE6BBC2A4802D5F9BB80ABF9575B87DFE7A612C938356EE234857EC0E5ECC6D97D1C5C384081A1D1
Bone Alkaline Phosphatase Antibody | Alkaline Phosphatase, Bone | Bone Specific Alkaline Phosphatase (Rat) Polyclonal AntibodyBone Alkaline Phosphatase Antibody | Alkaline Phosphatase, Bone | Bone Specific Alkaline Phosphatase (Rat) Polyclonal Antibody
Bone Alkaline Phosphatase, also known as Bone Specific Alkaline Phosphatase, is expressed in osteoblasts during bone formation and is thought to play a role in skeletal mineralization. Takaras Bone Specific Alkaline Phosphatase (Rat) Polyclonal Antibody was raised against a conjugate of the KLH (keyhole limpet hemocyanin) immunogen and the peptide (20-49) [PEKEKDPKYWRDQAQETLKYALELQKLNTN], which is highly conserved between human and rat bone specific alkaline phosphatase.. ...
http://www.clontech.com/US/Products/Cell_Biology_and_Epigenetics/Bone_Research/Bone_Specific_Alkaline_Phosphatase?sitex=10020:22372:US&PEBCL1=suphWgtkLuiwQDG0gCLXVRGQzV&PEBCL1_pses=ZG758E3CEF3953A99FA57F664ADFADF91C2C45283788F9F2473AD4AAA0A881D5B2BEB7F37271BB7FFB8076011C9558A77872DC88C2C19E4D62
Quantitative method for determining serum alkaline phosphatase isoenzyme activity: estimation of intestinal component. |...Quantitative method for determining serum alkaline phosphatase isoenzyme activity: estimation of intestinal component. |...
Intestinal alkaline phosphatase activity was measured using levamisole inhibition, and results were compared with a previously reported method using L-phenylalanine. Sixty two per cent intestinal, 39% placental, and 1.3% of either bone or liver alkaline phosphatase activity remained when alkaline phosphatase activity was inhibited in a 2-amino-2-methyl-1-propanol (AMP) buffer reagent system with 10 mmol/l levamisole (final assay concentration 8.1 mmol/l). The assay imprecision (SD) was 0.6 U/l compared with 3.9 U/l using L-phenylalanine for specimens with total alkaline phosphatase activity less than 250 U/l (reference range 30-120 U/l). In serum pools with raised total alkaline phosphatase activity errors in recovered intestinal activity were small (usually less than 3 U/l) when intestinal alkaline phosphatase was added. Much larger errors and many underestimated results were found using L-phenylalanine. For non-haemolysed specimens it is concluded that an assay based on levamisole inhibition ...
http://jcp.bmj.com/content/41/2/202
Benign Transient Hyperphosphatasemia Associated With Epstein-Barr Virus Enteritis in a Pediatric Liver Transplant Patient: A...Benign Transient Hyperphosphatasemia Associated With Epstein-Barr Virus Enteritis in a Pediatric Liver Transplant Patient: A...
TY - JOUR. T1 - Benign Transient Hyperphosphatasemia Associated With Epstein-Barr Virus Enteritis in a Pediatric Liver Transplant Patient. T2 - A Case Report. AU - Hranjec, T.. AU - Bonatti, H.. AU - Roman, A. L.. AU - Sifri, C.. AU - Borowitz, S. M.. AU - Barnes, B. H.. AU - Flohr, T. R.. AU - Pruett, T. L.. AU - Sawyer, R. G.. AU - Schmitt, T. M.. PY - 2008/6. Y1 - 2008/6. N2 - Transient hyperphosphatasemia was found in a 3-year-old male liver transplant recipient. The condition was associated with diarrheal disease due to the Epstein-Barr virus (EBV). Immunosuppression was tapered and valganciclovir prescribed for 3 months, after which the diarrhea resolved and the EBV polymerase chain reaction assays became negative. After 6 months, alkaline phosphatase levels normalized. Isolated elevation of alkaline phosphatase in conjunction with enteric infection is a rare condition. No further diagnostic or therapeutic interventions except treatment of the underlying infection are needed, as this has ...
https://experts.umn.edu/en/publications/benign-transient-hyperphosphatasemia-associated-with-epstein-barr
High serum alkaline phosphatase levels, a study in 181 Thai adult hospitalized patients | BMC Family Practice | Full TextHigh serum alkaline phosphatase levels, a study in 181 Thai adult hospitalized patients | BMC Family Practice | Full Text
During the one-year period, a total of 181 hospitalized patients with serum ALP level over 1000 IU/L were identified. They were 102 male and 96 female patients with ages ranging from 21 to 90 years old (mean age 49.4 ± 16.1 years). The ALP levels ranged from 1,001 to 3,067 IU/L.. The most common diagnosis in patients with high ALP in our series was malignant biliary obstruction. This was found in 58 patients, 48 of whom were cases with cholangicocarcinoma (CCA). Of the remaining 10, three were with pancreatic cancer, one with ampullary cancer, one with metastatic cancer, and five with periampullary cancer. The ALP levels ranged from 1,005 to 3,067 IU/L (average 1,869.8 ± 325.3 IU/L). In addition, benign duct obstruction from choledocholithiasis was found in another 14 patients, six of which cases were complicated by ascending cholangitis. The ALP level in this group ranged from 1,001 to 2,864 IU/L (average 1,498.3 ± 541.2 IU/L). Comparing these two groups, the mean ALP levels in the malignant ...
https://bmcfampract.biomedcentral.com/articles/10.1186/1471-2296-2-2
Immobilization of alkaline phosphatase on magnetic particles by site-specific and covalent cross-linking catalyzed by microbial...
TY - JOUR. T1 - Immobilization of alkaline phosphatase on magnetic particles by site-specific and covalent cross-linking catalyzed by microbial transglutaminase. AU - Moriyama, Kousuke. AU - Sung, Kyunga. AU - Goto, Masahiro. AU - Kamiya, Noriho. N1 - Funding Information: We are grateful to Ajinomoto Co., Inc. (Japan) for providing MTG samples. This work was supported by a Grant-in-Aid for the Global COE program Science for Future Molecular Systems, from the Ministry of Education, Culture, Sports, Science and Technology of Japan .. PY - 2011/6. Y1 - 2011/6. N2 - Bacterial alkaline phosphatase (BAP) was site-specifically and covalently immobilized on magnetic particles (MPs) using the enzymatic reaction of microbial transglutaminase (MTG). Immobilization efficiency was affected by the chemical surface treatment of MPs and immobilized BAP exhibited more than 90% of the initial activity after 10 rounds of recycling.. AB - Bacterial alkaline phosphatase (BAP) was site-specifically and covalently ...
https://kyushu-u.pure.elsevier.com/en/publications/immobilization-of-alkaline-phosphatase-on-magnetic-particles-by-s
Recombinant Human intestinal alkaline phosphatase protein (ab114266) | AbcamRecombinant Human intestinal alkaline phosphatase protein (ab114266) | Abcam
Recombinant Human intestinal alkaline phosphatase protein is a Wheat germ Protein fragment 74 to 162 aa range and validated in WB, ELISA, SDS-PAGE.
https://www.abcam.com/recombinant-human-intestinal-alkaline-phosphatase-protein-ab114266.html
Alkaline phosphatase levels in children - Doctor answersAlkaline phosphatase levels in children - Doctor answers
Alkaline phosphatase levels in children - Medicine for high alkaline phosphatase levels? Wrong approach. Alkaline phosphatase is a lab value to tell a physician what is happening, not a medical problem to treat. It can be high just because you
https://www.healthtap.com/topics/alkaline-phosphatase-levels-in-children
Tips From Other Journals - American Family PhysicianTips From Other Journals - American Family Physician
Treatment of Pagets disease of bone traditionally has been limited to patients with severe disease, defined as serum alkaline phosphatase levels of more than two times the upper limit of normal, bone pain not responsive to analgesics and higher risk for complications such as fracture. Newer antiresorptive treatments, including pamidronate, alendronate, tiludronate and etidronate, offer more widespread therapeutic intervention and shorter treatment courses. Risedronate is a pyridinyl bisphosphonate that is about 1,000 times more potent than etidronate and three to five times more potent than alendronate. These attributes allow for a shorter duration of treatment at a lower dosage. Miller and associates compared the effectiveness of risedronate with that of etidronate in the treatment of Pagets disease of bone.. Patients with documented Pagets disease were included if their serum alkaline phosphatase levels were at least two times the upper limit of normal. Women were required to be ...
https://www.aafp.org/afp/1999/1101/p2107a.html
Characterization of a second promoter for the mouse liver/bone/kidney-type alkaline phosphatase gene: Cell and tissue specific...
TY - JOUR. T1 - Characterization of a second promoter for the mouse liver/bone/kidney-type alkaline phosphatase gene. T2 - Cell and tissue specific expression. AU - Studer, Michela. AU - Terao, Mineko. AU - Giannì, Maurizio. AU - Garattini, Enrico. PY - 1991/9/30. Y1 - 1991/9/30. N2 - The second leader exon and the relative promoter of the mouse liver/bone/kidney-type alkaline phosphatase gene were identified and characterized. The transcription initiation site was determined by S1 mapping analysis. The differential expression of the two alternatively spliced transcripts was assessed in cell lines of different origin and in various tissues by polymerase chain reaction and RNase mapping analysis. The first promoter is active in embryo derived cells, whereas the second promoter is silent in basal conditions but it is activated by dibutyryl cAMP in fibroblastic cells. In the whole animal, the transcript driven by the first promoter is found in most tissues albeit at different levels, while the one ...
https://moh-it.pure.elsevier.com/en/publications/characterization-of-a-second-promoter-for-the-mouse-liverbonekidn
ALP isoenzyme test - Symptoms, Treatments and Resources for ALP isoenzyme testALP isoenzyme test - Symptoms, Treatments and Resources for ALP isoenzyme test
ALP isoenzyme test - MedHelps ALP isoenzyme test Center for Information, Symptoms, Resources, Treatments and Tools for ALP isoenzyme test. Find ALP isoenzyme test information, treatments for ALP isoenzyme test and ALP isoenzyme test symptoms.
http://apps.medhelp.org/tags/show/18760/ALP-isoenzyme-test
Liver test done, shows albumin serum, alkaline phosphate, SGPT, SGOT levels. Normal report? - Doctors insight on...Liver test done, shows albumin serum, alkaline phosphate, SGPT, SGOT levels. Normal report? - Doctors insight on...
Question - Liver test done, shows albumin serum, alkaline phosphate, SGPT, SGOT levels. Normal report?. Ask a Doctor about Alkaline phosphates, Ask a Gastroenterologist
http://www.healthcaremagic.com/questions/Liver-test-done-shows-albumin-serum-alkaline-phosphate-SGPT-SGOT-levels-Normal-report/321297
Leukocyte Alkaline Phosphatase Decreased: Causes & Diagnoses | Symptoma.comLeukocyte Alkaline Phosphatase Decreased: Causes & Diagnoses | Symptoma.com
Leukocyte Alkaline Phosphatase Decreased Possible Causes (Differential Diagnoses) include ❗ Infectious Mononucleosis ❗ Chronic Lymphocytic Leukemia ❗ Chronic Myeloid Leukemia ❗ Check more at Symptoma.com
https://www.symptoma.com/en/ddx/leukocyte-alkaline-phosphatase-decreased
Elevated alkaline phosphatase - Liver Disorders - MedHelpElevated alkaline phosphatase - Liver Disorders - MedHelp
I recently had a liver function test as part of my regular blood work. My alkaline phosphatase level was 145.0, where the normal range is 35.0-123.0. My doctor told me that the results indicated that...
http://www.medhelp.org/posts/Liver-Disorders/Elevated-alkaline-phosphatase-/show/934523
E7389 Versus Treatment of Physician's Choice in Patients With Locally Recurrent or Metastatic Breast Cancer - Full Text...E7389 Versus Treatment of Physician's Choice in Patients With Locally Recurrent or Metastatic Breast Cancer - Full Text...
Adequate liver function as evidenced by bilirubin ,= 1.5 times the upper limits of normal (ULN) and alkaline phosphatase, alanine aminotransferase (ALT), and aspartate aminotransferase (AST) ,= 3 x ULN (in the case of liver metastases ,= 5 x ULN), unless there are bone metastases, in which case liver specific alkaline phosphatase must be separated from the total and used to assess the liver function instead of the total alkaline phosphatase. In case alkaline phosphatase is ,3 x ULN (in absence of liver metastases) or , 5 x ULN (in presence of liver metastases) AND patient is known to have bone metastases, the liver specific alkaline phosphatase must be separated from the total and used to assess the liver function instead of the total alkaline phosphatase ...
https://clinicaltrials.gov/ct2/show/NCT00388726
ALKALINE PHOSPHATASE
Serum alkaline phosphatase levels are of interest in the diagnosis of hepatobiliary disorders and bone disease associated with increased osteoblastic activity. Moderate elevations of alkaline phosphatase may be seen in several conditions that do not involve the liver or bone. Among these are Hodgkins disease, congestive heart failure, ulcerative colitis, regional enteritis, and intra-abdominal bacterial infections. Elevations are also observed during the third trimester of pregnancy.. ...
http://www.saveonlabs.com/product-p/234.htm
Alkaline Phosphatase Assay Kit (ab83371) | AbcamAlkaline Phosphatase Assay Kit (ab83371) | Abcam
Assay Alkaline phosphatase in 1 hr in cell culture media, cell/tissue extracts, and biofluids with Alkaline Phosphatase Assay Kit (Fluorometric) ab83371. For microplate readers.
https://www.abcam.com/alkaline-phosphatase-assay-kit-fluorometric-ab83371.html
GastroHep News StoryGastroHep News Story
The doctors found that the median survival time from the diagnosis of AIDS and AIDS cholangiopathy was 23 and 9 months, respectively. In addition, they determined that HAART significantly improved the mortality of patients with AIDS cholangiopathy.. The team determined that any opportunistic infection of the digestive tract, lung, eye, nervous system, skin, or systemic involvement at diagnosis was an indicator of poor prognosis.. They also found that patients with high serum ALP levels tended to have a shorter life expectancy than those with normal or slightly elevated serum ALP levels. However, CD4 lymphocyte counts, type of cholangiopathy, and the performance of sphincterotomy were not correlated with patient survival.. Dr Wei-Fang Kos team concluded, HAART administration most likely accounts for the recent dramatic improvement in survival of patients with AIDS cholangiopathy. Underlying immunosuppressive status, reflected by the presence or history of any opportunistic infections, is ...
http://www.gastrohep.com/news/news.asp?id=2341
The efficacy of modified neutrophil alkaline phosphatase score, serum IL-6, IL-18 and CC16 levels on the prognosis of moderate...The efficacy of modified neutrophil alkaline phosphatase score, serum IL-6, IL-18 and CC16 levels on the prognosis of moderate...
The efficacy of modified neutrophil alkaline phosphatase score, serum IL-6, IL-18 and CC16 levels on the prognosis of moderate and severe COPD patients, Jinbiao Zhang, Rongqin Dai,
https://www.alliedacademies.org/articles/the-efficacy-of-modified-neutrophil-alkaline-phosphatase-score-serum-il6-il18-and-cc16-levels-on-the-prognosis-of-moderate-and-sev-8396.html
IntechOpen Open Access Publisher - Open Science Open Minds | IntechOpenIntechOpen Open Access Publisher - Open Science Open Minds | IntechOpen
Royal Jelly and Human Interferon-Alpha (HuIFN-αN3) Affect Proliferation, Glutathione Level, and Lipid Peroxidation in Human Colorectal Adenocarcinoma Cells In Vitro. By Bratko Filipič, Lidija Gradišnik, Klemen Rihar, Adriana Pereyra, Damir Đermić and Hrvoje Mazija. The purpose was to investigate the influence of RJ-F(M), 10-hydroxy-2-decenoic acid and HuIFN-αN3 on the proliferation of CaCo-2 cells and ascertain their effects on intracellular glutathione level and lipid peroxidation. The antiproliferative (AP) activity of RJ-F (M) (0.1 g/10 mL PBS), HuIFN-αN3 (1000 IU mL−1), 10-HDA (100.0 μmol L−1) and their combinations, in the ratios 1:1, 1:2, and 2:1 on CaCo-2 cells were measured. Single RJ-F (M) had a low AP activity: 2.0 (0.5 mg mL−1). HuIFN-αN3 had an AP activity of 2.5 (208.33 IU mL−1), while 10-HDA had an AP activity of 1.5 (37.5 μmol mL−1). AP activity of 3.8 was obtained when RJ-F(M) and HuIFN-αN3 were in the ratio 2:1. In it, the level of GSH was 24.9 ± 2.4 nmol ...
https://www.intechopen.com/profiles/254007/bratko-filipic
Alkaline phosphatase. I. Comparison of the physical and chemical properties of enzyme preparations from mammalian cell cultures...
TY - JOUR. T1 - Alkaline phosphatase. I. Comparison of the physical and chemical properties of enzyme preparations from mammalian cell cultures, various animal tissues, and Escherichia coli. AU - Cox, Rody P.. AU - Griffin, Martin J.. PY - 1967/12. Y1 - 1967/12. N2 - Some of the chemical and physical properties of alkaline phosphatase preparations derived from mammalian tissues, cell cultures, and E. coli have been compared. A number of chemical and physical properties of the various enzyme preparations are similar, such as the concentration of cysteine and histidine that inhibits alkaline phosphatase activity, and the phosphotransferase activity of different enzyme preparations. Other properties of the various alkaline phosphatases are markedly different, such as heat stability at 56 °, electrophoretic mobility, and the concentrations of Zn ions, L-phenylalanine, and L-tryptophan required to inhibit enzyme activity by 50%. These differences provide a means of distinguishing between alkaline ...
https://utsouthwestern.pure.elsevier.com/en/publications/alkaline-phosphatase-i-comparison-of-the-physical-and-chemical-pr
The study of biogenesis and secretion of alkaline phosphatase and its mutant forms in Escherichia coli. I. Introduction of...
TY - JOUR. T1 - The study of biogenesis and secretion of alkaline phosphatase and its mutant forms in Escherichia coli. I. Introduction of mutations into alkaline phosphatase gene. AU - Karamyshev, A. L.. AU - Shlyapnikov, M. G.. AU - Khmelnitsky, M. I.. AU - Nesmeyanova, M. A.. AU - Ksenzenko, V. N.. PY - 1994. Y1 - 1994. N2 - Various mutations in E. coli alkaline phosphatase gene were obtained by oligonucleotide-directed mutagenesis. They result in amino acid substitutions in the signal peptide cleavage site [Val for Ala(-1)] and in the N terminus of mature polypeptide chain: Ala for Arg(+1) and Gln for Glu(+4); Gln for Glu(+4). Enzyme activity was observed in all E. coli strains transformed by plasmids with cloned mutant genes. In addition, an amber mutation was introduced into the Arg(+1) position, and the synthesis of mutant alkaline phosphatase was shown in E. coli strains containing suppressor tRNAs specific for Ser, Gln, Tyr, Leu, Ala, Glu, Phe, Gly, His, Pro, and Cys.. AB - Various ...
https://utsouthwestern.pure.elsevier.com/en/publications/the-study-of-biogenesis-and-secretion-of-alkaline-phosphatase-and-2
The effect of intestinal alkaline phosphatase on intestinal epithelial cells, macrophages and chronic colitis in mice. | Sigma...The effect of intestinal alkaline phosphatase on intestinal epithelial cells, macrophages and chronic colitis in mice. | Sigma...
Sigma-Aldrich offers abstracts and full-text articles by [Changhyun Lee, Jaeyoung Chun, Sung Wook Hwang, Seung Joo Kang, Jong Pil Im, Joo Sung Kim].
https://www.sigmaaldrich.com/catalog/papers/24548630
A CHEMICAL METHOD FOR THE ISOLATION OF HELA CELL NUCLEI AND THE NUCLEAR LOCALIZATION OF HELA CELL ALKALINE PHOSPHATASE |...A CHEMICAL METHOD FOR THE ISOLATION OF HELA CELL NUCLEI AND THE NUCLEAR LOCALIZATION OF HELA CELL ALKALINE PHOSPHATASE |...
M. J. Griffin, R. P. Cox, N. Grujic; A CHEMICAL METHOD FOR THE ISOLATION OF HELA CELL NUCLEI AND THE NUCLEAR LOCALIZATION OF HELA CELL ALKALINE PHOSPHATASE . J Cell Biol 1 April 1967; 33 (1): 200-203. doi: https://doi.org/10.1083/jcb.33.1.200. Download citation file:. ...
https://rupress.org/jcb/article/33/1/200/16920/A-CHEMICAL-METHOD-FOR-THE-ISOLATION-OF-HELA-CELL
Abstract for TR-481Abstract for TR-481
Groups of 10 male and 10 female rats were admin istered 0, 25, 50, 100, 200, or 400 mg oleic acid diethanolamine condensate/kg body weight in ethanol dermally for 13 weeks. All male and female rats survived until the end of the study. The final mean body weights and body weight gains of 200 and 400 mg/kg males and the mean body weight gain of 400 mg/kg females were significantly less than those of the vehicle controls. The only chemical-related clinical finding was irritation of the skin at the site of application in most males administered 100 mg/kg or greater and in all females administered 50 mg/kg or greater. Segmented neutrophil counts were increased relative to the vehicle controls in the 400 mg/kg male group on days 5 and 19, in the 200 mg/kg female group on day 19 and at week 13, and in the 400 mg/kg female group on days 5 and 19 and at week 13. Alkaline phosphatase concentrations were significantly increased in the 200 mg/kg male group on day 19, the 200 mg/kg female group at week 13, ...
https://ntp.niehs.nih.gov/publications/reports/tr/400s/tr481/index.html?utm_source=direct&utm_medium=prod&utm_campaign=ntpgolinks&utm_term=tr481abs
British Library EThOS: Alkaline phosphatase forms in plasma : a clinical studyBritish Library EThOS: Alkaline phosphatase forms in plasma : a clinical study
The identification of the source of a raised total alkaline phosphatase activity in plasma, by the measurement of individual ALP forms, is of clinical value although many of the methods available for this purpose are complex, imprecise and non-specific. This thesis has validated, and in some cases modified, available methods for the measurement of the main forms of alkaline phosphatase (ALP; EC 3.1.3.1) in plasma: liver, bone, intestinal and high-molecular-mass ALP. The following methods were selected on the basis of their reliability and specificity: polyacrylamide gel electrophoresis, with densitometric scanning, for liver and bone ALP, an enzyme-linked immunosorbent assay (ELISA) for intestinal ALP and ion-exchange chromatography for high-molccular-mass ALP. These methods were then used to quantify individual ALP forms in specific disease groups and compare activities to those found in healthy adults. The diseases studied (diabetes mellitus and hyperthryoidism) were those where the source of ...
http://ethos.bl.uk/OrderDetails.do?uin=uk.bl.ethos.662952
Studies on the subcellular localization of human neutrophil alkaline phosphatase | Journal of Cell ScienceStudies on the subcellular localization of human neutrophil alkaline phosphatase | Journal of Cell Science
The intracellular localization of alkaline phosphatase has been determined in human neutrophils with analytical subcellular fractionation by density gradient centrifugation and EM cytochemistry. Centrifugation on sucrose gradients containing 1 mM DETA and 5 units/ml of heparin showed that alkaline phosphatase was associated with a membranous component distinct from plasma membrane, mitochondria, specific granules and azurophil granules. There was no resolution from the endoplasmic reticulum. Density gradient centrifugation on a sucrose-imidazole-heparin gradient showed a clear resolution of the alkaline phosphatase-containing membranes from the Golgi and endoplasmic reticulum. Density gradient centrifugation of neutrophils that had been disrupted in the presenceof 0.12 mmol/l. digitonin clearly separated alkaline phosphatase-containing membranes from the endoplasmic reticulum. Part of the gamma-glutamyl transferase has a similar localization to that of alkaline phosphatase. EM cytochemistry of ...
http://jcs.biologists.org/content/36/1/401
Alkaline Phosphatase, Tissue Non-Specific RNAi (H00000249-R01V): Novus BiologicalsAlkaline Phosphatase, Tissue Non-Specific RNAi (H00000249-R01V): Novus Biologicals
Alkaline Phosphatase, Tissue Non-Specific RNAi. Tested Reactivity: Hu. Validated: WB, RNAi, RNAi SP. Backed by our 100% Guarantee.
https://www.novusbio.com/products/alkaline-phosphatase-tissue-non-specific-rnai_h00000249-r01v
The levels of Serum Alkaline Phosphatase and Lactate Dehydrogenase in Hodgkin Lymphoma - Iranian Journal of Blood and CancerThe levels of Serum Alkaline Phosphatase and Lactate Dehydrogenase in Hodgkin Lymphoma - Iranian Journal of Blood and Cancer
Background: Hodgkins disease (HD) is a neoplastic disease originating in lymphoid tissue, which spreads to lymphoid structures and ultimately nonlymphoid tissues. Lactate Dehydrogenase and Alkaline Phosphatase are increased in blood following membrane cell damage. The aim of this study was to compare Lactate Dehydrogenase and Alkaline Phosphatase levels in children in ...
http://ijbc.ir/article-1-347-en.html
Am hepatitis B carrier. Taking treatment. Reason for high alkaline phosphate, creatinine? - Doctors insight on HealthcareMagicAm hepatitis B carrier. Taking treatment. Reason for high alkaline phosphate, creatinine? - Doctors insight on HealthcareMagic
Question - Am hepatitis B carrier. Taking treatment. Reason for high alkaline phosphate, creatinine?. Ask a Doctor about diagnosis, treatment and medication for Hepatitis b carrier, Ask a Gastroenterologist
http://www.healthcaremagic.com/questions/Am-hepatitis-B-carrier-Taking-treatment-Reason-for-high-alkaline-phosphate-creatinine/369119
SID.ir | EVALUATING SALIVARY ALKALINE PHOSPHATASE LEVELS AS A BIOCHEMICAL MARKER OF PERIODONTAL DISEASE IN PERIODONTAL PATIENTS...SID.ir | EVALUATING SALIVARY ALKALINE PHOSPHATASE LEVELS AS A BIOCHEMICAL MARKER OF PERIODONTAL DISEASE IN PERIODONTAL PATIENTS...
Download Free Full-Text of an article EVALUATING SALIVARY ALKALINE PHOSPHATASE LEVELS AS A BIOCHEMICAL MARKER OF PERIODONTAL DISEASE IN PERIODONTAL PATIENTS IN A TERTIARY HOSPITAL IN NIGERIA
https://www.sid.ir/en/journal/ViewPaper.aspx?id=508219
Transient Bile Duct Obstruction: Response of Serum Bilirubin and Alkaline Phosphatase Levels in the Rat | JAMA Surgery | JAMA...Transient Bile Duct Obstruction: Response of Serum Bilirubin and Alkaline Phosphatase Levels in the Rat | JAMA Surgery | JAMA...
• The immediate evolution of changes in serum bilirubin and alkaline phosphatase levels during and after brief temporary occlusion (12 hours or less) of the mai
https://jamanetwork.com/journals/jamasurgery/article-abstract/582122
Barry SHANE | Nutritional Sciences & Toxicology | University of California, BerkeleyBarry SHANE | Nutritional Sciences & Toxicology | University of California, Berkeley
Most Recent Publications. Bailey, L. B., Stover, P., McNulty, H., Fenech, M., Gregory, J., James Mills, J., Pfeiffer, C. M., Fazili, Z., Zhang, M., Ueland, P., Molloy, A., Caudill, M. A., Shane, B., Berry, R. J., Bailey, R., Raghavan, R. and Raiten, D. (2015) Biomarkers of Nutrition for Development (BOND) - Folate Review. J. Nutr. 145:1636S-80S. Carter, T. C., Pangilinan, F., Molloy, A. M., Fan, R., Wang, Y., Shane, B., Gibney, E. R., Midttun, O., Ueland, P. M, Cropp, C. D., Kim, Y., Wilson, A. F., Bailey-Wilson, J. E., Brody, L. C. and Mills, J. L. (2015) Common variants at putative regulatory sites of the tissue nonspecific alkaline phosphatase gene influence circulating pyridoxal 5-phosphate concentration in healthy adults. J. Nutr. 145:1386-93.. Deac, O. M., Mills, J. L., Shane, B., Midttun, O., Ueland, P. M., Brosnan, J. T., Brosnan, M. E., Laird, E., Gibney, E. R., Fan, R., Wang, Y., Brody, L. C. and Molloy, A. M. (2015) Tryptophan catabolism and vitamin B-6 status are affected by gender ...
https://nst.berkeley.edu/users/barry-shane
Tagging exported proteins using Escherichia coli alkaline phosphatase gene fusions. - PubMed - NCBITagging exported proteins using Escherichia coli alkaline phosphatase gene fusions. - PubMed - NCBI
PubMed comprises more than 30 million citations for biomedical literature from MEDLINE, life science journals, and online books. Citations may include links to full-text content from PubMed Central and publisher web sites.
https://www.ncbi.nlm.nih.gov/pubmed/11036633?dopt=Abstract
Titan gel in vendita filippine olx - dverigermes.ruTitan gel in vendita filippine olx - dverigermes.ru
Alkaline Phosphatase Isoenzymes High Resolution Titan gel in vendita filippine olx Immunofixation Immunoelectrophoresis The alkaline phosphatase ALP isoenzymes found in human serum originate from several sources with the greatest activity occurring in the bone, liver, intestine, and placenta. Because of wide distribution of alkaline phosphatase in tissue, limited information can be obtained from a total ALP assay. Fortunately, the tissue sources of elevated ALP in serum can be determined by identifying the isoenzyme.. The isoenzymes of alkaline phosphatase are unique in that some organs have only one major isoenzyme rather than multiple isoenzyme forms. The isoenzymes of ALP differ in their physicochemical and electrophoretic properties, and it is by taking advantage of these differences that individual isoenzymes can be titan gel in vendita filippine olx. In addition to the liver, bone, intestinal and placental isoenzymes, macrohepatic, Regan, PA, Nagao, and renal isoenzymes have also been ...
http://dverigermes.ru/15-03-2017-4.php
What Are the Causes of Elevated Alkaline Phosphatase? | Healthy LivingWhat Are the Causes of Elevated Alkaline Phosphatase? | Healthy Living
Erik Steel is a graduate of the University of Michigan, earning his bachelors degree in Russian. Steel has worked as writer for more than four years and has contributed content to eHow and Pluck on Demand. His work recently appeared in the literary journal Arsenic Lobster.. ...
https://healthyliving.azcentral.com/what-are-the-causes-of-elevated-alkaline-phosphatase-12259553.html
Comparison between bone alkaline phosphatase immunoassay and electrophoresis technique in hemodialysis patientsComparison between bone alkaline phosphatase immunoassay and electrophoresis technique in hemodialysis patients
Background: Problem of the variability between the different methods using for bone alkaline phosphatase(bALP) determination greately influences the clinical significance of bALP as direct marker of bone metabolism.The aim of this study was to compare immunoassay with electrophoresis technique for bALP determination. Methods: We measured bALP in 71 patients on hemodialysis with agar gel electrophoresis (ISO-PAL, SEBIA) and immunoassay (OSTASE, Beckman Coulter).Results: The analyzed methods showed significant correlation (Spearmans rho: 0.776, P , 0.01), but we found statistically significant (P , 0.01) positive bias (27%)for the results measured by immunoassay. In support of this, using electrophoresis technique we have detected presence of the intestinal isoenzymes of alkaline phosphatase in 55% of patients with median value of 30% of the total alkaline phoshatase and presence of liver-2 alkaline phosphatase... isoform in 42% of patients with median value of 16.6%. The Kendalls W of 0.787 ...
https://farfar.pharmacy.bg.ac.rs/handle/123456789/3617
Role of Vitamin D3 on Alkaline Phosphatase, Collagen, and Bone Mineralization: Impact of Biofield Energy Healing Treatment -...Role of Vitamin D3 on Alkaline Phosphatase, Collagen, and Bone Mineralization: Impact of Biofield Energy Healing Treatment -...
Journal: American Journal of Health Research Volume: 6 Issue: 1 Pages: 6-14 Published: January 10, 2018PDF Source: Trivedi EffectAuthors: Bonnie Patrice Hegarty-Diaz, Mahendra Kumar Trivedi, Alice Branton, Dahryn Trivedi, Gopal Nayak, Sambhu C
https://authorea.com/users/109929/articles/313002-role-of-vitamin-d3-on-alkaline-phosphatase-collagen-and-bone-mineralization-impact-of-biofield-energy-healing-treatment
JFB | Free Full-Text | Biocompatibility and Alkaline Phosphatase Activity of Phosphorylated Chitooligosaccharides on the...JFB | Free Full-Text | Biocompatibility and Alkaline Phosphatase Activity of Phosphorylated Chitooligosaccharides on the...
Phosphorylated chitooligosaccharides (P-COS) were prepared using a H3PO4, P2O5, Et3PO4 and hexanol solvent system. The P-COS were characterized by Fourier Transform Infrared Spectroscopy (FT-IR), Thermo gravimetric-Differential Thermal Analyzer (TG-DTA), 13C NMR, 31P NMR, X-ray diffraction analysis, solubility studies, biocompatibility and Alkaline Phosphatase Activity (ALP). The results reveal that phosphorylation occurred at the C3 and C6 position of OH groups and the C2 position of NH2 group. FT-IR confirmed no decomposition in pyranose ring in P-COS even with heating and treatment in acidic conditions. The amorphous nature of P-COS was confirmed by X-ray diffraction analysis. Further, the biocompatibility and alkaline phosphatase activity of P-COS were checked against the osteosarcoma MG63 cell line at different concentrations and no cytotoxicity was observed. After 12 h and 24 h of incubation, the ALP activity of P-COS was higher compared with the control group. These results suggest that P-COS is
http://www.mdpi.com/2079-4983/1/1/3
Anti-Calf Intestinal Alkaline Phosphatase Antibody (Serum) - Goat Anti-Bovine Polyclonal Antibody IHC-P, IHC-F, E - Buy Now! ...Anti-Calf Intestinal Alkaline Phosphatase Antibody (Serum) - Goat Anti-Bovine Polyclonal Antibody IHC-P, IHC-F, E - Buy Now! ...
Anti-Calf Intestinal Alkaline Phosphatase Antibody (Serum), Goat Anti-Bovine Polyclonal Antibody validated in IHC-P, IHC-F, E (ABD10274), Abgent
http://www.abgent.com/products/ABD10274-Anti-Calf-Intestinal-Alkaline-Phosphatase-Antibody-Serum
Quantitation of phospholipase A<sub>2</sub> and phospholipase C activity using alkaline phosphatase impregnated...
TY - JOUR. T1 - Quantitation of phospholipase A2 and phospholipase C activity using alkaline phosphatase impregnated liposomes. AU - Buxton, Thomas B.. AU - Catto, Brian. AU - Horner, Jack. AU - Yannis, Rex. AU - Rissing, J. Peter. PY - 1986/12. Y1 - 1986/12. N2 - Phospholipase A2 and C activity was quantitated using liposomes impregnated with alkaline phosphatase. Release of alkaline phosphatase was dependent on phospholipase related hydrolysis of intact vesicles. Released alkaline phosphatase was quantitated after addition of its chromogenic substrate p-nitrophenyl phosphate. The lower limit of detectability for phospholipase A2 and C activity was 0.5 unit/ml. These limits were 10-fold lower than a titrimetric method. Liposome destruction as measured by alkaline phosphatase release was calcium dependent and inhibited by 1 mM EDTA and 1 mM ZnSO4. The assay was technically simple, generated same day results, and used automated enzyme-linked immunosorbent assay instrumentation.. AB - ...
https://augusta.pure.elsevier.com/en/publications/quantitation-of-phospholipase-asub2sub-and-phospholipase-c-activi
Abstract 18200: Sortilin Levels Correlated With Renal Function and Reduced by Strong Statins With Increased PCSK9 in Primary...Abstract 18200: Sortilin Levels Correlated With Renal Function and Reduced by Strong Statins With Increased PCSK9 in Primary...
Sortilin is encoded by the well-known cardiovascular risk gene SORT1, however Sortilin seems to modulate cardiovascular disease not only with lipids, and its function has not been well elucidated. Recent basic reports showed new aspects of Sortilin that it can bind to PCSK9, and also can enhance vascular calcification with non-lipid tissue nonspecific alkaline phosphatase. We investigated the clinical roles of Sortilin in statin-treated primary dyslipidemia.. Methods: A total of 62 patients (Male 33, Age 65±11 yrs) with primary dyslipidemia including 18 genetically confirmed heterozygous familial hypercholesterolemia were included. Non-FH group was treated with 10mg Atorvastatin, and FH group was treated with 20mg Rosuvastatin for 8 weeks. ELISA determined plasma levels of Sortilin and PCSK9 (free-fragment and hetero-dimer).. Results: Strong statins lowered LDL-C (-44% in non-FH, -54% in FH), and increased hetero-dimer PCSK9 (+21% in non-FH, +102% in FH) but not in free-fragment PCSK9. Statins ...
http://circ.ahajournals.org/content/134/Suppl_1/A18200
ALKALINE PHOSPHATASE RESEARCH: Tumor necrosis factor-α increases alkaline phosphatase expression in vascular smooth muscle...ALKALINE PHOSPHATASE RESEARCH: Tumor necrosis factor-α increases alkaline phosphatase expression in vascular smooth muscle...
Vascular calcification is implicated in many diseases including atherosclerosis and diabetes. Tumor necrosis factor-α (TNF-α) has been shown to promote vascular calcification both in vitro and in vivo. However, the molecular mechanism of TNF-α-mediated vascular calcification has not yet been fully defined. Therefore, in this study, we aimed to investigate whether MSX2 acts as a crucial regulator in TNF-α-induced vascular calcification and to define the regulatory mechanism of MSX2 induction in human vascular smooth muscle cells (VSMCs ...
http://alkalinephosphatase.blogspot.com/2010/01/tumor-necrosis-factor-increases.html
The Big C: Summer time, summer time, sum-sum-summer time!The Big C: Summer time, summer time, sum-sum-summer time!
Alkaline Phosphatase, serum Bone-specific alkaline phosphatase (BAP.) When alkaline phosphatase is measured, it is actually the sum of the bone-specific and liver-specific components (isoenzymes.) BAP can indicate excess osteoblastic cell activity which may indicate bone metastases. Metra Systems, Inc., says that Bone Alkaline Phosphatase is an osteoblast membrane-bound molecule which is involved in bone formation. Levels of this enzyme are thought to be indicative of the activity of osteoblasts. Another description of AlkPhos is that it is an enzyme that is found on the surface of osteoblasts(the cells that build bone) and as such is used as a serum marker of increased osteoblast activity. Since bone is being added at prostate cancer bone metastases, an increased alkaline phosphatase can mean increased bone met formation. A recent paper by MR Smith et al in Urology discussed BAP and NTx in their role as predictors of skeletal complications in HRPC patients (MR Smith, et al, Urology 70: 315-319, ...
http://prostatecancerat42.blogspot.com/2009/04/summer-time-summer-time-sum-sum-summer.html
Inhibition of pyrophosphatase activity of mouse duodenal alkaline phosphatase by magnesium ions | Biochemical JournalInhibition of pyrophosphatase activity of mouse duodenal alkaline phosphatase by magnesium ions | Biochemical Journal
Duodenal alkaline phosphatase of juvenile (11-day-old) mice, like other non-specific alkaline phosphatases, has the ability to hydrolyse PPi. When a constant Mg2+/PPi concentration ratio is maintained, plots of velocity as a function of PPi concentration are consistent with Michaelis-Menten kinetics. Mg2+ activates pyrophosphate hydrolysis and maximal activity is obtained at a constant Mg2+/PPi concentration ratio of 0·66. At higher ratios there is strong inhibition. At constant concentrations of Mg2+ and increasing concentrations of PPi, the velocity-substrate (PPi) concentration plots show sigmoidal dependence. By assuming that the true substrate is MgP2O72− complex, and using complexity constants, the concentrations of free Mg2+, Mg2P2O7 and MgP2O72− were calculated in assay mixtures ranging in PPi concentration from 0·1 to 2·5mm and in total Mg2+ concentration from 0·6 to 2·6mm. From these data, the concentrations of added Mg2+ and PPi in the assay mixtures were selected so that the ...
http://www.biochemj.org/content/115/1/29
Gene expression in tooth: references
The effect of a 2 hour exposure to adriamycin (1 mg/litre) on alkaline phosphatase (ALPase) activity of the golden hamster 4-5 day old second maxillary molars (M2) was investigated in vitro. The molars were grown in BGJb medium containing 15% fetal bovine serum, glutamine (200 micrograms/ml), vitamin C (250 micrograms/ml), penicillin G (50 micrograms/ml), and streptomycin sulphate (30 micrograms/ml). The gas phase contained 50% O2 + 5% CO2 + 45% N2. The molars were supported on cellulosic membrane filters and grown for 3, 5, and 7 days at the medium-gas interface in a closed humidified chamber. Biochemical analysis indicated a steady increase in ALPase activity throughout this study in the control samples. However, after adriamycin treatment no increase in ALPase activity could be observed. The histochemical data showed that the increased activity in the control was confined to the peripheral pulp, sub-odontoblastic layer, stratum intermedium, ameloblasts and odontoblasts. Although these layers ...
http://bite-it.helsinki.fi/REF179.HTM
Possible functions of alkaline phosphatase in dental mineraliz...Possible functions of alkaline phosphatase in dental mineraliz...
Possible functions of alkaline phosphatase in dental mineralization: cadmium effects.: In mineralizing dental tissues the non-specific alkaline phosphatase, usi
https://www.mysciencework.com/publication/show/possible-functions-alkaline-phosphatase-dental-mineralization-cadmium-effects-fcd26b63
Bone-specific alkaline phosphatase and bone turnover in African Americ by Lenar Yessayan, Carol Moore et al.Bone-specific alkaline phosphatase and bone turnover in African Americ by Lenar Yessayan, Carol Moore et al.
INTRODUCTION: Noninvasive measures of bone activity include intact parathyroid hormone (iPTH) and bone-specific alkaline phosphatase (BSAP). Whether BSAP measurement alone or in combination with other biochemical data provides more reliable information about bone turnover than iPTH alone in African Americans on hemodialysis is unknown. METHODS: This cross-sectional study aimed to determine the optimal predictor and cutoff points for BSAP, iPTH, calcium and phosphorus in classifying bone biopsy findings. Forty-three African American hemodialysis patients were available for analysis. Biochemical data on the day of biopsy across a spectrum of qualitative histologic bone features were compared. Classification and regression tree analysis was used to determine both the optimal predictor and cutoff points for BSAP, iPTH, calcium and phosphorus in identifying bone turnover status. FINDINGS: Seven subjects had adynamic disease, 31 had mild/moderate hyperparathyroid bone features, and five had severe
https://scholarlycommons.henryford.com/internalmedicine_articles/197/
anti-Intestinal Alkaline Phosphatase antibody (Alkaline Phosphatase, Intestinal)</span...anti-Intestinal Alkaline Phosphatase antibody (Alkaline Phosphatase, Intestinal)</span...
Rabbit Polyclonal Intestinal Alkaline Phosphatase antibody for IHC (p), ELISA, WB. Order anti-Intestinal Alkaline Phosphatase antibody ABIN1731689.
https://www.antibodies-online.com/antibody/1731689/anti-Alkaline+Phosphatase,+Intestinal+ALPI+antibody/
Indenopyridine hydrochloride induced testicular spermatogenesis failure with high seminal alkaline phosphatase levels in male...Indenopyridine hydrochloride induced testicular spermatogenesis failure with high seminal alkaline phosphatase levels in male...
Indenopyridine hydrochloride (IH), an antispermatogenic agent, was tested to determine the testicular pathological changes, seminal spermatozoa concentrations and seminal plasma alkaline phosphatase levels in male dogs. A single oral dosage of 30 mg IH/kg BW induced the dissociation and premature release of germ cells into the lumens of seminiferous tubules. Ring-shaped spermatid nuclei, nuclear pykonosis of spermatocytes and multinucleated cell associations were also observed. Thereafter, the spermatogenic index (SI) significantly decreased one day after IH administration. Moreover, seminal spermatozoa concentrations decreased two weeks after drug treatment; and there was a statistically significant difference in spermatozoa production inhibited by IH compared to the control. Reversible spermatogenesis was noted 7 weeks after IH treatment in male dogs. Meanwhile, seminal plasma alkaline phosphatase levels also significantly increased two weeks after IH treatment. These data confirm that IH ...
https://ir.lib.nchu.edu.tw/handle/11455/68190?mode=full
Liver histopathology and liver and serum alanine aminotransferase and alkaline phosphatase activities in epileptic dogs...Liver histopathology and liver and serum alanine aminotransferase and alkaline phosphatase activities in epileptic dogs...
Phenobarbital (PB) therapy is frequently associated with elevated serum alanine aminotransferase (ALT) and alkaline phosphatase (AP) activities in dogs without clinical signs of liver disease. The goal of this study was to determine if increased serum ALT and AP activities in clinically healthy PB-treated epileptic dogs are due to hepatic enzyme induction or to subclinical liver injury. Liver biopsies were obtained from 12 PB-treated dogs without clinical signs of liver disease but with elevated Show morePhenobarbital (PB) therapy is frequently associated with elevated serum alanine aminotransferase (ALT) and alkaline phosphatase (AP) activities in dogs without clinical signs of liver disease. The goal of this study was to determine if increased serum ALT and AP activities in clinically healthy PB-treated epileptic dogs are due to hepatic enzyme induction or to subclinical liver injury. Liver biopsies were obtained from 12 PB-treated dogs without clinical signs of liver disease but with elevated ...
http://www.islandscholar.ca/islandora/object/ir:ir-batch6-394
Alkaline Phosphatase, Liver/Bone/Kidney Antibody (BGN/03/662) (NB100-66385): Novus BiologicalsAlkaline Phosphatase, Liver/Bone/Kidney Antibody (BGN/03/662) (NB100-66385): Novus Biologicals
Mouse Monoclonal Anti-Alkaline Phosphatase, Liver/Bone/Kidney Antibody (BGN/03/662). Validated: WB, ELISA. Tested Reactivity: Human, Bacteria. 100% Guaranteed.
https://www.novusbio.com/products/alkaline-phosphatase-liver-bone-kidney-antibody-bgn-03-662_nb100-66385
ALPL - WikipediaALPL - Wikipedia
3.0.CO;2-C. PMID 10737975. Khandwala HM, Mumm S, Whyte MP (2007). Low serum alkaline phosphatase activity and pathologic fracture: case report and brief review of hypophosphatasia diagnosed in adulthood. Endocrine Practice. 12 (6): 676-81. doi:10.4158/ep.12.6.676. PMID 17229666. Nye KE, Riley GA, Pinching AJ (1992). The defect seen in the phosphatidylinositol hydrolysis pathway in HIV-infected lymphocytes and lymphoblastoid cells is due to inhibition of the inositol 1,4,5-trisphosphate 1,3,4,5-tetrakisphosphate 5-phosphomonoesterase. Clin. Exp. Immunol. 89 (1): 89-93. doi:10.1111/j.1365-2249.1992.tb06883.x. PMC 1554388 . PMID 1321014. Henthorn PS, Raducha M, Fedde KN, et al. (1992). Different missense mutations at the tissue-nonspecific alkaline phosphatase gene locus in autosomal recessively inherited forms of mild and severe hypophosphatasia. Proc. Natl. Acad. Sci. U.S.A. 89 (20): 9924-8. doi:10.1073/pnas.89.20.9924. PMC 50246 . PMID 1409720. Nishihara Y, Hayashi Y, Adachi T, et al. ...
https://en.wikipedia.org/wiki/ALPL
Hypophosphatasia - WikipediaHypophosphatasia - Wikipedia
Hypophosphatasia (also called deficiency of alkaline phosphatase or phosphoethanolaminuria) is a rare, and sometimes fatal, metabolic bone disease. Clinical symptoms are heterogeneous, ranging from the rapidly fatal, perinatal variant, with profound skeletal hypomineralization and respiratory compromise, to a milder, progressive osteomalacia later in life. Tissue non-specific alkaline phosphatase (TNSALP) deficiency in osteoblasts and chondrocytes impairs bone mineralization, leading to rickets or osteomalacia. The pathognomonic finding is subnormal serum activity of the TNSALP enzyme, which is caused by one of 200 genetic mutations identified to date, in the gene encoding TNSALP. Genetic inheritance is autosomal recessive for the perinatal and infantile forms but either autosomal recessive or autosomal dominant in the milder forms. The prevalence of hypophosphatasia is not known; one study estimated the live birth incidence of severe forms to be 1:100,000. There is a remarkable variety of ...
https://en.wikipedia.org/wiki/Hypophosphatasia
Hypophosphatasia - wikidocHypophosphatasia - wikidoc
Hypophosphatasia is a rare inherited metabolic disease of decreased tissue nonspecific alkaline phosphatase (TNSALP) and defective bone mineralization. Both autosomal recessive and autosomal dominant variants of the disease exist. The disease comes in one of five forms, perinatal, infantile, childhood, adult, and odontohypophosphatasia. Perinatal hypophosphatasia is invariably lethal while infantile hypophosphatasia has a roughly 50% mortality rate with symptoms appearing within the first 6th months after birth. The other forms are generally non-lethal. Common symptoms include bone malformations and higher chance of bone fracture. Both the adult form and odontohypophosphatasial form are marked by premature teeth loss. There is no known cure for hypophosphatasia. However, there have been some claims that choline may have positive health benefits for those with the disease that take it as a dietary supplement. ...
http://wikidoc.org/index.php/Hypophosphatasia
Phosphate-irrepressible Alkaline Phosphatase of Zymomonas mobilis | Microbiology SocietyPhosphate-irrepressible Alkaline Phosphatase of Zymomonas mobilis | Microbiology Society
The phosphate regulation and subcellular location of the hydrolytic enzyme alkaline phosphatase were investigated in the Gram-negative bacterium Zymomonas mobilis. The biosynthesis of alkaline phosphatase was not derepressed at a low phosphate concentration as is generally observed in other micro-organisms, nor was it repressed by high phosphate concentrations in the medium. The enzyme level was rather constant during the growth phases in batch culture, at a value at least 8.4-fold lower than that observed in Escherichia coli. The alkaline phosphatase of Z. mobilis was found associated with the membrane fraction after cell disruption, osmotic shock treatment or spheroplast formation. This is a rather unusual location, since most of the alkaline phosphatases from Gram-negative bacteria have been shown to be periplasmic enzymes. Activity staining on polyacrylamide gels after two-dimensional electrophoresis revealed two isoforms of alkaline phosphatase, each of approximate molecular mass 56 kDa. These two
https://www.microbiologyresearch.org/content/journal/micro/10.1099/00221287-135-2-453
A homozygous missense variant in the alkaline phosphatase gene ALPL is associated with a severe form of canine hypophosphatasia...
TY - JOUR. T1 - A homozygous missense variant in the alkaline phosphatase gene ALPL is associated with a severe form of canine hypophosphatasia. AU - Kyöstilä, Kaisa. AU - Syrjä, Pernilla. AU - Lappalainen, Anu K.. AU - Arumilli, Meharji. AU - Hundi, Sruthi. AU - Karkamo, Veera. AU - Viitmaa, Ranno. AU - Hytönen, Marjo K.. AU - Lohi, Hannes. PY - 2019/1/30. Y1 - 2019/1/30. KW - PYRIDOXINE-RESPONSIVE SEIZURES. KW - INFANTILE HYPOPHOSPHATASIA. KW - MATRIX VESICLES. KW - PERINATAL HYPOPHOSPHATASIA. KW - MUTATION. KW - BONE. KW - VITAMIN-B6. KW - NOSOLOGY. KW - GENOTYPE. KW - PYRIDOXAL-5-PHOSPHATE. KW - 413 Veterinary science. KW - 1184 Genetics, developmental biology, physiology. KW - 3111 Biomedicine. U2 - 10.1038/s41598-018-37801-2. DO - 10.1038/s41598-018-37801-2. M3 - Article. VL - 9. JO - Scientific Reports. JF - Scientific Reports. SN - 2045-2322. M1 - 973. ER - ...
https://researchportal.helsinki.fi/en/publications/a-homozygous-missense-variant-in-the-alkaline-phosphatase-gene-al
A Multicenter, Post-Approval Clinical Study for Asfotase Alfa (Human Recombinant Tissue-nonspecific Alkaline Phosphatase Fusion...A Multicenter, Post-Approval Clinical Study for Asfotase Alfa (Human Recombinant Tissue-nonspecific Alkaline Phosphatase Fusion...
This study will investigated Asfotase Alfa in patients with hypophosphatasia who completed the investigator-initiated clinical study (HPPJEAP-01) protocol for
http://adisinsight.springer.com/trials/700260257?error=cookies_not_supported&code=07e0a39e-61a3-469c-b800-76e4440f4b36
Repositorio da Producao Cientifica e Intelectual da Unicamp: Hypophosphatasia-associated Deficiencies in Mineralization and...Repositorio da Producao Cientifica e Intelectual da Unicamp: Hypophosphatasia-associated Deficiencies in Mineralization and...
Introduction: Mutations in the gene ALPL in hypophosphatasia (HPP) reduce the function of tissue nonspecific alkaline phosphatase, and the resulting increase in pyrophosphate (PPi) contributes to bone and tooth mineralization defects by inhibiting physiologic calcium-phosphate (P-i) precipitation. Although periodontal phenotypes are well documented, pulp/dentin abnormalities have been suggested in the clinical literature although reports are variable and underlying mechanisms remains unclear. in vitro analyses were used to identify mechanisms involved in HPP-associated pulp/dentin phenotypes. Methods: Primary pulp cells cultured from HPP subjects were established to assay alkaline phosphatase (ALP) activity, mineralization, and gene expression compared with cells from healthy controls. Exogenous P-i was provided to the correct P-i/PPi ratio in cell culture. Results: HPP cells exhibited significantly reduced ALP activity (by 50%) and mineral nodule formation (by 60%) compared with the controls. ...
http://repositorio.unicamp.br/jspui/handle/REPOSIP/69080
Thyroiditis and Alkaline Phosphatase | Annals of Internal Medicine | American College of PhysiciansThyroiditis and Alkaline Phosphatase | Annals of Internal Medicine | American College of Physicians
To the editor: In 1960 Vogt (1) called attention to the possible presence of elevated alkaline phosphatase levels in thyroiditis. Since the report of Dalovisio (2) last year, a number of letters confirming their finding have appeared.. We wish to report one case of subacute thyroiditis with serum levels of alkaline phosphatase only minimally raised, but in which the thermoestable fraction was markedly elevated, indicating a hepatobiliary origin.. A 35-year-old woman began to feel nervousness, tremor, occipital headache and pain in the anterior aspect of the neck around 3 March 1979. By 1 month later, she had developed fever (temperature ...
https://annals.org/aim/article-abstract/693372/thyroiditis-alkaline-phosphatase
Index Catalog // Deep Blue Data
Craniosynostosis is the premature fusion of cranial bones. The goal of this study was to determine if delivery of recombinant tissue nonspecific alkaline phosphatase (TNAP) could prevent or diminish the severity of craniosynostosis in a C57BL/6 FGFR2C342Y/+ model of neonatal onset craniosynostosis or a BALB/c FGFR2C342Y/+ model of postnatal onset craniosynostosis. Mice were injected with a lentivirus encoding a mineral targeted form of TNAP immediately after birth. Cranial bone fusion as well as cranial bone volume, mineral content and density were assessed by micro computed tomography. Craniofacial shape was measured with calipers., Alkaline phosphatase, alanine amino transferase (ALT) and aspartate amino transferase (AST) activity levels were measured in serum. Neonatal delivery of TNAP diminished craniosynostosis severity from 94% suture obliteration in vehicle treated mice to 67% suture obliteration in treated mice, p,0.02) and the incidence of malocclusion from 82.4% to 34.7% (p,0.03), with ...
https://deepblue.lib.umich.edu/data/catalog?f%5Bkeyword_sim%5D%5B%5D=FGFR2&locale=en
Human Embryonic Stem Cell Marker Antibody Panel. Contains 25 g each of anti-Alkaline Phosphatase, anti-Nanog, anti-Oct-3/4,...Human Embryonic Stem Cell Marker Antibody Panel. Contains 25 g each of anti-Alkaline Phosphatase, anti-Nanog, anti-Oct-3/4,...
Human Embryonic Stem Cell Marker Antibody Panel. Contains 25 g each of anti-Alkaline Phosphatase, anti-Nanog, anti-Oct-3/4, anti-SSEA-1, and anti-SSEA-4. from R&D Systems,,biological,biology supply,biology supplies,biology product
http://bio-medicine.org/biology-products/Human-Embryonic-Stem-Cell-Marker-Antibody-Panel---Contains-25-g-each-of-anti-Alkaline-Phosphatase--anti-Nanog--anti-Oct-3-4--anti-SSEA-1--and-anti-SSE-3893-1/
Frontiers | Alkaline Phosphatase, an Unconventional Immune Protein | ImmunologyFrontiers | Alkaline Phosphatase, an Unconventional Immune Protein | Immunology
Recent years have seen an increase in the number of studies focusing on alkaline phosphatases (AP), revealing an expanding complexity of function of these enzymes. Of the four human AP proteins, most is known about tissue non-specific AP (TNAP) and intestinal AP (IAP). This review highlights current understanding of TNAP and IAP in relation to human health and disease. TNAP plays a role in multiple processes including bone mineralization, vitamin B6 metabolism and neurogenesis, is the genetic cause of hypophosphatasia, influences inflammation through regulation of purinergic signaling, and has been implicated in Alzheimers disease. IAP regulates fatty acid absorption and has been implicated in the regulation of diet induced obesity and metabolic syndrome. IAP and TNAP can dephosphorylate bacterial derived lipopolysaccharide (LPS), and IAP has been identified as a potential regulator of the composition of the intestinal microbiome, an evolutionarily conserved function. Endogenous and recombinant
https://www.frontiersin.org/articles/10.3389/fimmu.2017.00897/full
Overexpression of tissue-nonspecific alkaline phosphatase increases the expression of neurogenic differentiation markers in the...Overexpression of tissue-nonspecific alkaline phosphatase increases the expression of neurogenic differentiation markers in the...
Sigma-Aldrich offers abstracts and full-text articles by [Stephanie Graser, Birgit Mentrup, Doris Schneider, Ludger Klein-Hitpass, Franz Jakob, Christine Hofmann].
https://www.sigmaaldrich.com/catalog/papers/26032516
Alkaline phosphatase activity on osteoblast: post #1Alkaline phosphatase activity on osteoblast: post #1
Alkaline phosphatase activity on osteoblast - posted in Tissue and Cell Culture: HelloI have cultured human fetal osteoblast (hFOB 1.19) and I need to check for the alkaline phosphatase activity (ALP) for that cells.I use the plant extract as for the treatment for differentiation and proliferation of the osteoblast.I never did ALP test before. Does everybody can help regarding the protocol for ALP assay?I will use ALP kit from RANDOX.Thank you for help.
http://www.protocol-online.org/forums/topic/28727-alkaline-phosphatase-activity-on-osteoblast/
Balloon gastrostomy migration leading to acute pancreatitis | GutBalloon gastrostomy migration leading to acute pancreatitis | Gut
A 57 year old woman with cerebrovascular disease had a 16 Fr Corflo percutaneous endoscopic gastrostomy (Merck Gastroenterology, West Drayton, Middlesex, UK) exchanged for a 20 Fr replacement Corflo balloon gastrostomy (volume 5 ml) as a bridge to eventual insertion of a permanent 20 Fr Corflo-cuBBy button gastrostomy. Four weeks later she presented with a seven day history of abdominal pain and vomiting. Initial investigations revealed a serum alanine transaminase level of 54 IU/l (normal range (NR) 0-35), serum alkaline phosphatase level of 491 IU/l (NR 70-300), serum bilirubin level of … ...
http://gut.bmj.com/content/55/11/1673
A particulate non-specific alkaline phosphatase in Saccharomyces cerevisiaeA particulate non-specific alkaline phosphatase in Saccharomyces cerevisiae
NOTE: This item is not available outside the Texas A&M University network. Texas A&M affiliated users who are off campus can access the item through NetID and password authentication or by using TAMU VPN. Non-affiliated individuals should request a copy through their local librarys interlibrary loan service ...
https://oaktrust.library.tamu.edu/handle/1969.1/ETD-TAMU-1980-THESIS-M681
Hypophosphatasia
Hypophosphatasia is a genetic condition in which the activity of an enzyme called alkaline phosphatase is deficient. This enzyme plays an essential role in mineralization - when minerals such as calcium and phosphorus are deposited in developing bones and teeth. Low activity of this enzyme which characterizes hypophosphatasia also leads to rickets, osteomalacia, or both. The severity of the symptoms of hypophosphatasia varies widely, from fetal loss during pregnancy to cases in which pathologic fractures first present only in adulthood. Hypophosphatasia is caused by a mutation in a gene - called the ALPL gene - that provides instructions for making the alkaline phosphatase enzyme. A cure or proven medical therapy for hypophosphatasia has not yet been found. Treatment is generally directed towards preventing or correcting the symptoms or complications ...
http://www.diseaseinfosearch.org/Hypophosphatasia/3677
Molecular Characterization of Alkaline Phosphatase and PLAP in the Germinal Epithelium of Pb and Se+Zn Treated Adult Sprague...Molecular Characterization of Alkaline Phosphatase and PLAP in the Germinal Epithelium of Pb and Se+Zn Treated Adult Sprague...
Aim: The role of alkaline phosphatase in cell metabolism and regulation is essential and cuts across cell proliferation, division, cell death, membrane transport and DNA cleavage. This study addresses the role and importance of alkaline phosphates (ALP) and Placenta Alkaline phosphatase (PLAP) in the cells of germinal epithelium of male Rat testes following induced lead (Pb) toxicity and rejuvenation by Selenium (Se) and Zinc (Zn) treatment. Method: Adult Sprague-Dawley Rats (males) were divided into 4 groups of 15 animals each and were treated as thus; Group 1: Normal saline and serves as the control, Group 2: 100 mg/Kg BW of Pb only, Group 3: 100 mg/Kg BW of Pb and 2.25 mg/Kg each of Se and Zn and group 4 received 2.25 mg.Kg each of Se and Zn only. The duration of treatment was 56 days following which the animals were sacrificed by the 57th day and testes fixed in Bouins fluid. Result: Pb induced toxicity could be apoptotic involving ROS activation of NO-dependent apoptotic pathway or ...
http://eprints.abuad.edu.ng/882/
PIGO mutations in intractable epilepsy and severe developmental delay with mild elevation of alkaline phosphatase levels -...PIGO mutations in intractable epilepsy and severe developmental delay with mild elevation of alkaline phosphatase levels -...
Aberrations in the glycosylphosphatidylinositol (GPI)-anchor biosynthesis pathway constitute a subclass of congenital disorders of glycosylation, and mutations in seven genes involved in this pathway have been identified. Among them, mutations in PIGV and PIGO, which are involved in the late stages of GPI-anchor synthesis, and PGAP2, which is involved in fatty-acid GPI-anchor remodeling, are all causative for hyperphosphatasia with mental retardation syndrome (HPMRS). Using whole exome sequencing, we identified novel compound heterozygous PIGO mutations (c.389C,A [p.Thr130Asn] and c.1288C,T [p.Gln430*]) in two siblings, one of them having epileptic encephalopathy. GPI-anchored proteins (CD16 and CD24) on blood granulocytes were slightly decreased compared with a control and his mother. Our patients lacked the characteristic features of HPMRS, such as facial dysmorphology (showing only a tented mouth) and hypoplasia of distal phalanges, and had only a mild elevation of serum alkaline phosphatase ...
http://onlinelibrary.wiley.com/doi/10.1111/epi.12508/abstract
NewYork-Presbyterian Queens - Pagets Disease of the Bone
a bone-specific alkaline phosphatase test - a test that involves the alkaline phosphatase levels (an enzyme found throughout the body) in the bone being measured; any condition of bone growth or an increased activity of bone cells, including Pagets disease, will cause alkaline phosphatase levels to rise. ...
http://www.nyhq.org/diw/Content.asp?PageID=DIW007436&More=DIW&language=Chinese
CDX1 - wikidocCDX1 - wikidoc
This gene is a member of the caudal-related homeobox transcription factor family. The encoded DNA-binding protein regulates intestine-specific gene expression and enterocyte differentiation. It has been shown to induce expression of the intestinal alkaline phosphatase gene, and inhibit beta-catenin/T-cell factor transcriptional activity.[2] CDX1 has also been shown to play an important role in embryonic epicardial development. It has been demonstrated that CDX proteins suppress cardiac differentiation in both zebrafish and mouse embryonic stem cells, but the overall mechanism for how this happens is poorly understood.[5] However, CDX1 has been shown to be transiently expressed in the embryonic heart 11.5 days post coitum (dpc). This transient expression is thought to induce epicardial epithelial-to-mesynchemal transition and thus proper cardiovascular formation. It has been shown that low-dose CDX1 induction caused enhanced migration and differentiation of epicardium-derived cells into vascular ...
https://www.wikidoc.org/index.php?title=CDX1&oldid=1420493
Gamma Glutamyl Transferase (GGT)
Elevated GGT is found in all forms of liver disease. Measurement of GGT is used in the diagnosis and treatment of alcoholic cirrhosis, as well as primary and secondary liver tumors. It is more sensitive than alkaline phosphatase, the transaminases, and leucine aminopeptidase in detecting obstructive jaundice, cholangitis, and cholecystitis. Normal levels of GGT are seen in skeletal diseases; thus, GGT in serum can be used to ascertain whether a disease, suggested by elevated alkaline phosphatase, is skeletal or hepatobiliary. ...
http://www.saveonlabs.com/product-p/482.htm
The Treatment of Malignant Tumours of Bone in the Dog by Intra-Arterial Injection or Perfusion of Epodyl (Triethyleneglycol...
As well as regression assessed directly by measuring the circumference of the limb at the point of maximum tumour swelling, radiographic changes in tumour appearance occurred in the St. Bernard and Great Dane. There was resorption of periosteal new bone and a much smoother outline of the affected areas was apparent (Fig. 6). Recurrence was heralded by the proliferation of periosteal new bone. An increase in serum alkaline phosphatase values was present the day after perfusion (Fig. 7). This was not solely a feature of osteosarcomas as an increased amount of the enzyme in the blood also occurred when the limb of a dog bearing a squamous cell carcinoma was perfused. A similar effect was seen when a normal dog and a nephrecto- mised dog were perfused. An increase in serum alkaline phosphatase occurred when an osteosarcoma was treated by radiotherapy. Where therapy resulted in regression of osteosarcoma and radiography showed resorption of new bone values fell below the pre-treatment figure, rising ...
https://sarcoma-ultrasonography.jimdofree.com/generally-articles-and-discussions-about-osteosarcoma-in-dogs/the-treatment-of-malignant-tumours-of-bone-in-the-dog-by-intra-arterial-injection-or-perfusion-of-epodyl-triethyleneglycol-diglycidyl-ether/
Zoledronate or Observation in Maintaining Bone Mineral Density in Patients Who Are Undergoing Surgery to Remove Both Ovaries -...Zoledronate or Observation in Maintaining Bone Mineral Density in Patients Who Are Undergoing Surgery to Remove Both Ovaries -...
PRIMARY OBJECTIVE:. I. Compare the effect of zoledronate vs observation on bone loss associated with surgery (at a minimum, any surgical procedure that results in removal of both ovaries) in patients undergoing excision of both ovaries.. SECONDARY OBJECTIVE:. I. Compare the change in bone mineral density of the bilateral hip in patients treated with these regimens.. TERTIARY OBJECTIVE:. I. Compare the effect of zoledronate vs observation on biochemical markers of bone resorption and bone formation (N-telopeptide and bone specific alkaline phosphatase) during 1 year of treatment.. OUTLINE: This is a randomized, multicenter study. Patients are randomized to 1 of 2 treatment arms.. All patients undergo surgery, with removal of both ovaries, in month 1. All patients are requested to take calcium supplements twice daily and a multivitamin containing vitamin D once daily beginning in month 1 and continuing for up to 18 months.. ARM I: Beginning 60-90 days after surgery, patients receive zoledronate IV ...
https://clinicaltrials.gov/ct2/show/record/NCT00305695
Presence of gamma-glutamyltransferase in the renal microvascular compartmentPresence of gamma-glutamyltransferase in the renal microvascular compartment
The association between the brush border enzyme alkaline phosphatase and gamma-glutamyltransferase was determined by sucrose density gradient analysis of crude kidney homogenates, isolated glomeruli, and isolated microvessels. As previously established there is an overlap of these enzyme activities …
https://pubmed.ncbi.nlm.nih.gov/6117358/?dopt=Abstract
ISO - ISO 11816-1:1997 - Milk and milk products - Determination of alkaline phosphatase activity using a fluorometric method -...ISO - ISO 11816-1:1997 - Milk and milk products - Determination of alkaline phosphatase activity using a fluorometric method -...
Milk and milk products - Determination of alkaline phosphatase activity using a fluorometric method - Part 1: Milk and milk-based drinks
https://committee.iso.org/standard/20095.html?browse=tc
Impact of hypophosphatasia on neonates and infantsImpact of hypophosphatasia on neonates and infants
aData from a noninterventional, retrospective chart review study designed to understand the natural history of 48 patients ≤5 years of age with severe perinatal- and infantile-onset hypophosphatasia. Patients included in the study were those diagnosed with hypophosphatasia based on at least one of the following: serum biomarker levels (below-normal alkaline phosphatase [ALP] and above-normal PLP or PEA), below-normal ALP and radiographic abnormalities, or genetic analysis of the ALPL gene. Additionally, onset of hypophosphatasia must have occurred prior to 6 months of age based on signs that included at least one of the following: respiratory compromise, rachitic chest deformity, and/or vitamin B6-responsive seizures.12. bRadiographs are from different patients with hypophosphatasia.. ...
https://hypophosphatasia.com/hcp/patient-cohorts/neonates-infants
Alkaline Phosphatase assay - Randox Online StoreAlkaline Phosphatase assay - Randox Online Store
SKU: AP3877 Categories: Clinical Chemistry, Clinical Chemistry Analysers, Diagnostic Reagents, RX daytona, RX daytona and RX imola Reagents, RX imola, Veterinary Reagents Method: AMP Format: Lyophilised Size: R1 6x17.5ml, R2 6x3.5ml Assay Range: Measuring range 18.3 to 1117 U/l Working Stability: To expiry at +2 to +8℃ Available Applications: Applications are available for a wide range of instruments Tags: Assay, Clinical Chemistry Reagents, RX daytona, RX imola, Veterinary Reagents ...
https://store.randox.com/product/ap3877/
Blood tests show elevated health risks for Gulf spill cleanup workers | Fuel FixBlood tests show elevated health risks for Gulf spill cleanup workers | Fuel Fix
As blood carries chemicals through the body, it can go through bone marrow, which is the basis for production of blood cells. The liver also filters toxins.. DAndreas study with colleague G. Kesava Reddy documented a wide range of abnormal values for enzymes in the blood of 117 former cleanup workers, compared to a control group of 130 patients not involved in sopping up the spill.. The workers had decreased levels of blood-clotting platelets, as well as lower numbers for blood urea nitrogen and creatinine, which are indicators of kidney health.. The amount of three liver enzymes - alkaline phosphatase, aspartate transaminase and alanine transaminase - in the cleanup workers blood also was higher than the non-exposed patients, a warning sign of liver dysfunction and damage.. DAndrea said various studies show that patients with damaged bone marrow have higher incidence of possible leukemias, lymphoma and myelomas, and that liver damage increases risk of liver, pancreas and gallbladder ...
http://fuelfix.com/blog/2013/09/16/blood-tests-suggest-elevated-health-risk-for-spill-cleanup-workers/
Membrane permeabilization by conjugated oligoelectrolytes accelerates whole-cell catalysis | www.icb.ucsb.eduMembrane permeabilization by conjugated oligoelectrolytes accelerates whole-cell catalysis | www.icb.ucsb.edu
Conjugated oligoelectrolytes (COEs) boost the electrical performance of a wide range of bioelectrochemical systems, yet their mechanism of action remains incompletely understood. One possible mode of action is that COEs permeabilize the cell envelope. We thus examined the effect of tetracationic COE, DSSN+, on the permeability of the inner and outer membrane of Escherichia coli by detecting extracellular activity of normally periplasmic and cytoplasmic enzymes. DSSN+ increases the release of the periplasmic enzyme alkaline phosphatase (ALP) up to 20-fold, but does not significantly change the release of the cytoplasmic enzyme β-galactosidase. Additionally, DSSN+ caused a 2-fold increase in the turnover of a cytoplasmic substrate. These studies present a more complete understanding of the mechanism of action in bioelectrochemical systems and pivot future applications of COEs towards a method for improving whole-cell catalysis.. ...
https://www.icb.ucsb.edu/research/publications/membrane-permeabilization-conjugated-oligoelectrolytes-accelerates-whole-cell
High liver function levels in blood test
high liver function levels in blood test Alpha fetoprotein blood AFP test. Normally the liver serves various important functions in our body including breaking down waste or toxic substance changing nutrient into energy for body function and hormone production. Your liver enzymes may be elevated even if there is no damage to the liver at all. The liver is very active in handling fat. Badly harmed liver can not produce albumin. 60. Liver function test abnormalities are common in patients with EM but were mild most often not associated with symptoms and improved or resolved by 3 weeks after the onset of antibiotic therapy in most patients. The liver is responsible for producing albumin a protein that prevents If one value of the liver profile is elevated alkaline phosphatase AST lactate dehydrogenase or bilirubin common bile duct stones will found in 20 of cases. The Hepatic Profile or Liver Function Tests LFT is a group of blood tests that provide information about the state of your liver. As ...
http://manufacturingonline.rozewebdesign.com/chromecast-dns/high-liver-function-levels-in-blood-test.html
Alkaline Phosphatase quenching reagent, Levamisole Solution | Vector LabsAlkaline Phosphatase quenching reagent, Levamisole Solution | Vector Labs
Tissues can contain endogenous alkaline phosphatase activity that will produce background staining if an alkaline phosphatase detection system and substrate are used.
https://vectorlabs.com/uk/levamisole-solution.html
Native Human Alkaline Phosphatase Placental | Cell SciencesNative Human Alkaline Phosphatase Placental | Cell Sciences
Prices are in US dollars.. These products are for laboratory research purposes only, not for any human or animal diagnostic or therapeutic use.. All site content © 2017 Cell Sciences, Inc.. ...
http://www.cellsciences.com/native-human-alkaline-phosphatase-placental-1
Hypophosphatasia (HPP): Background, Pathophysiology, EpidemiologyHypophosphatasia (HPP): Background, Pathophysiology, Epidemiology
Initially recognized by Rathbun in 1948, hypophosphatasia is a rare inborn error of metabolism caused by mutations in the gene encoding tissue-nonspecific isoenzyme of alkaline phosphatase (TNSALP). TNSALP is a phosphomonoesterase of 507 residues and is anchored at its carboxyl terminus to the plasma membrane by a phosphatidylinositol-glycan ...
https://emedicine.medscape.com/article/945375-overview
Hypophosphatasia Treatment & Management: Medical Care, Surgical Care, ConsultationsHypophosphatasia Treatment & Management: Medical Care, Surgical Care, Consultations
Initially recognized by Rathbun in 1948, hypophosphatasia is a rare inborn error of metabolism caused by mutations in the gene encoding tissue-nonspecific isoenzyme of alkaline phosphatase (TNSALP). TNSALP is a phosphomonoesterase of 507 residues and is anchored at its carboxyl terminus to the plasma membrane by a phosphatidylinositol-glycan ...
https://emedicine.medscape.com/article/945375-treatment
Case Report: An Adult-Onset Stills Disease Mimic - The RheumatologistCase Report: An Adult-Onset Stills Disease Mimic - The Rheumatologist
The arthralgias had started six weeks prior to his new admission. The joint pain had started in his left wrist. It then spread to the knees, ankles, hips and shoulders. The pain did not worsen with activity and was not relieved by rest. The patient reported he had noticed progressive hand swelling. His pain had worsened to the point that walking was unbearable. He reported fever, loss of appetite, nausea and vomiting. He also reported having had one or two extremely watery, mucous-laden stools just prior to his emergency department visit.. On admission, the patient was noted to have numerous laboratory abnormalities: hyponatremia with a sodium level of 130 mEq/L (reference range [RR]: 136-145); hypokalemia with potassium at 3.0 mEq/L (RR: 3.5-5.1); a chloride level of 92 mEq/L (RR: 98-107); hypocalcemia with a level of 7.9 mg/dL (RR: 8.5-10.1); aspartate amino-transferase of 109 units/L (RR: 15-37); alanine aminotransferase of 84 units/L (RR: 12-78); elevated alkaline phosphatase of 158 units/L ...
https://www.the-rheumatologist.org/article/case-report-an-adult-onset-stills-disease-mimic/
Quantitation of Regulatory Activity for the Complement ...Quantitation of Regulatory Activity for the Complement ...
Complement pathways function to identify and remove pathogens and infected cells. There are three complement pathways: the classical, lectin and alternative pathway (AP). While all pathways are activated following pathogen stimuli, the AP is constitutively active and tightly controlled by activators (e.g., Factor B, Factor D) and negative regulators (e.g., Factor H). Complement activity can be measured by well-established methods that are often used in a diagnostic setting to determine the CH50 (50% complement hemolytic activity) or AP50, specifically to measure AP activity. The protocol here has adapted the traditional AP50 method designed to measure AP activity in human sera, to measure the positive or negative AP regulatory activity within a given test sample. The assay relies on the ability of AP components in human serum to lyse rabbit erythrocytes under in vitro conditions specific for the AP with subsequent release of hemoglobin that is quantitated by measurement of optical density. Our method
https://en.bio-protocol.org/e3116
Nitric Oxide Synthase | Profiles RNS
Rentea RM, Lam V, Biesterveld B, Fredrich KM, Callison J, Fish BL, Baker JE, Komorowski R, Gourlay DM, Otterson MF. Radiation-induced changes in intestinal and tissue-nonspecific alkaline phosphatase: implications for recovery after radiation therapy. Am J Surg. 2016 Oct; 212(4):602-608 ...
https://researchers.childrensmercy.org/display/20393
Hepatobiliary Infections, Parasitic | Quick Answers Surgery | AccessSurgery | McGraw-Hill MedicalHepatobiliary Infections, Parasitic | Quick Answers Surgery | AccessSurgery | McGraw-Hill Medical
Leukocytosis. • Elevated alkaline phosphatase. • Elevated transaminases. • Hypoalbuminemia rare for amebic abscess. • Entamoeba histolytica serologic studies (positive in 95% of cases) in amebic abscess. • Hydatid serologic studies (positive in > 80% of cases). • Schistosomal ova in feces. • Eosinophilia in hydatid disease ...
https://accesssurgery.mhmedical.com/content.aspx?bookid=853§ionid=49662124
Enjoypath
86 year-old white female was in good heath. Two days before admission to ER, she had an increased abdominal pain in the left lower quadrant without bowel movement, and she had three times of vomiting with possible blood. On admission, she was found to have severe extensive abdominal pain (10/10) with movement, urinary tract infection, dehydration,hypercalcemia (13.9), elevated alkaline phosphatase (414), and white cell count (32K). One day later, she had decreased air entry bilaterally with minimal atelectasis, acute renal failure with metabolic and respiratory acidosis (Potassium 6.2, pH 7.11, BUN 84, Cr 2.7, AST 960, ALT 428, CK 2441, Myoglobin ,1000). CT scan showed distended small bowel and colon with distal colon obstruction and abdominal aortic atherosclerosis. The patients expired two days later ...
http://www.enjoypath.com/sp/case-0017/case-0017.htm
GFIT result for T01004GFIT result for T01004
sp:PPBT_MOUSE] Alpl, ALP, APTNAP, Akp-2, Akp2, TNAP, TNSALP; alkaline phosphatase, liver/bone/kidney; K01077 alkaline phosphatase [EC:3.1.3.1] ...
http://www.kegg.jp/ssdb-bin/www_ssget?dre:393982
Determinants of membrane protein topology | PNASDeterminants of membrane protein topology | PNAS
The topology of the integral membrane protein MalF, which is required for maltose transport in Escherichia coli, has been analyzed using fusions of alkaline phosphatase (EC 3.1.3.1). The properties of such fusion strains support a MalF structure previously proposed on theoretical grounds. Several transmembrane segments within MalF can act as signal sequences in exporting alkaline phosphatase. Other transmembrane sequences, in conjunction with cytoplasmic domains, can stably anchor alkaline phosphatase in the cytoplasm. Our results suggest that features of the amino acid sequence (possibly the positively charged amino acids) of the cytoplasmic domains of membrane proteins are important in anchoring these domains in the cytoplasm. These studies in conjunction with our earlier results show that alkaline phosphatase fusions to membrane proteins can be an important aid in analyzing membrane topology and its determinants.. ...
https://www.pnas.org/content/84/23/8525?ijkey=dde27ba39d07eedee81e8c1baef393b844c9b459&keytype2=tf_ipsecsha
alkaline phosphatase - Digestive Disorders / Gastroenterology - MedHelpalkaline phosphatase - Digestive Disorders / Gastroenterology - MedHelp
I received blookwork results that showed that my alkaline phosphatase level is 153, my doctor said that high normal is 136. All other bloodwork and enzymes are fine. I am being sent for a gall bladde...
https://www.medhelp.org/posts/Digestive-Disorders---Gastroenterology/alkaline-phosphatase/show/234502
December | 2019 | pkc inhibitors
BL21/pES2KI pellets were subjected to ammonium sulfate precipitation (30-40%), resuspended in buffer A (30 mM NaCl and 20 mM Tris-Cl, pH 8.0), and applied to a Fractogel column (Merck, USA). The fraction. was eluted by a NaCl gradient (30 mM-1.4 M). After purification through a P-100 size-exclusion column (BioRad, USA), the CaroS2K fractions were CB-5083 pooled and concentrated using an Amicon centriprep-50 column (Millipore, USA) and dissolved in buffer A. BL21/pES2I pellets were precipitated by ammonium sulfate (70-100%) and resuspended in buffer A. CaroS2I purification involved a similar chromatographic procedure using the Amicon centriprep-3 column (Millipore, USA). The concentration of protein was determined by the Bradford assay (Amresco, USA). In vitro determination of Carocin S2 activity Total RNA was treated with calf intestinal alkaline phosphatase (Promega, USA) at 55°C for 30 min as recommended by the manufacturer. The reaction was arrested by adding 5 mM nitrilotriacetic acid, and ...
https://pkc-inhibitors.com/2019/12
A comparative study of digoxigenin, 2,4-dinitrophenyl, and alkaline phosphatase as deoxyoligonucleotide labels in non...A comparative study of digoxigenin, 2,4-dinitrophenyl, and alkaline phosphatase as deoxyoligonucleotide labels in non...
AIM: To determine the optimum form of labelling and the most efficient reporter molecule for non-radioisotopic in situ hybridisation (ISH). METHODS: Nine deoxyoligonucleotides complementary to histone mRNA were synthesised and labelled either enzymatically or during solid-phase synthesis with the reporter molecules digoxigenin, 2,4-dinitrophenyl (DNP), or alkaline phosphatase. Pooled deoxyoligonucleotide cocktails were then used in non-radioisotopic ISH detection of histone mRNA in human tonsil. Hybrid detection was by nitroblue tetrazoleum/5-bromo-4-chloro-3-indolyl phosphate colorimetric development. RESULTS: The use of a spacer in 3 enzymatic labelling and when labelling with alkaline phosphatase significantly increased ISH signal. The 3 and 5 labelling of oligonucleotides with triple DNP groups during solid-phase synthesis produced the strongest signal as determined by the highest cell signal intensity and shortest development time. CONCLUSIONS: 3 and 5 solid-phase labelling with triple ...
http://jcp.bmj.com/content/50/8/686
Alkaline phosphataseAlkaline phosphatase
High alkaline phosphatase levels can occur if the bile ducts are obstructed. Also, the level of alkaline phosphatase increases ... Common alkaline phosphatases used in research include: Shrimp alkaline phosphatase (SAP), from a species of Arctic shrimp ( ... Human-intestinal alkaline phosphatase. The human body has multiple types of alkaline phosphatase present, which are determined ... Calf-intestinal alkaline phosphatase (CIP) Placental alkaline phosphatase (PLAP) and its C terminally truncated version that ...
https://en.wikipedia.org/wiki/Alkaline_phosphatase
Elevated alkaline phosphataseElevated alkaline phosphatase
... occurs when levels of alkaline phosphatase (ALP) exceed the reference range. This group of ... The major function of alkaline phosphatase is transporting chemicals across cell membranes. Alkaline phosphatases are present ... which are distinct forms of alkaline phosphatase generated by these tumors, can raise the total volume of alkaline phosphatase ... possibly an alternative cause for elevated serum alkaline phosphatase. Chronic kidney disease Elevated alkaline phosphatase in ...
https://en.wikipedia.org/wiki/Elevated_alkaline_phosphatase
Placental alkaline phosphatasePlacental alkaline phosphatase
Alkaline phosphatase, placental type also known as placental alkaline phosphatase (PLAP) is an allosteric enzyme that in humans ... for this form of alkaline phosphatase have been well-characterized. Alkaline phosphatase, placental type is a membrane-bound ... "Entrez Gene: ALPP alkaline phosphatase, placental (Regan isozyme)". "European Group on Tumor Markers. A European Based Expert ... Le Du MH, Stigbrand T, Taussig MJ, Menez A, Stura EA (2001). "Crystal structure of alkaline phosphatase from human placenta at ...
https://en.wikipedia.org/wiki/Placental_alkaline_phosphatase
Calf-intestinal alkaline phosphataseCalf-intestinal alkaline phosphatase
... (CIAP/CIP) is a type of alkaline phosphatase that catalyzes the removal of phosphate ...
https://en.wikipedia.org/wiki/Calf-intestinal_alkaline_phosphatase
LevamisoleLevamisole
... alkaline phosphatase activity in biomedical assays involving detection signal amplification by intestinal alkaline phosphatase ... Van Belle H (July 1976). "Alkaline phosphatase. I. Kinetics and inhibition by levamisole of purified isoenzymes from humans". ... Levamisole reversibly and noncompetitively inhibits most isoforms of alkaline phosphatase (e.g., human liver, bone, kidney, and ... Phosphatase inhibitors, World Health Organization essential medicines, Wikipedia medicine articles ready to translate). ...
https://en.wikipedia.org/wiki/Levamisole
Liver function testsLiver function tests
"Clinical Utilization of Alkaline Phosphatase Measurements". Alkaline Phosphatase. Springer US. pp. 525-786. doi:10.1007/978-1- ... Alkaline phosphatase (ALP) is an enzyme in the cells lining the biliary ducts of the liver. It can also be found on the mucosal ... gamma-glutamyl transferase and alkaline phosphatase). Because some of these tests do not measure function, it is more accurate ...
https://en.wikipedia.org/wiki/Liver_function_tests
Laundry wastewaterLaundry wastewater
doi:10.2134/jeq1998.00472425002700020004x McComb, R. B.; Bowers, G. N.; Posen, S. (1979). Alkaline phosphatase. New York: ...
https://en.wikipedia.org/wiki/Laundry_wastewater
Thomas Walter WarnesThomas Walter Warnes
the first trial of colchicine in PBC); Alkaline phosphatase isoenzymes; Hepatitis B & C; Tumour markers of primary liver cancer ... The development of new techniques to separate and identify Alkaline phosphatase (ALP) isoenzymes in blood and duodenal juice; 2 ...
https://en.wikipedia.org/wiki/Thomas_Walter_Warnes
Epigenetics in stem-cell differentiationEpigenetics in stem-cell differentiation
1979) found that there are at least three varieties of alkaline phosphatases, kidney, liver, and bone alkaline phosphatases, ... The alkaline phosphatase varieties, therefore, express a unique complement of in the enzymatic processes in post-translational ... Alkaline phosphatase activity correlates with the morphology changes. Initial deacetylation of histone is required for ... In normal stem cells, the activity of alkaline phosphatase activity is lowered upon differentiation. Trichostatin A causes the ...
https://en.wikipedia.org/wiki/Epigenetics_in_stem-cell_differentiation
ALPPL2ALPPL2
Alkaline phosphatase, placental-like 2 is a protein that in humans is encoded by the ALPPL2 gene. There are at least four ... "Entrez Gene: Alkaline phosphatase, placental-like 2". Human ALPPL2 genome location and ALPPL2 gene details page in the UCSC ... Shen LP, Liu H, Kan YW, Kam W (June 1988). "5' nucleotide sequence of a putative human placental alkaline phosphatase-like gene ... Ben-Arie A, Hagay Z, Ben-Hur H, Open M, Dgani R (September 1999). "Elevated serum alkaline phosphatase may enable early ...
https://en.wikipedia.org/wiki/ALPPL2
Asfotase alfaAsfotase alfa
The enzyme tissue non-specific alkaline phosphatase (ALP) plays a key role in creating and maintaining healthy bones, and ... Hypophosphatasia is caused by a genetic defect of tissue-nonspecific alkaline phosphatase (TNSALP), an enzyme that plays a role ... Asfotase alfa interferes with alkaline phosphatase measurements. As asfotase alfa is a glycoprotein (as opposed to a small ...
https://en.wikipedia.org/wiki/Asfotase_alfa
Megavitamin-B6 syndromeMegavitamin-B6 syndrome
Alkaline phosphatase acts in vitamin B6 metabolism". Journal of Clinical Investigation. 76 (2): 752-756. doi:10.1172/JCI112031 ...
https://en.wikipedia.org/wiki/Megavitamin-B6_syndrome
HypophosphatasiaHypophosphatasia
"The Tissue Nonspecific Alkaline Phosphatase Gene Mutations Database". About 80% of the mutations are missense mutations. The ... Tissue non-specific alkaline phosphatase (TNSALP) deficiency in osteoblasts and chondrocytes impairs bone mineralization, ... Alkaline phosphatase Choline Rogers K, Chauhan Y (2013-09-30). "Hypophosphatasia". Encyclopedia Britannica. Retrieved 2021-08- ... Whyte MP, Walkenhorst DA, Fedde KN, Henthorn PS, Hill CS (June 1996). "Hypophosphatasia: levels of bone alkaline phosphatase ...
https://en.wikipedia.org/wiki/Hypophosphatasia
5-Bromo-4-chloro-3-indolyl phosphate5-Bromo-4-chloro-3-indolyl phosphate
Alkaline phosphatase is commonly conjugated to secondary antibodies. "5-Bromo-4-chloro-3-indolyl phosphate disodium salt". ... Alkaline phosphatase hydrolyses BCIP to 5-bromo-4-chloro-3-indoxyl. ... is an artificial chromogenic substrate used for the sensitive colorimetric detection of alkaline phosphatase activity. It is, ...
https://en.wikipedia.org/wiki/5-Bromo-4-chloro-3-indolyl_phosphate
Uncompetitive inhibitionUncompetitive inhibition
Human alkaline phosphatases such as CGAP have been found to be over-expressed in certain types of cancers, and those ... It has also been found that a number of the genes that code for human alkaline phosphatases (TSAPs) are inhibited ... Studies of the involved amino acid residues have been undertaken in attempts to regulate alkaline phosphatase activity and ... Millán JL, Fishman WH (1995). "Biology of human alkaline phosphatases with special reference to cancer". Critical Reviews in ...
https://en.wikipedia.org/wiki/Uncompetitive_inhibition
LipopolysaccharideLipopolysaccharide
Alkaline phosphatase prevents intestinal inflammation (and "leaky gut") from bacteria by dephosphorylating the Lipid A portion ... Dephosphorylation of LPS by intestinal alkaline phosphatase can reduce the severity of Salmonella tryphimurium and ... Bates JM, Akerlund J, Mittge E, Guillemin K (2007). "Intestinal alkaline phosphatase detoxifies lipopolysaccharide and prevents ... Lallès JP (February 2014). "Intestinal alkaline phosphatase: novel functions and protective effects". Nutrition Reviews. 72 (2 ...
https://en.wikipedia.org/wiki/Lipopolysaccharide
Harry Harris (geneticist)Harry Harris (geneticist)
Moak, G; Harris, H (1979). "Lack of homology between dog and human placental alkaline phosphatases". Proceedings of the ... Goldstein, DJ; Rogers, CE; Harris, H (1980). "Expression of alkaline phosphatase loci in mammalian tissues". Proceedings of the ...
https://en.wikipedia.org/wiki/Harry_Harris_(geneticist)
CirrhosisCirrhosis
Alkaline phosphatase - slightly elevated but less than 2-3 times the upper limit of normal.[citation needed] Gamma-glutamyl ... Rises in alkaline phosphatase, cholesterol, and bilirubin levels occur. Patients are usually positive for anti-mitochondrial ...
https://en.wikipedia.org/wiki/Cirrhosis
IsozymeIsozyme
Each isoenzymes is a dimer of 2 subunits M (muscle), B (brain) or both 3.) Isoenzymes of alkaline phosphatase: Six isoenzymes ...
https://en.wikipedia.org/wiki/Isozyme
Southwestern blotSouthwestern blot
"Repeated probing of Southwestern blots using alkaline phosphatase stripping". Journal of Chromatography A. 1217 (45): 7177-7181 ...
https://en.wikipedia.org/wiki/Southwestern_blot
Vibrio natriegensVibrio natriegens
Woolkalis MJ, Baumann P (July 1981). "Evolution of alkaline phosphatase in marine species of Vibrio". J. Bacteriol. 147 (1): 36 ...
https://en.wikipedia.org/wiki/Vibrio_natriegens
Phospholipase A-2-activating proteinPhospholipase A-2-activating protein
"Function assignment to conserved residues in mammalian alkaline phosphatases". J. Biol. Chem. 277 (25): 22992-9. doi:10.1074/ ...
https://en.wikipedia.org/wiki/Phospholipase_A-2-activating_protein
Vaccenic acidVaccenic acid
Alkaline phosphatase inhibited 25% by vaccenic acid in osteoblasts. Oxidation of omega-7 unsaturated fatty acids on the skin ...
https://en.wikipedia.org/wiki/Vaccenic_acid
ALPIALPI
Alkaline phosphatase, intestinal also known as ALPI is a type of alkaline phosphatase that in humans is encoded by the ALPI ... "Nucleotide and amino acid sequences of human intestinal alkaline phosphatase: close homology to placental alkaline phosphatase ... 2008). "Intestinal alkaline phosphatase is a gut mucosal defense factor maintained by enteral nutrition". Proc. Natl. Acad. Sci ... 2003). "Intestinal alkaline phosphatase release is not associated with chylomicron formation". Am. J. Physiol. Gastrointest. ...
https://en.wikipedia.org/wiki/ALPI
Autoimmune hepatitisAutoimmune hepatitis
Of note, alkaline phosphatase and bilirubin are usually normal. Autoimmune hepatitis may overlap with other autoimmune ...
https://en.wikipedia.org/wiki/Autoimmune_hepatitis
SphingomonasSphingomonas
strain BSAR-1 expressing a high activity alkaline phosphatase (PhoK) has also been applied for bioprecipitation of uranium from ... "Cloning and Overexpression of Alkaline Phosphatase PhoK from Sphingomonas sp. Strain BSAR-1 for Bioprecipitation of Uranium ... This is the first report of bioprecipitation of uranium under alkaline conditions. Wine, developed through the alcoholic ... from Alkaline Solutions" (PDF). Applied and Environmental Microbiology. 74 (17): 5516-5523. Bibcode:2008ApEnM..74.5516N. doi: ...
https://en.wikipedia.org/wiki/Sphingomonas
SeminomaSeminoma
Blood tests may detect the presence of placental alkaline phosphatase (ALP, ALKP, ALPase, Alk Phos) in fifty percent of cases. ... "Is placental alkaline phosphatase (PLAP) a useful marker for seminoma?". European Journal of Cancer and Clinical Oncology. 26 ( ...
https://en.wikipedia.org/wiki/Seminoma
Oxidative foldingOxidative folding
Another example is alkaline phosphatase, which contains two essential disulfides. It was used as an indicator protein to screen ...
https://en.wikipedia.org/wiki/Oxidative_folding
UraniumUranium
strain BSAR-1 has been found to express a high activity alkaline phosphatase (PhoK) that has been applied for bioprecipitation ... Nilgiriwala, K.S.; Alahari, A.; Rao, A. S. & Apte, S.K. (2008). "Cloning and Overexpression of Alkaline Phosphatase PhoK from ... In nature, uranium(VI) forms highly soluble carbonate complexes at alkaline pH. This leads to an increase in mobility and ... However, it is difficult to precipitate uranium as phosphate in the presence of excess carbonate at alkaline pH. A Sphingomonas ...
https://en.wikipedia.org/wiki/Uranium
Daniel HerschlagDaniel Herschlag
Zalatan, Jesse G.; Herschlag, Daniel (2006). "Alkaline Phosphatase Mono- and Diesterase Reactions: Comparative Transition State ...
https://en.wikipedia.org/wiki/Daniel_Herschlag
MetabolismMetabolism
July 2005). "Diel variations in carbon metabolism by green nonsulfur-like bacteria in alkaline siliceous hot spring microbial ... Insulin causes glycogen synthesis by activating protein phosphatases and producing a decrease in the phosphorylation of these ... emerging roles of the glycogen targeting subunits of protein phosphatase-1" (PDF). Diabetes. 49 (12): 1967-77. doi:10.2337/ ...
https://en.wikipedia.org/wiki/Metabolism
Zinc deficiencyZinc deficiency
... could be also associated with low alkaline phosphatase since it acts a cofactor for this enzyme.[citation ...
https://en.wikipedia.org/wiki/Zinc_deficiency
Polyestriol phosphatePolyestriol phosphate
... where the estrogen is steadily released by splitting off of the phosphate portion due to the action of alkaline phosphatase ... 30 (4): ix-x. Andersson M, Müntzing J (1971). "Effects of oestrogen on phosphatase activity in the ventral prostate of intact, ...
https://en.wikipedia.org/wiki/Polyestriol_phosphate
Glucocorticoid receptorGlucocorticoid receptor
"Glucocorticoid regulation of alkaline phosphatase, osteocalcin, and proto-oncogenes in normal human osteoblast-like cells". ...
https://en.wikipedia.org/wiki/Glucocorticoid_receptor
Prostate cancerProstate cancer
Alkaline phosphatase is more elevated in metastatic than non-metastatic cells. High levels of alkaline phosphatase is ... January 2017). "Tumour-derived alkaline phosphatase regulates tumour growth, epithelial plasticity and disease-free survival in ... The most important of these might be the tyrosine phosphatase ACP1 of which the expression might outperform the Gleason grading ... April 2016). "Low-Molecular-Weight Protein Tyrosine Phosphatase Predicts Prostate Cancer Outcome by Increasing the Metastatic ...
https://en.wikipedia.org/wiki/Prostate_cancer
Liver support systemLiver support system
Biomarker measurements showed a significantly reduced level of bilirubin and alkaline phosphatase in ELAD patients, though ...
https://en.wikipedia.org/wiki/Liver_support_system
Aureoumbra lagunensisAureoumbra lagunensis
... alkaline phosphatase, to dephosphorylate DOP compounds to alleviate the low phosphate bioavailability. High alkaline ... and Nitrogen-Limiting Conditions and of Its Phosphate Limitation-Specific Protein with Alkaline Phosphatase Activity". Appl. ... phosphatase activity accompanied with very low dissolved inorganic phosphorus concentration were measured in the A. lagunensis ...
https://en.wikipedia.org/wiki/Aureoumbra_lagunensis
Aldolase AAldolase A
... alkaline phosphatase and aldolase isozymes in tissue sections". Histochemistry. 48 (2): 101-9. doi:10.1007/BF00494548. PMID ...
https://en.wikipedia.org/wiki/Aldolase_A
Maud MentenMaud Menten
1944). "Distribution of alkaline phosphatase in kidney following the use of histochemical azo dye test". Proceedings of the ... As part of extensive work on alkaline phosphatase, Menten invented the azo-dye coupling reaction, which is still used in ... 1944). "A coupling histochemical azo dye test for alkaline phosphatase in the kidney". Journal of Biological Chemistry. 153 (2 ... Menten, ML.; Janouch, M. (1946). "Changes in alkaline phosphatase of kidney following renal damage with alloxan". Proceedings ...
https://en.wikipedia.org/wiki/Maud_Menten
1987 in science1987 in science
... responsible for alkaline phosphatase isozyme conversion in Escherichia coli, and identification of the gene product". Journal ...
https://en.wikipedia.org/wiki/1987_in_science
Lipid signalingLipid signaling
These include enzymes called ceramide-activated Ser-Thr phosphatases (CAPPs), such as protein phosphatase 1 and 2A (PP1 and ... 2006). "Golgi alkaline ceramidase regulates cell proliferation and survival by controlling levels of sphingosine and S1P". ... Studies show that knockdown of key enzymes such as S1P lyase and S1P phosphatase increased prostaglandin production, parallel ... 2003). "Role of human sphingosine-1-phosphate phosphatase 1 in the regulation of intra- and extracellular sphingosine-1- ...
https://en.wikipedia.org/wiki/Lipid_signaling
Hys lawHy's law
... defined as serum alkaline phosphatase activity less than 2× the upper limit of normal). No other reason can be found to explain ...
https://en.wikipedia.org/wiki/Hy's_law
CholestasisCholestasis
Another study of 48 patients with PBC found a combination of bezafibrate and UDCA showed a decrease of alkaline phosphatase in ... Typically, patients have conjugated hyperbilirubinemia and alkaline phosphatase (ALP) elevation but not to extreme levels. ... against PDC-E2 and elevated alkaline phosphatase persisting for 6+ months. Ursodeoxycholic acid (UDCA) is an FDA-approved first ... is characterized by severe pruritus and elevated serum levels of bile acids as well as transaminases and alkaline phosphatase. ...
https://en.wikipedia.org/wiki/Cholestasis
PrimidonePrimidone
It can also cause elevations in hepatic enzymes such as gamma-glutamyl transferase and alkaline phosphatase. Less than 1% of ...
https://en.wikipedia.org/wiki/Primidone
Italian crested newtItalian crested newt
Ion transport processes and alkaline phosphatase activity in the skin of the crested newt. Bolletino di Zoologia. 62(2): 137- ...
https://en.wikipedia.org/wiki/Italian_crested_newt
SAP (disambiguation)SAP (disambiguation)
... the serum form of a human protein that forms amyloids Shrimp alkaline phosphatase, an enzyme used in research SLAM-associated ...
https://en.wikipedia.org/wiki/SAP_(disambiguation)
RuBisCORuBisCO
Formation of the carbamate is favored by an alkaline pH. The pH and the concentration of magnesium ions in the fluid ... it is rapidly converted to a non-inhibitory form by a light-activated CA1P-phosphatase. Even without these strong inhibitors, ...
https://en.wikipedia.org/wiki/RuBisCO
TrehalaseTrehalase
Dephosphorylation of the purified phosphorylated enzyme by alkaline phosphatase caused an almost complete inactivation of the ...
https://en.wikipedia.org/wiki/Trehalase
NeutrophiliaNeutrophilia
The leukocyte alkaline phosphatase (LAP) score, which refers to the amount of alkaline phosphatase per neutrophil, will ...
https://en.wikipedia.org/wiki/Neutrophilia
Bodansky unitBodansky unit
Other units that were used in the past as a measure of blood alkaline phosphatase levels are King-Armstrong units, Kind-King ... It is defined as the quantity of alkaline phosphatase that liberates 1mg of phosphate ion during the first hour of incubation ... This technique was the first test to measure blood alkaline phosphatase levels, and was developed by Aaron Bodansky in the ... The Bodansky unit is an obsolete measure of alkaline phosphatase concentration in blood. ...
https://en.wikipedia.org/wiki/Bodansky_unit
Group 5 elementGroup 5 element
Seargeant, Lorne E.; Stinson, Robert A. (1979). "Inhibition of human alkaline phosphatases by vanadate". Biochemical Journal. ... In alkaline solutions, species with 2, 3 and 4 peroxide groups are known; the last forms violet salts with the formula M3V(O2)4 ...
https://en.wikipedia.org/wiki/Group_5_element
Amorphous calcium phosphateAmorphous calcium phosphate
Moreover, it can increase alkaline phosphatase activities of mesoblasts, enhance cell proliferation and promote cell adhesion. ...
https://en.wikipedia.org/wiki/Amorphous_calcium_phosphate
ProstateProstate
They are generally composed of simple sugars and are often slightly alkaline. Because the Skene's gland and the male prostate ... Kong, HY; Byun, J (January 2013). "Emerging roles of human prostatic Acid phosphatase". Biomolecules & Therapeutics. 21 (1): 10 ... This prostatic fluid is slightly alkaline, milky or white in appearance. The alkalinity of semen helps neutralize the acidity ... The secretions of the prostate include proteolytic enzymes, prostatic acid phosphatase, fibrinolysin, zinc, and prostate- ...
https://en.wikipedia.org/wiki/Prostate
LysobacterLysobacter
Nucleotide sequence and characterization of the gene for secreted alkaline phosphatase from Lysobacter enzymogenes. J Bacteriol ... Comparison of the phosphatases of Lysobacter enzymogenes with those of related bacteria. J Gen Microbiol 133:3121-7. Wright, D ... Production of two phosphatases by Lysobacter enzymogenes and purification and characterization of the extracellular enzyme. ...
https://en.wikipedia.org/wiki/Lysobacter
Acute fatty liver of pregnancyAcute fatty liver of pregnancy
Alkaline phosphatase is often elevated in pregnancy due to production from the placenta, but may be additionally elevated. ...
https://en.wikipedia.org/wiki/Acute_fatty_liver_of_pregnancy
Estrogen insensitivity syndromeEstrogen insensitivity syndrome
Osteocalcin and bone-specific alkaline phosphatase levels were both substantially elevated (18.7-21.6 ng/mL and 33.3-35.9 ng/mL ...
https://en.wikipedia.org/wiki/Estrogen_insensitivity_syndrome
Alanine transaminaseAlanine transaminase
... elevated ALT levels due to hepatocyte damage can be distinguished from bile duct problems by measuring alkaline phosphatase. ...
https://en.wikipedia.org/wiki/Alanine_transaminase
Alkaline Phosphatase: MedlinePlus Medical TestAlkaline Phosphatase: MedlinePlus Medical Test
An alkaline phosphatase (ALP) test measures the amount of ALP in the blood. It is commonly used to diagnose liver damage or ... What is an Alkaline Phosphatase Test?. An alkaline phosphatase (ALP) test measures the amount of ALP in your blood. ALP is an ... Why do I need an alkaline phosphatase test?. Your health care provider may order an alkaline phosphatase test as part of a ... What happens during an alkaline phosphatase test?. An alkaline phosphatase test is a type of blood test. During the test, a ...
https://medlineplus.gov/lab-tests/alkaline-phosphatase/
alkaline phosphatase - Healthy.netalkaline phosphatase - Healthy.net
Posts about alkaline phosphatase written by What Doctors Dont Tell You ...
https://healthy.net/tag/alkaline-phosphatase/
Alkaline phosphatase (ALP) - photometric | Animal Health LaboratoryAlkaline phosphatase (ALP) - photometric | Animal Health Laboratory
In the Users Guide - See Clinical Pathology section - Guide to interpretation of AHL biochemistry profiles* - Alkaline ...
https://www.uoguelph.ca/ahl/services/alkaline-phosphatase-alp-photometric
RCSB PDB - 1ELX: E. COLI ALKALINE PHOSPHATASE MUTANT (S102A)RCSB PDB - 1ELX: E. COLI ALKALINE PHOSPHATASE MUTANT (S102A)
ALKALINE PHOSPHATASE. A, B. 449. Escherichia coli. Mutation(s): 1 Gene Names: phoA. EC: 3.1.3.1. ... Reaction Mechanism of Alkaline Phosphatase Based on Crystal Structures. Two-Metal Ion Catalysis. Kim, E.E., Wyckoff, H.W. ... Escherichia coli alkaline phosphatase (EC 3.1.3.1) is a non-specific phosphomonoesterase that catalyzes the hydrolysis reaction ... Escherichia coli alkaline phosphatase (EC 3.1.3.1) is a non-specific phosphomonoesterase that catalyzes the hydrolysis reaction ...
https://www.rcsb.org/structure/1ELX
Colorimetric Alkaline Phosphatase and Peroxidase Substrate Detection SystemsColorimetric Alkaline Phosphatase and Peroxidase Substrate Detection Systems
... is used with the alkaline phosphatase substrate 5-Bromo- 4-Chloro-3-Indolyl Phosphate (BCIP) in western blotting and ... Substrates for Alkaline Phosphatase. Nitroblue Tetrazolium (NBT) is used with the alkaline phosphatase substrate 5-Bromo- 4- ... pNPP substrates develop the yellow end-product, p-nitrophenol, when hydrolyzed by alkaline phosphatase. Since this system forms ... These products are supplied as ready-to-use buffered alkaline phosphatase substrate solutions containing p-NPP. The soluble ...
https://www.sigmaaldrich.com/CA/en/technical-documents/technical-article/protein-biology/immunohistochemistry/colorimetric-alkaline
HRP & Alkaline Phosphatase - Jackson ImmunoResearchHRP & Alkaline Phosphatase - Jackson ImmunoResearch
Alkaline Phosphatase. Alkaline phosphatase (from calf intestine) conjugates are prepared by a method modified from Avremeas et ... Alkaline Phosphatase-conjugated Streptavidin. 016-050-084. Horseradish Peroxidase (HRP). Horseradish peroxidase crystal ... The alkaline phosphatase homodimer from the 2 Å crystal structure PDB 1ALK showing phosphate, zinc and magnesium ions. The ... Although alkaline phosphatase conjugates are sometimes used for immunohistochemistry, penetration into tissues may be limited ...
https://www.jacksonimmuno.com/technical/products/conjugate-selection/enzymes
TSAP Thermosensitive Alkaline Phosphatase Activity in NEB Restriction Enzyme BuffersTSAP Thermosensitive Alkaline Phosphatase Activity in NEB Restriction Enzyme Buffers
TSAP Thermosensitive Alkaline Phosphatase is active in all Promega restriction enzyme buffers, making it an ideal choice for ... TSAP thermosensitive alkaline phosphatase is a robust phosphatase that can efficiently dephosphorylate all 5´ termini from DNA ... TSAP Thermosensitive Alkaline Phosphatase is active in all Promega restriction enzyme buffers, making it an ideal choice for ... TSAP Thermosensitive Alkaline Phosphatase (Cat.# M9910) is effectively and irreversibly inactivated by heating at 74°C for 15 ...
https://www.promega.com/resources/pubhub/enotes/tsap-thermosensitive-alkaline-phosphatase-activity-in-neb-buffers/
alkaline phosphatase Archives - ISCDalkaline phosphatase Archives - ISCD
2022 International Society for Clinical Densitometry, Inc. Disclaimer Privacy Policy ...
https://iscd.org/tag/alkaline-phosphatase/
NHANES 2001-2002: C-Reactive protein (CRP), Fibrinogen, Bone Alkaline Phosphatase & Urinary N-telopeptides Data...
Bone alkaline phosphatase There were two methods used to measure Bone Alkaline Phosphatase in NHANES 2001-2002. For NHANES 2001 ... Bone alkaline phosphatase and N-telopeptides Evaluation of bone mineral status can utilize measures of total bone mineral ... LBDBAP - Bone alkaline phosphotase (ug/L). Variable Name: LBDBAP. SAS Label: Bone alkaline phosphotase (ug/L). English Text: ... Serum bone alkaline phosphatase is a marker of bone formation and urinary N-telopeptides are markers of bone resorption. ...
https://wwwn.cdc.gov/Nchs/Nhanes/2001-2002/L11_B.htm
SCOP 1.71: Fold c.76: Alkaline phosphatase-likeSCOP 1.71: Fold c.76: Alkaline phosphatase-like
Alkaline phosphatase-like. Timeline for Fold c.76: Alkaline phosphatase-like: *Fold c.76: Alkaline phosphatase-like first ... Fold c.76: Alkaline phosphatase-like appears in SCOP 1.69. *Fold c.76: Alkaline phosphatase-like appears in SCOP 1.73. *Fold c. ... Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily). core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order ... Lineage for Fold c.76: Alkaline phosphatase-like. *Root: SCOP 1.71 *. Class c: Alpha and beta proteins (a/b) [51349] (134 folds ...
http://scop.berkeley.edu/sunid=53648&ver=1.71
Safety Study of Human Recombinant Tissue Non-Specific Alkaline Phosphatase Fusion Protein Asfotase Alfa in Adults With...Safety Study of Human Recombinant Tissue Non-Specific Alkaline Phosphatase Fusion Protein Asfotase Alfa in Adults With...
Low Alkaline Phosphatase. genetic metabolic disorder. alkaline phosphatase. tissue non-specific alkaline phosphatase. rickets. ... Safety Study of Human Recombinant Tissue Non-Specific Alkaline Phosphatase Fusion Protein Asfotase Alfa in Adults With ... a. Serum alkaline phosphatase at least 3 SD below the mean for age ... Tolerability and Pharmacology of Human Recombinant Tissue Non-Specific Alkaline Phosphatase Fusion Protein Asfotase Alfa in ...
https://clinicaltrials.gov/ct2/show/NCT00739505
Alkaline Phosphatase (ALP), Porcine Kidney | LeeBio.comAlkaline Phosphatase (ALP), Porcine Kidney | LeeBio.com
Buy ultra pure Alkaline Phosphatase (ALP) from Porcine Kidney for diagnostic manufacturing, control, calibrator and research ... Alkaline Phosphatase is a hydrolase enzyme responsible for removing phosphate groups in the 5- and 3- positions from many types ... In humans, alkaline phosphatase is present in all tissues throughout the entire body, but is particularly concentrated in liver ... 490-20 - Alkaline Phosphatase from porcine kidney. 310-30 - Alanine Aminotransferase from porcine heart. 300-20 - Aspartate ...
https://leebio.com/product/705/alkaline-phosphatase-alp-porcine-kidney-high-purity-490-21
Higher Alkaline Phosphatase Raises Death Risk in HD Patients - Renal and Urology NewsHigher Alkaline Phosphatase Raises Death Risk in HD Patients - Renal and Urology News
Elevated levels of serum alkaline phosphatase are associated with decreased long-term survival among hemodialysis (HD) patients ... Serum alkaline phosphatase correrlated directly with calcium, parathyroid hormone, and months on dialysis at study enrollment. ... The study population had mean and median serum alkaline phosphatase levels of 122 and 88.5 U/L, respectively. Elevated levels ( ... NATIONAL HARBOR, Md.-Elevated levels of serum alkaline phosphatase are associated with decreased long-term survival among ...
https://www.renalandurologynews.com/home/conference-highlights/national-kidney-foundation-annual-meeting/nkf-2012-spring-meeting/nkf-2012-general-news/higher-alkaline-phosphatase-raises-death-risk-in-hd-patients/
anti-ARHGAP39 Antikörper (C-Term) (Alkaline Phosphatase (AP)) | Produkt Nr. ABIN2299721anti-ARHGAP39 Antikörper (C-Term) (Alkaline Phosphatase (AP)) | Produkt Nr. ABIN2299721
Alkaline Phosphatase (AP)). ARHGAP39 Reaktivität: Human ELISA, WB Wirt: Kaninchen Polyclonal Alkaline Phosphatase (AP) ... Dieser ARHGAP39 Antikörper ist konjugiert mit Alkaline Phosphatase (AP) Applikation Alle Applikationen für ARHGAP39 Antikörper ...
https://www.antikoerper-online.de/antibody/2299721/anti-rho+GTPase+Activating+Protein+39+ARHGAP39+AA+859-888,+C-Term+antibody+Alkaline+Phosphatase+AP/
Anti-Alkaline Phosphatase antibody [BGN/03/661] (GTX42810) | GeneTexAnti-Alkaline Phosphatase antibody [BGN/03/661] (GTX42810) | GeneTex
Mouse Monoclonal Alkaline Phosphatase antibody [BGN/03/661]. Validated in WB, ELISA. Tested in Human. ... placental and intestinal alkaline phosphatase), but may react with other alkaline phosphatases.. ... The exact physiological function of the alkaline phosphatases is not known. A proposed function of this form of the enzyme is ... There are currently no reviews for Alkaline Phosphatase antibody [BGN/03/661] (GTX42810). Be the first to share your experience ...
https://www.genetex.com/Product/Detail/Alkaline-Phosphatase-antibody-BGN-03-661/GTX42810
Alkaline phosphatase Test In Buckhead | Any Lab Test NowAlkaline phosphatase Test In Buckhead | Any Lab Test Now
The Alkaline phosphatase Test In Buckhead Is Used To Detect Liver Disease, Bone Disorders, Or Detect Gallbladder Disease. ... Alkaline Phosphatase (ALP). Alkaline phosphatase (ALP) is an enzyme that is found throughout the body but mostly found in liver ... Low levels of alkaline phosphatase can be seen in malnutrition of either vitamins or minerals, and it may also be temporarily ... Elevated levels of alkaline phosphatase can be seen in the detection of liver disease, bone disorders, or gallbladder disease. ...
https://www.anylabtestnow.com/buckhead-30309/tests/alkaline-phosphatase-alp/
Alkaline phosphatase isoenzymes in feline serum using an agarose gel alkaline phosphatase kit methodAlkaline phosphatase isoenzymes in feline serum using an agarose gel alkaline phosphatase kit method
... Alkaline phosphatase ... alkaline phosphatase a serum factor converts m placental alkaline phosphatase to a and b placental alkaline phosphatase. ... Influence of dietary Ca, P and Se on serum GOT and alkaline phosphatase IV. Effect of vitamin D on serum alkaline phosphatase. ... Clinical studies of serum alkaline phosphatase in domestic animals. iI. detection of isoenzymes of serum alkaline phosphatase ...
https://eurekamag.com/research/002/296/002296116.php
Alkaline phosphatase : An old enzyme newly discovered : Implications in cardiac surgeryAlkaline phosphatase : An old enzyme newly discovered : Implications in cardiac surgery
This second peak of alkaline phosphatase has an endogenous origin. The most likely source is liver type alkaline phosphatase. ... to an initial rise of plasma alkaline phosphatase levels followed by a significant increase of plasma alkaline phosphatase at ... No endogenous alkaline phosphatase release could be demonstrated in piglet experiments which are described in chapter 7 show ... Bovine intestinal alkaline phosphatase or placebo was administered as an intravenous bolus followed by continuous infusion for ...
https://dspace.library.uu.nl/handle/1874/214269
Alkaline Phosphatase Blood Test | ALP Lab Test Online | PersonalabsAlkaline Phosphatase Blood Test | ALP Lab Test Online | Personalabs
Personalabs offers alkaline phosphatase blood test at more than 4,000 affiliated locations nationwide. Order online and get an ... Alkaline phosphatase is an enzyme produced by the liver and bones. A blood test for alkaline phosphatase can show if levels are ... What Does a Blood Test for Alkaline Phosphatase Measure?. An ALP lab test will show the levels of this enzyme in your blood. ... Where Can I Get an Alkaline Phosphatase Blood Test Near Me?. Need a blood test for ALP? Personalabs makes it simple and ...
https://www.personalabs.com/product/alkaline-phosphatase-alp-blood-test/
WHO EMRO | Correlation of serum alkaline phosphatase with clinicopathological characteristics of patients with oesophageal...
Correlation of serum alkaline phosphatase with clinicopathological characteristics of patients with oesophageal cancer ... Alkaline phosphatase. Gut, 1972, 13:926-937.. *Fishman WH et al. Immunology and biochemistry of Regan isoenzyme of alkaline ... Alkaline phosphatase (ALP) comprises a group of enzymes that catalyse the hydrolysis of phosphate esters in an alkaline ... Correlation of serum alkaline phosphatase with clinicopathological characteristics of patients with oesophageal cancer ...
http://www.emro.who.int/emhj-volume-17/volume-17-issue-11/article-10.html
Cytosar-u and Blood alkaline phosphatase increased, a phase IV clinical study of FDA data - eHealthMe
Blood alkaline phosphatase increased is found among people who take Cytosar-u, especially for people who are female, 60+ old, ... What is Blood alkaline phosphatase increased?. Blood alkaline phosphatase increased is found to be associated with 2,373 drugs ... Cytosar-u and Blood alkaline phosphatase increased - a phase IV clinical study of FDA data Summary:. Blood alkaline phosphatase ... Blood alkaline phosphatase increased in Moderna COVID Vaccine *Blood alkaline phosphatase increased in Pfizer BioNTech Covid ...
https://www.ehealthme.com/ds/cytosar-u/blood-alkaline-phosphatase-increased/
Alkaline Phosphatase Conjugated Anguilla anguilla Lectin (Fresh Water Eel) -AAA-, 1mg - EY Laboratories, Inc.Alkaline Phosphatase Conjugated Anguilla anguilla Lectin (Fresh Water Eel) -AAA-, 1mg - EY Laboratories, Inc.
Alkaline Phosphatase Conjugated Anguilla anguilla Lectin (Fresh Water Eel) -AAA-, 1mg ... Alkaline Phosphatase, Anguilla anguilla Lectin Tags: lectin, AAA, Fresh-Water-Eel-agglutinin, alkaline-phosphatase, LA-4901-1 ... Alkaline Phosphatase Conjugated Anguilla anguilla Lectin (Fresh Water Eel) -AAA-, 1mg quantity. ... Alkaline Phosphatase Conjugated Phaseolus vulgaris Lectin (Red Kidney Bean) -PHA-E-, 1mg ...
http://eylabs.com/product/alkaline-phosphatase-conjugated-anguilla-anguilla-lectin-fresh-water-eel-aaa-1mg/
Alkaline Phosphatase - Labeling - Secondary Antibodies - ProductsAlkaline Phosphatase - Labeling - Secondary Antibodies - Products
We use cookies to make your experience better. To comply with the new e-Privacy directive, we need to ask for your consent to set the cookies. Learn more. ...
https://www.covalab.com/catalog/category/view/s/alkaline-phospho/id/157/
Alkaline PhosphataseAlkaline Phosphatase
This test measures the amount of an enzyme called alkaline phosphatase in your blood. It can help your healthcare provider ...
http://library.southcoast.org/YourFamily/OlderAdults/167,alkaline_phosphatase
Alkaline Phosphatase Conjugation - 101 - 250 mg - Virusys CorporationAlkaline Phosphatase Conjugation - 101 - 250 mg - Virusys Corporation
Client supplied protein is covalently linked to Alkaline Phosphatase (calf intestine). The procedure is optimized using a ...
https://virusys.com/antibody-purification-and-conjugation/alkaline-phosphatase-conjugation-101-250-mg
Excimer-based activatable fluorescent sensor for sensitive detection of alkaline phosphatase | NTU SingaporeExcimer-based activatable fluorescent sensor for sensitive detection of alkaline phosphatase | NTU Singapore
Excimer-based activatable fluorescent sensor for sensitive detection of alkaline phosphatase. Authors: Yuan, Fang. Li, Yang. ... Herein, a new probe that features excimer formation has been designed to detect cancer-related biomarker alkaline phosphatase( ... Excimer-based activatable fluorescent sensor for sensitive detection of alkaline phosphatase. Chemical Research in Chinese ...
https://dr.ntu.edu.sg/handle/10356/162433
Alkaline PhosphataseAlkaline Phosphatase
This test measures the amount of an enzyme called alkaline phosphatase in your blood. It can help your healthcare provider ...
https://myhealth.ucsd.edu/Library/PreventionGuidelines/167,alkaline_phosphatase
A study of human serum and tissue alkaline phosphataseA study of human serum and tissue alkaline phosphatase
The export option will allow you to export the current search results of the entered query to a file. Different formats are available for download. To export the items, click on the button corresponding with the preferred download format. By default, clicking on the export buttons will result in a download of the allowed maximum amount of items. To select a subset of the search results, click "Selective Export" button and make a selection of the items you want to export. The amount of items that can be exported at once is similarly restricted as the full export. After making a selection, click one of the export format buttons. The amount of items that will be exported is indicated in the bubble next to export format. ...
https://augusta.openrepository.com/handle/10675.2/622680
Biochemical and immunohistochemical evidence that in cartilage an alkaline phosphatase is a Ca2+-binding glycoprotein. |...Biochemical and immunohistochemical evidence that in cartilage an alkaline phosphatase is a Ca2+-binding glycoprotein. |...
A glycoprotein that exhibits alkaline phosphatase activity and binds Ca2+ with high affinity has been extracted and purified ... Biochemical and immunohistochemical evidence that in cartilage an alkaline phosphatase is a Ca2+-binding glycoprotein. B de ... A glycoprotein that exhibits alkaline phosphatase activity and binds Ca2+ with high affinity has been extracted and purified ... The observation that this glycoprotein (which binds Ca2+ and has alkaline phosphatase activity) is synthesized in chondrocytes ...
https://rupress.org/jcb/article/103/4/1615/13528/Biochemical-and-immunohistochemical-evidence-that
Fluorescence quenching based alkaline phosphatase activity detectionFluorescence quenching based alkaline phosphatase activity detection
Simple and fast detection of alkaline phosphatase (ALP) activity is of great importance for diagnostic and analytical ... Fluorescence quenching based alkaline phosphatase activity detection. Simple and fast detection of alkaline phosphatase (ALP) ...
https://www.researcher-app.com/paper/22944
Serum alkaline phosphataseEnzymeLiverIntestinalBoneEnzymesStreptavidinAlbuminPeriodontal diseaseSecondary AntibodiesCalfProteinBiotinReagentsConjugatesDetectionHuman serumActivityLevelsAlcalineELISAPhosphateKidneyBiochemicalGingivalMoleculesBiochemistryClinicalDiagnosticBloodHighGenePhysiologicalInflammatory
Serum alkaline phosphatase8
  • NATIONAL HARBOR, Md.-Elevated levels of serum alkaline phosphatase are associated with decreased long-term survival among hemodialysis (HD) patients, data presented at the National Kidney Foundation 2012 Spring Clinical Meetings suggest. (renalandurologynews.com)
  • In a study of 64 HD patients followed up to more than seven years, Neal Mittman, MD, and others at the State University of New York Downstate Medical Center in Brooklyn found that each 1-unit increase in serum alkaline phosphatase independently predicted a 0.5% increased risk of death, after adjusting for calcium, phosphorus and other variables. (renalandurologynews.com)
  • The study population had mean and median serum alkaline phosphatase levels of 122 and 88.5 U/L, respectively. (renalandurologynews.com)
  • Serum alkaline phosphatase correrlated directly with calcium, parathyroid hormone, and months on dialysis at study enrollment. (renalandurologynews.com)
  • The investigators concluded that serum alkaline phosphatase may be a useful therapeutic target in clinical practice. (renalandurologynews.com)
  • Total serum alkaline phosphatase (ALP) activity is the product of the combined activity of isoenzymes from a number of tissue sources. (eurekamag.com)
  • We retrospectively examined the correlation of serum alkaline phosphatase (ALP) levels with several clinicopathological characteristics of 207 cases of oesophageal carcinoma. (who.int)
  • We therefore studied the role of clinical (Body Mass Index), haematological (reticulocyte count, haemoglobin level), and biochemical (serum bilirubin: direct and indirect, serum alkaline phosphatase, serum transaminase) indices in predicting sickle cell anaemia patients likely to develop gallstones. (ac.ke)
Enzyme5
  • Alkaline Phosphatase is a hydrolase enzyme responsible for removing phosphate groups in the 5- and 3- positions from many types of molecules, including nucleotides, proteins, and alkaloids. (leebio.com)
  • Alkaline phosphatase (ALP) is an enzyme that is found throughout the body but mostly found in liver, bones, kidneys, and digestive system. (anylabtestnow.com)
  • Alkaline phosphatase is an enzyme produced by the liver and bones. (personalabs.com)
  • Alkaline phosphatase (ALP) is an enzyme in a person's blood that helps break down proteins. (bowtie.com.hk)
  • Alkaline phosphatase is a liver enzyme, whose elevated levels indicate that something is irritating the liver cell membrane. (dantheadman.org)
Liver13
  • An alkaline phosphatase test is often used to screen for or help diagnose diseases of the liver or bones. (medlineplus.gov)
  • An alkaline phosphatase test may also be ordered if you have symptoms of liver damage or a bone disorder. (medlineplus.gov)
  • High alkaline phosphatase (ALP) levels may be a sign of a liver problem or a bone disorder. (medlineplus.gov)
  • If alkaline phosphatase levels are high and the results of liver tests are normal, the problem may be a bone disorder, such as Paget's disease of bone . (medlineplus.gov)
  • In humans, alkaline phosphatase is present in all tissues throughout the entire body, but is particularly concentrated in liver, bile duct, kidney, bone, and the placenta. (leebio.com)
  • There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). (genetex.com)
  • Elevated levels of alkaline phosphatase can be seen in the detection of liver disease, bone disorders, or gallbladder disease. (anylabtestnow.com)
  • The most likely source is liver type alkaline phosphatase. (uu.nl)
  • Alkaline phosphatase levels that are too high have been connected to liver, gallbladder, pancreatic, intestinal, and other severe infections. (techbullion.com)
  • Levels of alkaline phosphatase are also linked to liver and bile duct cancer. (techbullion.com)
  • A procedure for the selective fractionation of the bone and liver alkaline phosphatase activity in tissue extracts and human sera is proposed. (unicatt.it)
  • If your alkaline phosphatase levels are high, you could look into natural ways to support the health of your liver. (bowtie.com.hk)
  • Alkaline phosphatase (ALP) levels are elevated in patients with PBC, and this corresponds to an increased risk of liver failure among other serious concerns. (medscape.com)
Intestinal5
  • This antibody detects the tissue specific isotypes, BAP, PLAP and IAP (bone, placental and intestinal alkaline phosphatase), but may react with other alkaline phosphatases. (genetex.com)
  • Based on the promising results of alkaline phosphatase in the attenuation of the inflammatory response in several studies we focused in this thesis on the effect of bovine Intestinal Alkaline Phosphatase (bIAP) on the inflammatory response in the field of cardiology and cardiac surgery. (uu.nl)
  • Bovine intestinal alkaline phosphatase or placebo was administered as an intravenous bolus followed by continuous infusion for 36 hours. (uu.nl)
  • Omega-3 fatty acids reduce the levels of intestinal alkaline phosphatase, whereas omega-6 fatty acid increases the level of intestinal alkaline phosphatase in the gut. (bowtie.com.hk)
  • Increases the activities of intestinal brush border enzymes such as disaccharidases, α-glucosidases, alkaline phosphatases, and aminopeptidases. (drruscio.com)
Bone7
  • Serum bone alkaline phosphatase is a marker of bone formation and urinary N-telopeptides are markers of bone resorption. (cdc.gov)
  • There were two methods used to measure Bone Alkaline Phosphatase in NHANES 2001-2002. (cdc.gov)
  • For NHANES 2001, the HybritechTandem-MP Ostase ImmunoEnzymetric assay was used for quantitative measurement of Bone Alkaline Phosphatase (BAP), an indicator of osteoblastic activity, in human serum. (cdc.gov)
  • Alkaline phosphatase from human bone. (genetex.com)
  • A study of the association between serum bone-specific alkaline phosphatase and serum phosphorus concentration or dietary phosphorus intake. (cdc.gov)
  • After diagnosis of Paget's disease, we recommend measurement of serum total alkaline phosphatase or, when warranted, a more specific marker of bone formation or bone resorption to assess the response to treatment or evolution of the disease in untreated patients. (bvsalud.org)
  • In patients with monostotic disease who have a normal serum total alkaline phosphatase, we suggest that a specific marker of bone formation and bone resorption be measured, although these may still be normal. (bvsalud.org)
Enzymes1
  • In comparison to control rats, the amounts of enzymes (lactic dehydrogenase, alkaline phosphatase), protein, and cells in lavage fluids from treated animals were unaltered. (cdc.gov)
Streptavidin2
  • Biotin Alkaline Phosphatase Conjugated has been tested by ELISA and dot blot and can be utilized in ELISA and Western Blotting experiments where the assay's target of interest is coupled with streptavidin. (rockland.com)
  • Dendritic-like streptavidin/alkaline phosphatase nanoarchitectures for amplified electrochemical sensing of DNA sequences. (rockland.com)
Albumin2
  • Some tests are associated with functionality (e.g., albumin), some with cellular integrity (e.g., transaminase ), and some with conditions linked to the biliary tract ( gamma-glutamyl transferase and alkaline phosphatase ). (wikipedia.org)
  • Our results showed that all dosages induced no significant alterations in growth parameters and the seric levels of total protein, albumin, globulin, low-density lipoprotein cholesterol, high-density lipoprotein cholesterol and triglycerides and activities of glutamic pyruvic transaminase, glutamic oxaloacetic transaminase, alkaline phosphatase and lactate dehydrogenase, when compared to the control group. (blogspot.com)
Periodontal disease1
  • IMSEAR at SEARO: Alkaline phosphatase as a periodontal disease marker. (who.int)
Secondary Antibodies1
  • JIR offers secondary antibodies and other reagents conjugated to horseradish peroxidase and alkaline phosphatase . (jacksonimmuno.com)
Calf3
  • Alkaline phosphatase (from calf intestine) conjugates are prepared by a method modified from Avremeas et al. (jacksonimmuno.com)
  • Client supplied protein is covalently linked to Alkaline Phosphatase (calf intestine). (virusys.com)
  • Assay by immunoelectrophoresis resulted in a single precipitin arc against anti-Alkaline Phosphatase (calf intestine) and anti-Biotin. (rockland.com)
Protein2
  • A glycoprotein that exhibits alkaline phosphatase activity and binds Ca2+ with high affinity has been extracted and purified from cartilage matrix vesicles by fast protein liquid chromatography. (rupress.org)
  • These results suggested that pyrophosphatase activity stems from the membrane -bound osseous plate alkaline phosphatase and not from a different protein . (bvsalud.org)
Biotin2
  • Biotin Alkaline Phosphatase Conjugated is ideal for investigators in Immunology, Cancer, Neuroscience, and Cell Biology. (rockland.com)
  • This product was prepared from electrophoretically pure Alkaline Phosphatase and Biotin. (rockland.com)
Reagents1
  • Furthermore, when stored in the conditions recommended by the makers, the reagents used in the alkaline phosphatase kit are stable for a year and must be replaced annually. (techbullion.com)
Conjugates3
  • Although alkaline phosphatase conjugates are sometimes used for immunohistochemistry, penetration into tissues may be limited by their large sizes. (jacksonimmuno.com)
  • Freezing alkaline phosphatase conjugates will result in a substantial loss of enzymatic activity. (rockland.com)
  • Alkaline phosphatase (AP) buffer and it's conjugates has a 5X concentration with a pH around 9.5. (glycomatrix.com)
Detection3
  • Fast Red TR/Naphthol AS-MX and TR phosphate (4-Chloro-2-methylbenzenediazonium/ 3- Hydroxy-2-naphthoic acid 2,4-dimethylanilide phosphate) substrate systems have been formulated and optimized for use in immunohistology and western blotting as a precipitating substrate for the detection of alkaline phosphatase activity. (sigmaaldrich.com)
  • Simple and fast detection of alkaline phosphatase (ALP) activity is of great importance for diagnostic and analytical applications. (researcher-app.com)
  • Alkaline-phosphatase-based nanostructure assemblies for electrochemical detection of microRNAs. (rockland.com)
Human serum1
  • The presence of alkaline phosphates in human serum and other physiological fluids can indicate a range of potential health problems. (techbullion.com)
Activity6
  • The observation that this glycoprotein (which binds Ca2+ and has alkaline phosphatase activity) is synthesized in chondrocytes and is exported to the extracellular matrix at the time when calcification begins, suggests that it plays a specific role in the process of calcification. (rupress.org)
  • To investigate the expression of alkaline phosphatase (ALP) activity in gingival fibroblasts from individuals with chronic periodontitis (CP) and drug-induced gingival hyperplasia (DGH) induced by diphenylhydantoin. (bvsalud.org)
  • Inorganic pyrophosphate-phosphohydrolytic activity associated with rat osseous plate alkaline phosphatase. (bvsalud.org)
  • Purified membrane -bound alkaline phosphatase from rat osseous plate hydrolyzed pyrophosphate in the presence of magnesium ions , with a specific activity of 92.7 U/mg. (bvsalud.org)
  • Non-sudden cardiac death was associated with moderate venous hyperemia and high postcapillary alkaline phosphatase activity. (nih.gov)
  • Alkaline phosphatase activity was higher for SF coated microspheres in comparison to uncoated microspheres when dynamic culture condition was applied. (metu.edu.tr)
Levels6
  • Low levels of alkaline phosphatase can be seen in malnutrition of either vitamins or minerals, and it may also be temporarily seen after blood transfusions or cardiac bypass surgery. (anylabtestnow.com)
  • The intravenous administration of bIAP as a bolus followed by continuous infusion to patients undergoing elective CABG with CPB leads to an initial rise of plasma alkaline phosphatase levels followed by a significant increase of plasma alkaline phosphatase at about 4-6 hours post start of surgery. (uu.nl)
  • A blood test for alkaline phosphatase can show if levels are elevated. (personalabs.com)
  • Since vitamin D deficiency has been linked with high alkaline phosphatase, be sure to check your levels. (bowtie.com.hk)
  • Clinical, biochemical and genetic spectrum of low alkaline phosphatase levels in adults. (cdc.gov)
  • The cut-off points were reticulocyte counts above ten per cent and alkaline phosphatase levels above 13 K.A. units. (ac.ke)
Alcaline2
  • Nous avons examiné rétrospectivement la corrélation entre le taux de phosphatase alcaline sérique et plusieurs caractéristiques clinicopathologiques de 207 cas de carcinome de l'œsophage. (who.int)
  • Le taux moyen de phosphatase alcaline sérique chez les patients souffrant d'un cancer de l'œsophage avec atteinte des ganglions était significativement supérieur [141 (E.T. 77) U/l] au taux des autres patients [116 (E.T. 63) U/l]. (who.int)
ELISA2
  • ELISA applications utilizing pNPP may be read in timed assays or stopped with alkaline solutions for delayed readings. (sigmaaldrich.com)
  • By direct ELISA (against purified Chlamydia LPS), 1:2,000 dilution will yield 0.2 O.D using alkaline phosphatase conjugated rabbit anti-mouse Ig (Jackson Laboratories). (prospecbio.com)
Phosphate5
  • Escherichia coli alkaline phosphatase (EC 3.1.3.1) is a non-specific phosphomonoesterase that catalyzes the hydrolysis reaction via a phosphoseryl intermediate to produce inorganic phosphate and the corresponding alcohol. (rcsb.org)
  • Nitroblue Tetrazolium (NBT) is used with the alkaline phosphatase substrate 5-Bromo- 4-Chloro-3-Indolyl Phosphate (BCIP) in western blotting and immunohistological staining procedures. (sigmaaldrich.com)
  • The alkaline phosphatase homodimer from the 2 Å crystal structure PDB 1ALK showing phosphate, zinc and magnesium ions. (jacksonimmuno.com)
  • In 2018, the cost difference between alkaline phosphate kits with pack sizes of 100 and below and pack sizes ranging from 501 to 1000 was over US $700, while the cost difference between the latter and alkaline phosphate kits with pack sizes of 100 and below was under US $110. (techbullion.com)
  • Alkaline phosphate kits, which come in pack sizes ranging from 101 to 500, are the most popular choice among end-users because to their relative price. (techbullion.com)
Kidney1
  • Lee Biosolutions is the leading producer of high purity porcine kidney Alkaline Phosphatase (ALP) for research, life science and diagnostic manufacturing. (leebio.com)
Biochemical1
  • Biochemical and immunohistochemical evidence that in cartilage an alkaline phosphatase is a Ca2+-binding glycoprotein. (rupress.org)
Gingival1
  • Background: The potential of alkaline phosphatase (ALP) as an important diagnostic marker of gingival crevicular fluid (GCF) has been the subject to investigation since 1970. (who.int)
Molecules1
  • Questions that are being addressed are: what is the role of gatekeeper molecules like alkaline phosphatase in burn wound healing? (uva.nl)
Biochemistry1
  • In the User's Guide - See Clinical Pathology section - Guide to interpretation of AHL biochemistry profiles* - Alkaline phosphatase (ALP). (uoguelph.ca)
Clinical1
  • The phase IV clinical study analyzes which people take Cytosar-u and have Blood alkaline phosphatase increased. (ehealthme.com)
Diagnostic1
  • Alkaline phosphatase kits have become a common diagnostic tool in the medical community due to its capacity to aid in the identification and prognosis of a wide range of disorders. (techbullion.com)
Blood13
  • An alkaline phosphatase (ALP) test measures the amount of ALP in your blood. (medlineplus.gov)
  • But an alkaline phosphatase test alone can't identify the source of ALP in your blood, so other tests are usually needed to make a diagnosis. (medlineplus.gov)
  • An alkaline phosphatase test is a type of blood test. (medlineplus.gov)
  • What Does a Blood Test for Alkaline Phosphatase Measure? (personalabs.com)
  • Schedule a telehealth appointment with one of our board-certified physicians to discuss your blood test for alkaline phosphatase. (personalabs.com)
  • Where Can I Get an Alkaline Phosphatase Blood Test Near Me? (personalabs.com)
  • Blood alkaline phosphatase increased is reported only by a few people who take Cytosar-U. (ehealthme.com)
  • Among them, 3 people (0.51%) have Blood alkaline phosphatase increased. (ehealthme.com)
  • What is Blood alkaline phosphatase increased? (ehealthme.com)
  • Blood alkaline phosphatase increased is found to be associated with 2,373 drugs and 2,314 conditions by eHealthMe. (ehealthme.com)
  • Do you take Cytosar-u and have Blood alkaline phosphatase increased? (ehealthme.com)
  • Doctors use the level of alkaline phosphatase in a patient's blood to diagnose illnesses such hepatitis, cirrhosis, cholecystitis, and bile duct blockage. (techbullion.com)
  • LAP, or neutrophil alkaline phosphatase, refers to a staining reaction of peripheral blood smears. (5minuteconsult.com)
High3
  • Because of the significant cost gap between pack sizes 501-1000 and a minor value differential with pack sizes up to 100, demand for alkaline phosphatase kits with pack sizes ranging from 101-500 has remained high. (techbullion.com)
  • What is considered a very high level of alkaline phosphatase? (buycbdoilarizona.com)
  • What is considered a very high level of alkaline phosphatase?Qualify for compensation for exposure to Camp Lejeune's water.If you or a loved one were at Camp Lejeune between 1953-1987 you may qualify for compensation.Q. What is considered a very high level of alkaline phosphatase? (buycbdoilarizona.com)
Gene4
  • The carriers were complexed with episomal plasmid DNA or minicircles using secreted alkaline phosphatase (SEAP) gene as a marker gene. (helsinki.fi)
  • Importance of deletion of T at nucleotide 1559 in the tissue-nonspecific alkaline phosphatase gene in Japanese patients with hypophosphatasia. (cdc.gov)
  • C) in the tissue-nonspecific alkaline phosphatase gene associated with BMD. (cdc.gov)
  • Common mutations F310L and T1559del in the tissue-nonspecific alkaline phosphatase gene are related to distinct phenotypes in Japanese patients with hypophosphatasia. (cdc.gov)
Physiological1
  • The exact physiological function of the alkaline phosphatases is not known. (genetex.com)
Inflammatory1
  • To exclude that aprotinin as possible anti-inflammatory agent was the eliciting factor in endogenous alkaline phosphatase release we performed a small study in patients undergoing CABG with the use of CPB, but without the use of aprotinin. (uu.nl)
DailyMed - TAFINLAR- dabrafenib capsule
DailyMed - TAFINLAR- dabrafenib capsule (dailymed.nlm.nih.gov)
Alkaline phosphatase - Healthy.net
Alkaline phosphatase - Healthy.net (healthy.net)
Notes from the Field: Fatal Yellow Fever in a Traveler Returning From Peru - New York, 2016 | MMWR
Notes from the Field: Fatal Yellow Fever in a Traveler Returning From Peru - New York, 2016 | MMWR (cdc.gov)
Acute Kidney Injury Among Children Likely Associated with Diethylene Glycol-Contaminated Medications - The Gambia, June...
Acute Kidney Injury Among Children Likely Associated with Diethylene Glycol-Contaminated Medications - The Gambia, June... (cdc.gov)
RCSB PDB - 1ELX: E. COLI ALKALINE PHOSPHATASE MUTANT (S102A)
RCSB PDB - 1ELX: E. COLI ALKALINE PHOSPHATASE MUTANT (S102A) (rcsb.org)
Find Best alkaline-phosphatase Clinic & alkaline-phosphatase Hospital Near me
Find Best alkaline-phosphatase Clinic & alkaline-phosphatase Hospital Near me (kayawell.com)
Unresolved Splenomegaly in Recently Resettled Congolese Refugees ― Multiple States, 2015-2018 | MMWR
Unresolved Splenomegaly in Recently Resettled Congolese Refugees ― Multiple States, 2015-2018 | MMWR (cdc.gov)
Alkaline Phosphatase: MedlinePlus Medical Test
Alkaline Phosphatase: MedlinePlus Medical Test (medlineplus.gov)
A Boy With Frequent Diarrhea: IBS or IBD?
A Boy With Frequent Diarrhea: IBS or IBD? (medscape.com)
Chronic Kidney Disease (CKD): Practice Essentials, Pathophysiology, Etiology
Chronic Kidney Disease (CKD): Practice Essentials, Pathophysiology, Etiology (medscape.com)
Peritoneal fluid analysis: MedlinePlus Medical Encyclopedia
Peritoneal fluid analysis: MedlinePlus Medical Encyclopedia (medlineplus.gov)
Hodgkin Lymphoma: Practice Essentials, Background, Pathophysiology
Hodgkin Lymphoma: Practice Essentials, Background, Pathophysiology (medscape.com)
Mabry syndrome: MedlinePlus Genetics
Mabry syndrome: MedlinePlus Genetics (medlineplus.gov)
Chronic Kidney Disease (CKD): Practice Essentials, Pathophysiology, Etiology
Chronic Kidney Disease (CKD): Practice Essentials, Pathophysiology, Etiology (medscape.com)
Appendix B: Some Common Abbreviations: MedlinePlus
Appendix B: Some Common Abbreviations: MedlinePlus (medlineplus.gov)
Choroidal Melanoma: Practice Essentials, Overview, Pathophysiology
Choroidal Melanoma: Practice Essentials, Overview, Pathophysiology (medscape.com)
Paget's Disease of Bone | MedlinePlus
Paget's Disease of Bone | MedlinePlus (medlineplus.gov)
Diagnosis and Management of Q Fever - United States, 2013
Diagnosis and Management of Q Fever - United States, 2013 (cdc.gov)
PDF) In vitro digestibility of expanded pork skin and rawhide chews, and digestion and metabolic characteristics of expanded...
PDF) In vitro digestibility of expanded pork skin and rawhide chews, and digestion and metabolic characteristics of expanded... (researchgate.net)
Surveillance for Recurrent Bladder Cancer: Practice Essentials, Imaging Studies, Complications of Cystoscopy
Surveillance for Recurrent Bladder Cancer: Practice Essentials, Imaging Studies, Complications of Cystoscopy (medscape.com)
Secondary Thrombocytosis Workup: Approach Considerations
Secondary Thrombocytosis Workup: Approach Considerations (medscape.com)
Biliary Obstruction Workup: Laboratory Studies, Imaging Studies, Procedures
Biliary Obstruction Workup: Laboratory Studies, Imaging Studies, Procedures (medscape.com)
(emedicine.medscape.com)
Bone Markers in Osteoporosis: Bone Turnover Markers, Bone Formation Markers, Bone Resorption Markers
Bone Markers in Osteoporosis: Bone Turnover Markers, Bone Formation Markers, Bone Resorption Markers (emedicine.medscape.com)
(emedicine.medscape.com)
Histoplasmosis Workup: Laboratory Studies, Imaging Studies, Other Tests
Histoplasmosis Workup: Laboratory Studies, Imaging Studies, Other Tests (medscape.com)