Alanine Transaminase: An enzyme that catalyzes the conversion of L-alanine and 2-oxoglutarate to pyruvate and L-glutamate. (From Enzyme Nomenclature, 1992) EC 2.6.1.2.Aspartate Aminotransferases: Enzymes of the transferase class that catalyze the conversion of L-aspartate and 2-ketoglutarate to oxaloacetate and L-glutamate. EC 2.6.1.1.Alanine: A non-essential amino acid that occurs in high levels in its free state in plasma. It is produced from pyruvate by transamination. It is involved in sugar and acid metabolism, increases IMMUNITY, and provides energy for muscle tissue, BRAIN, and the CENTRAL NERVOUS SYSTEM.Liver: A large lobed glandular organ in the abdomen of vertebrates that is responsible for detoxification, metabolism, synthesis and storage of various substances.4-Aminobutyrate Transaminase: An enzyme that converts brain gamma-aminobutyric acid (GAMMA-AMINOBUTYRIC ACID) into succinate semialdehyde, which can be converted to succinic acid and enter the citric acid cycle. It also acts on beta-alanine. EC 2.6.1.19.Drug-Induced Liver Injury: A spectrum of clinical liver diseases ranging from mild biochemical abnormalities to ACUTE LIVER FAILURE, caused by drugs, drug metabolites, and chemicals from the environment.Transaminases: A subclass of enzymes of the transferase class that catalyze the transfer of an amino group from a donor (generally an amino acid) to an acceptor (generally a 2-keto acid). Most of these enzymes are pyridoxyl phosphate proteins. (Dorland, 28th ed) EC 2.6.1.Liver Function Tests: Blood tests that are used to evaluate how well a patient's liver is working and also to help diagnose liver conditions.Liver Diseases: Pathological processes of the LIVER.D-Alanine Transaminase: A PYRIDOXAL PHOSPHATE containing enzyme that catalyzes the reversible transfer of an amino group between D-Alanine and alpha-ketoglutarate to form PYRUVATE and D-GLUTAMATE, respectively. It plays a role in the synthesis of the bacterial CELL WALL. This enzyme was formerly classified as EC 2.6.1.10.Carbon Tetrachloride: A solvent for oils, fats, lacquers, varnishes, rubber waxes, and resins, and a starting material in the manufacturing of organic compounds. Poisoning by inhalation, ingestion or skin absorption is possible and may be fatal. (Merck Index, 11th ed)gamma-Glutamyltransferase: An enzyme, sometimes called GGT, with a key role in the synthesis and degradation of GLUTATHIONE; (GSH, a tripeptide that protects cells from many toxins). It catalyzes the transfer of the gamma-glutamyl moiety to an acceptor amino acid.Protective Agents: Synthetic or natural substances which are given to prevent a disease or disorder or are used in the process of treating a disease or injury due to a poisonous agent.Bilirubin: A bile pigment that is a degradation product of HEME.Plant Extracts: Concentrated pharmaceutical preparations of plants obtained by removing active constituents with a suitable solvent, which is evaporated away, and adjusting the residue to a prescribed standard.Acetaminophen: Analgesic antipyretic derivative of acetanilide. It has weak anti-inflammatory properties and is used as a common analgesic, but may cause liver, blood cell, and kidney damage.GalactosamineLiver Cirrhosis: Liver disease in which the normal microcirculation, the gross vascular anatomy, and the hepatic architecture have been variably destroyed and altered with fibrous septa surrounding regenerated or regenerating parenchymal nodules.Alkaline Phosphatase: An enzyme that catalyzes the conversion of an orthophosphoric monoester and water to an alcohol and orthophosphate. EC 3.1.3.1.Liver Cirrhosis, Experimental: Experimentally induced chronic injuries to the parenchymal cells in the liver to achieve a model for LIVER CIRRHOSIS.Phytotherapy: Use of plants or herbs to treat diseases or to alleviate pain.Fatty Liver: Lipid infiltration of the hepatic parenchymal cells resulting in a yellow-colored liver. The abnormal lipid accumulation is usually in the form of TRIGLYCERIDES, either as a single large droplet or multiple small droplets. Fatty liver is caused by an imbalance in the metabolism of FATTY ACIDS.Alanine Racemase: A pyridoxal-phosphate protein that reversibly catalyzes the conversion of L-alanine to D-alanine. EC 5.1.1.1.Biological Markers: Measurable and quantifiable biological parameters (e.g., specific enzyme concentration, specific hormone concentration, specific gene phenotype distribution in a population, presence of biological substances) which serve as indices for health- and physiology-related assessments, such as disease risk, psychiatric disorders, environmental exposure and its effects, disease diagnosis, metabolic processes, substance abuse, pregnancy, cell line development, epidemiologic studies, etc.Hepatitis B, Chronic: INFLAMMATION of the LIVER in humans caused by HEPATITIS B VIRUS lasting six months or more. It is primarily transmitted by parenteral exposure, such as transfusion of contaminated blood or blood products, but can also be transmitted via sexual or intimate personal contact.L-Lactate Dehydrogenase: A tetrameric enzyme that, along with the coenzyme NAD+, catalyzes the interconversion of LACTATE and PYRUVATE. In vertebrates, genes for three different subunits (LDH-A, LDH-B and LDH-C) exist.Reperfusion Injury: Adverse functional, metabolic, or structural changes in ischemic tissues resulting from the restoration of blood flow to the tissue (REPERFUSION), including swelling; HEMORRHAGE; NECROSIS; and damage from FREE RADICALS. The most common instance is MYOCARDIAL REPERFUSION INJURY.Analgesics, Non-Narcotic: A subclass of analgesic agents that typically do not bind to OPIOID RECEPTORS and are not addictive. Many non-narcotic analgesics are offered as NONPRESCRIPTION DRUGS.Rats, Wistar: A strain of albino rat developed at the Wistar Institute that has spread widely at other institutions. This has markedly diluted the original strain.Lipid Peroxidation: Peroxidase catalyzed oxidation of lipids using hydrogen peroxide as an electron acceptor.Thiobarbituric Acid Reactive Substances: Low-molecular-weight end products, probably malondialdehyde, that are formed during the decomposition of lipid peroxidation products. These compounds react with thiobarbituric acid to form a fluorescent red adduct.Hepatitis C, Chronic: INFLAMMATION of the LIVER in humans that is caused by HEPATITIS C VIRUS lasting six months or more. Chronic hepatitis C can lead to LIVER CIRRHOSIS.Tyrosine Transaminase: An enzyme that catalyzes the conversion of L-TYROSINE and 2-oxoglutarate to 4-hydroxyphenylpyruvate and L-GLUTAMATE. It is a pyridoxal-phosphate protein. L-PHENYLALANINE is hydroxylated to L-tyrosine. The mitochondrial enzyme may be identical with ASPARTATE AMINOTRANSFERASES (EC 2.6.1.1.). Deficiency of this enzyme may cause type II Tyrosinemia (see TYROSINEMIAS). EC 2.6.1.5.Antioxidants: Naturally occurring or synthetic substances that inhibit or retard the oxidation of a substance to which it is added. They counteract the harmful and damaging effects of oxidation in animal tissues.Necrosis: The pathological process occurring in cells that are dying from irreparable injuries. It is caused by the progressive, uncontrolled action of degradative ENZYMES, leading to MITOCHONDRIAL SWELLING, nuclear flocculation, and cell lysis. It is distinct it from APOPTOSIS, which is a normal, regulated cellular process.Rats, Sprague-Dawley: A strain of albino rat used widely for experimental purposes because of its calmness and ease of handling. It was developed by the Sprague-Dawley Animal Company.Antiviral Agents: Agents used in the prophylaxis or therapy of VIRUS DISEASES. Some of the ways they may act include preventing viral replication by inhibiting viral DNA polymerase; binding to specific cell-surface receptors and inhibiting viral penetration or uncoating; inhibiting viral protein synthesis; or blocking late stages of virus assembly.Hepatitis C: INFLAMMATION of the LIVER in humans caused by HEPATITIS C VIRUS, a single-stranded RNA virus. Its incubation period is 30-90 days. Hepatitis C is transmitted primarily by contaminated blood parenterally, and is often associated with transfusion and intravenous drug abuse. However, in a significant number of cases, the source of hepatitis C infection is unknown.Disease Models, Animal: Naturally occurring or experimentally induced animal diseases with pathological processes sufficiently similar to those of human diseases. They are used as study models for human diseases.Interferon-alpha: One of the type I interferons produced by peripheral blood leukocytes or lymphoblastoid cells. In addition to antiviral activity, it activates NATURAL KILLER CELLS and B-LYMPHOCYTES, and down-regulates VASCULAR ENDOTHELIAL GROWTH FACTOR expression through PI-3 KINASE and MAPK KINASES signaling pathways.Treatment Outcome: Evaluation undertaken to assess the results or consequences of management and procedures used in combating disease in order to determine the efficacy, effectiveness, safety, and practicability of these interventions in individual cases or series.Time Factors: Elements of limited time intervals, contributing to particular results or situations.Alanine Dehydrogenase: An NAD-dependent enzyme that catalyzes the reversible DEAMINATION of L-ALANINE to PYRUVATE and AMMONIA. The enzyme is needed for growth when ALANINE is the sole CARBON or NITROGEN source. It may also play a role in CELL WALL synthesis because L-ALANINE is an important constituent of the PEPTIDOGLYCAN layer.Hepacivirus: A genus of FLAVIVIRIDAE causing parenterally-transmitted HEPATITIS C which is associated with transfusions and drug abuse. Hepatitis C virus is the type species.Ornithine-Oxo-Acid Transaminase: A pyridoxal phosphate enzyme that catalyzes the formation of glutamate gamma-semialdehyde and an L-amino acid from L-ornithine and a 2-keto-acid. EC 2.6.1.13.Aminooxyacetic Acid: A compound that inhibits aminobutyrate aminotransferase activity in vivo, thereby raising the level of gamma-aminobutyric acid in tissues.Vigabatrin: An analogue of GAMMA-AMINOBUTYRIC ACID. It is an irreversible inhibitor of 4-AMINOBUTYRATE TRANSAMINASE, the enzyme responsible for the catabolism of GAMMA-AMINOBUTYRIC ACID. (From Martindale The Extra Pharmacopoeia, 31st ed)Predictive Value of Tests: In screening and diagnostic tests, the probability that a person with a positive test is a true positive (i.e., has the disease), is referred to as the predictive value of a positive test; whereas, the predictive value of a negative test is the probability that the person with a negative test does not have the disease. Predictive value is related to the sensitivity and specificity of the test.beta-Alanine-Pyruvate Transaminase: A PYRIDOXAL PHOSPHATE containing enzyme that catalyzes the transfer of an amino group from L-ALANINE to 3-oxopropanoate to generate PYRUVATE and BETA-ALANINE.Retrospective Studies: Studies used to test etiologic hypotheses in which inferences about an exposure to putative causal factors are derived from data relating to characteristics of persons under study or to events or experiences in their past. The essential feature is that some of the persons under study have the disease or outcome of interest and their characteristics are compared with those of unaffected persons.Amino Acids: Organic compounds that generally contain an amino (-NH2) and a carboxyl (-COOH) group. Twenty alpha-amino acids are the subunits which are polymerized to form proteins.Mice, Inbred C57BLPyridoxal Phosphate: This is the active form of VITAMIN B 6 serving as a coenzyme for synthesis of amino acids, neurotransmitters (serotonin, norepinephrine), sphingolipids, aminolevulinic acid. During transamination of amino acids, pyridoxal phosphate is transiently converted into pyridoxamine phosphate (PYRIDOXAMINE).Tumor Necrosis Factor-alpha: Serum glycoprotein produced by activated MACROPHAGES and other mammalian MONONUCLEAR LEUKOCYTES. It has necrotizing activity against tumor cell lines and increases ability to reject tumor transplants. Also known as TNF-alpha, it is only 30% homologous to TNF-beta (LYMPHOTOXIN), but they share TNF RECEPTORS.Aspartate Aminotransferase, Cytoplasmic: An aspartate aminotransferase found in the CYTOPLASM.Isoleucine: An essential branched-chain aliphatic amino acid found in many proteins. It is an isomer of LEUCINE. It is important in hemoglobin synthesis and regulation of blood sugar and energy levels.Prospective Studies: Observation of a population for a sufficient number of persons over a sufficient number of years to generate incidence or mortality rates subsequent to the selection of the study group.Ketoglutaric Acids: A family of compounds containing an oxo group with the general structure of 1,5-pentanedioic acid. (From Lehninger, Principles of Biochemistry, 1982, p442)Amino Acid Sequence: The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.Molecular Sequence Data: Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.Aminobutyrates: Derivatives of BUTYRIC ACID that contain one or more amino groups attached to the aliphatic structure. Included under this heading are a broad variety of acid forms, salts, esters, and amides that include the aminobutryrate structure.Clinical Enzyme Tests: Analyses for a specific enzyme activity, or of the level of a specific enzyme that is used to assess health and disease risk, for early detection of disease or disease prediction, diagnosis, and change in disease status.Pyridoxine: The 4-methanol form of VITAMIN B 6 which is converted to PYRIDOXAL PHOSPHATE which is a coenzyme for synthesis of amino acids, neurotransmitters (serotonin, norepinephrine), sphingolipids, aminolevulinic acid. Although pyridoxine and Vitamin B 6 are still frequently used as synonyms, especially by medical researchers, this practice is erroneous and sometimes misleading (EE Snell; Ann NY Acad Sci, vol 585 pg 1, 1990).Glutamine-Fructose-6-Phosphate Transaminase (Isomerizing): An enzyme that catalyzes the synthesis of fructose-6-phosphate plus GLUTAMINE from GLUTAMATE plus glucosamine-6-phosphate.Aspartate Aminotransferase, Mitochondrial: An aspartate aminotransferase found in MITOCHONDRIA.Mutagenesis, Site-Directed: Genetically engineered MUTAGENESIS at a specific site in the DNA molecule that introduces a base substitution, or an insertion or deletion.Kinetics: The rate dynamics in chemical or physical systems.Glycine Transaminase: A PYRIDOXAL PHOSPHATE containing enzyme that catalyzes the transfer of the amino group of GLYCINE onto 2-oxoglutarate to generate GLYOXYLATE and L-GLUTAMATE.Glutamine: A non-essential amino acid present abundantly throughout the body and is involved in many metabolic processes. It is synthesized from GLUTAMIC ACID and AMMONIA. It is the principal carrier of NITROGEN in the body and is an important energy source for many cells.Keto AcidsAspartic Acid: One of the non-essential amino acids commonly occurring in the L-form. It is found in animals and plants, especially in sugar cane and sugar beets. It may be a neurotransmitter.Glutamates: Derivatives of GLUTAMIC ACID. Included under this heading are a broad variety of acid forms, salts, esters, and amides that contain the 2-aminopentanedioic acid structure.PyruvatesMutation: Any detectable and heritable change in the genetic material that causes a change in the GENOTYPE and which is transmitted to daughter cells and to succeeding generations.Hepatitis: INFLAMMATION of the LIVER.Succinyldiaminopimelate Transaminase: A PYRIDOXAL PHOSPHATE containing enzyme that catalyzes the transfer amino group from N-succinyl-L-2,6-diaminoheptanedioate to 2-oxoglutarate in order to generate N-succinyl-2-L-amino-6-oxoheptanedioate and L-GLUTAMATE, respectively.Pyridoxamine: The 4-aminomethyl form of VITAMIN B 6. During transamination of amino acids, PYRIDOXAL PHOSPHATE is transiently converted into pyridoxamine phosphate.ValeratesLyases: A class of enzymes that catalyze the cleavage of C-C, C-O, and C-N, and other bonds by other means than by hydrolysis or oxidation. (Enzyme Nomenclature, 1992) EC 4.Leucine: An essential branched-chain amino acid important for hemoglobin formation.Valine: A branched-chain essential amino acid that has stimulant activity. It promotes muscle growth and tissue repair. It is a precursor in the penicillin biosynthetic pathway.Escherichia coli: A species of gram-negative, facultatively anaerobic, rod-shaped bacteria (GRAM-NEGATIVE FACULTATIVELY ANAEROBIC RODS) commonly found in the lower part of the intestine of warm-blooded animals. It is usually nonpathogenic, but some strains are known to produce DIARRHEA and pyogenic infections. Pathogenic strains (virotypes) are classified by their specific pathogenic mechanisms such as toxins (ENTEROTOXIGENIC ESCHERICHIA COLI), etc.KynurenineAmination: The creation of an amine. It can be produced by the addition of an amino group to an organic compound or reduction of a nitro group.Succinate-Semialdehyde Dehydrogenase: An enzyme that plays a role in the GLUTAMATE and butanoate metabolism pathways by catalyzing the oxidation of succinate semialdehyde to SUCCINATE using NAD+ as a coenzyme. Deficiency of this enzyme, causes 4-hydroxybutyricaciduria, a rare inborn error in the metabolism of the neurotransmitter 4-aminobutyric acid (GABA).Amino Acid Substitution: The naturally occurring or experimentally induced replacement of one or more AMINO ACIDS in a protein with another. If a functionally equivalent amino acid is substituted, the protein may retain wild-type activity. Substitution may also diminish, enhance, or eliminate protein function. Experimentally induced substitution is often used to study enzyme activities and binding site properties.Oxaloacetic Acid: A dicarboxylic acid ketone that is an important metabolic intermediate of the CITRIC ACID CYCLE. It can be converted to ASPARTIC ACID by ASPARTATE TRANSAMINASE.Aminocaproates: Amino derivatives of caproic acid. Included under this heading are a broad variety of acid forms, salts, esters, and amides that contain the amino caproic acid structure.Serine: A non-essential amino acid occurring in natural form as the L-isomer. It is synthesized from GLYCINE or THREONINE. It is involved in the biosynthesis of PURINES; PYRIMIDINES; and other amino acids.Blood Chemical Analysis: An examination of chemicals in the blood.Recombinant Proteins: Proteins prepared by recombinant DNA technology.Substrate Specificity: A characteristic feature of enzyme activity in relation to the kind of substrate on which the enzyme or catalytic molecule reacts.Aminoethylphosphonic Acid: An organophosphorus compound isolated from human and animal tissues.

Quantitative aspects in the assessment of liver injury. (1/3443)

Liver function data are usually difficult to use in their original form when one wishes to compare the hepatotoxic properties of several chemical substances. However, procedures are available for the conversion of liver function data into quantal responses. These permit the elaboration of dose-response lines for the substances in question, the calculation of median effective doses and the statistical analysis of differences in liver-damaging potency. These same procedures can be utilized for estimating the relative hazard involved if one compares the liver-damaging potency to the median effective dose for some other pharmacologie parameter. Alterations in hepatic triglycerides, lipid peroxidation, and the activities of various hepatic enzymes can also be quantitiated in a dose-related manner. This permits the selection of equitoxic doses required for certain comparative studies and the selection of doses in chemical interaction studies. The quantitative problems involved in low-frequency adverse reactions and the difficulty these present in the detection of liver injury in laboratory animals are discussed.  (+info)

Activities of citrate synthase, NAD+-linked and NADP+-linked isocitrate dehydrogenases, glutamate dehydrogenase, aspartate aminotransferase and alanine aminotransferase in nervous tissues from vertebrates and invertebrates. (2/3443)

1. The activities of citrate synthase and NAD+-linked and NADP+-linked isocitrate dehydrogenases were measured in nervous tissue from different animals in an attempt to provide more information about the citric acid cycle in this tissue. In higher animals the activities of citrate synthase are greater than the sum of activities of the isocitrate dehydrogenases, whereas they are similar in nervous tissues from the lower animals. This suggests that in higher animals the isocitrate dehydrogenase reaction is far-removed from equilibrium. If it is assumed that isocitrate dehydrogenase activities provide an indication of the maximum flux through the citric acid cycle, the maximum glycolytic capacity in nervous tissue is considerably greater than that of the cycle. This suggest that glycolysis can provide energy in excess of the aerobic capacity of the tissue. 2. The activities of glutamate dehydrogenase are high in most nervous tissues and the activities of aspartate aminotransferase are high in all nervous tissue investigated. However, the activities of alanine aminotransferase are low in all tissues except the ganglia of the waterbug and cockroach. In these insect tissues, anaerobic glycolysis may result in the formation of alanine rather than lactate.  (+info)

Blockade of type beta transforming growth factor signaling prevents liver fibrosis and dysfunction in the rat. (3/3443)

We eliminated type beta transforming growth factor (TGF-beta) signaling by adenovirus-mediated local expression of a dominant-negative type II TGF-beta receptor (AdCATbeta-TR) in the liver of rats treated with dimethylnitrosamine, a model of persistent liver fibrosis. In rats that received a single application of AdCATbeta-TR via the portal vein, liver fibrosis as assessed by histology and hydroxyproline content was markedly attenuated. All AdCATbeta-TR-treated rats remained alive, and their serum levels of hyaluronic acid and transaminases remained at low levels, whereas all the AdCATbeta-TR-untreated rats died of liver dysfunction. The results demonstrate that TGF-beta does play a central role in liver fibrogenesis and indicate clearly in a persistent fibrosis model that prevention of fibrosis by anti-TGF-beta intervention could be therapeutically useful.  (+info)

Phase I and pharmacokinetic study of the topoisomerase II catalytic inhibitor fostriecin. (4/3443)

We conducted a phase I and pharmacokinetic study of the topoisomerase II catalytic inhibitor fostriecin. Fostriecin was administered intravenously over 60 min on days 1-5 at 4-week intervals. Dose was escalated from 2 mg m(-2) day(-1) to 20 mg m(-2) day(-1) in 20 patients. Drug pharmacokinetics was analysed with high performance liquid chromatography with UV-detection. Plasma collected during drug administration was tested in vitro for growth inhibition of a teniposide-resistant small-cell lung cancer (SCLC) cell line. The predominant toxicities were elevated liver transaminases (maximum common toxicity criteria (CTC) grade 4) and serum creatinine (maximum CTC grade 2). These showed only a limited increase with increasing doses, often recovered during drug administration and were fully reversible. Duration of elevated alanine-amino transferase (ALT) was dose-limiting in one patient at 20 mg m(-2). Other frequent toxicities were grade 1-2 nausea/vomiting, fever and mild fatigue. Mean fostriecin plasma half-life was 0.36 h (initial; 95% CI, 0-0.76 h) and 1.51 h (terminal; 95% CI, 0.41-2.61 h). A metabolite, most probably dephosphorylated fostriecin, was detected in plasma and urine. No tumour responses were observed, but the plasma concentrations reached in the patients were insufficient to induce significant growth inhibition in vitro. The maximum tolerated dose (MTD) has not been reached, because drug supply was stopped at the 20 mg m(-2) dose level. However, further escalation seems possible and is warranted to achieve potentially effective drug levels. Fostriecin has a short plasma half-life and longer duration of infusion should be considered.  (+info)

Influences of Kupffer cell stimulation and suppression on immunological liver injury in mice. (5/3443)

AIM: To study the possible involvement of Kupffer cells (KC) in immunological liver injury in mice. METHODS: Liver injury was induced by i.v. injection of Bacillus Calmette-Guerin (BCG) 5 x 10(7) viable bacilli followed by i.v. injection of lipopolysaccharides (LPS) 7.5 micrograms to each mouse. Indian ink and silica were i.v. injected to suppress KC and retinol was given po to stimulate KC in these mice. Plasma alanine aminotransferase (AlaAT), aspatate aminotransferase (AspAT), nitric oxide (NO), and liver tissue were examined. RESULTS: Injection of LPS following BCG injection resulted in a remarkable elevation of plasma NO, AlaAT, and AspAT levels, and severe liver damage. The damages were enhanced by the activation of KC with retinol and reduced by suppression of KC with silica and Indian ink. CONCLUSION: The degree of liver injury induced by BCG + LPS is closely correlated with the status of KC, and NO from KC plays an important role in the pathogenesis of the liver damage in mice.  (+info)

Effect of epidermal growth factor on cultured rat hepatocytes poisoned by CCl4. (6/3443)

AIM: To study the effects of epidermal growth factor (EGF) on CCl4-induced primary cultured hepatocytes injury. METHODS: Alanine amino-transferase (AlaAT) and aspartate aminotransferase (AspAT) activities and K+ concentractions were determined by the Auto-biochemistry Assay System. Malondialdehyde (MDA) was determined by thiobarbituric acid method. Radioactivity was determined by liquid scintillometry. Light microscopy and electron microscopy were used. RESULTS: EGF 40 micrograms.L-1 decreased CCl4 (10 mmol.L-1)-induced damages of rat primary cultured hepatocytes by decreasing AlaAT and AspAT leakage and MDA production, and promoted RNA and DNA synthesis, with a high positive correlation between intracellular K+ leakage and DNA syntheses (r = 0.99, P < 0.01). Cytopathological study showed that EGF decreased damage of liver cells. CONCLUSION: EGF maintains the stability of cellular lipid membrane and promotes syntheses of RNA and DNA of hepatocytes, and intracellular K+ transference is a promotor of the message transmission of DNA synthesis.  (+info)

Continuous versus intermittent portal triad clamping for liver resection: a controlled study. (7/3443)

OBJECTIVE: The authors compared the intra- and postoperative course of patients undergoing liver resections under continuous pedicular clamping (CPC) or intermittent pedicular clamping (IPC). SUMMARY BACKGROUND DATA: Reduced blood loss during liver resection is achieved by pedicular clamping. There is controversy about the benefits of IPC over CPC in humans in terms of hepatocellular injury and blood loss control in normal and abnormal liver parenchyma. METHODS: Eighty-six patients undergoing liver resections were included in a prospective randomized study comparing the intra- and postoperative course under CPC (n = 42) or IPC (n = 44) with periods of 15 minutes of clamping and 5 minutes of unclamping. The data were further analyzed according to the presence (steatosis >20% and chronic liver disease) or absence of abnormal liver parenchyma. RESULTS: The two groups of patients were similar in terms of age, sex, nature of the liver tumors, results of preoperative assessment, proportion of patients undergoing major or minor hepatectomy, and nature of nontumorous liver parenchyma. Intraoperative blood loss during liver transsection was significantly higher in the IPC group. In the CPC group, postoperative liver enzymes and serum bilirubin levels were significantly higher in the subgroup of patients with abnormal liver parenchyma. Major postoperative deterioration of liver function occurred in four patients with abnormal liver parenchyma, with two postoperative deaths. All of them were in the CPC group. CONCLUSIONS: This clinical controlled study clearly demonstrated the better parenchymal tolerance to IPC over CPC, especially in patients with abnormal liver parenchyma.  (+info)

Folate nutriture alters choline status of women and men fed low choline diets. (8/3443)

Choline and folate share methylation pathways and, in studies of rats, were shown to be metabolically inter-related. To determine whether choline status is related to folate intake in humans, we measured the effect of controlled folate depletion and repletion on the plasma choline and phosphatidylcholine concentrations of 11 healthy men (33-46 y) and 10 healthy women (49-63 y) fed low-choline diets in two separate metabolic unit studies. Total folate intake was varied by supplementing low folate (25 and 56 microg/d for men and women, respectively) and low choline (238 and 147 mg/d for men and women, respectively) diets with pteroylglutamic acid for 2-6 wk following folate-depletion periods of 4-5 wk. The low folate/choline intakes resulted in subclinical folate deficiencies; mean plasma choline decreases of 28 and 25% in the men and women, respectively; and a plasma phosphatidylcholine decrease of 26% in the men (P < 0. 05). No functional choline deficiency occurred, as measured by serum transaminase and lipid concentrations. The decreases in choline status measures returned to baseline or higher upon moderate folate repletion and were more responsive to folate repletion than plasma folate and homocysteine. Feeding methionine supplements to the men did not prevent plasma choline depletion, indicating that folate is a more limiting nutrient for these methylation pathways. The results indicate that 1) choline is utilized as a methyl donor when folate intake is low, 2) the de novo synthesis of phosphatidylcholine is insufficient to maintain choline status when intakes of folate and choline are low, and 3) dietary choline is required by adults in an amount > 250 mg/d to maintain plasma choline and phosphatidylcholine when folate intake is low.  (+info)

*Aspartate transaminase

Example reference ranges are shown below: Alanine transaminase (ALT/ALAT/SGPT) Transaminases PDB: 1AAM​Almo SC, Smith DL, ... Serum AST level, serum ALT (alanine transaminase) level, and their ratio (AST/ALT ratio) are commonly measured clinically as ... AST is similar to alanine transaminase (ALT) in that both enzymes are associated with liver parenchymal cells. The difference ... Aspartate transaminase, as with all transaminases, operates via dual substrate recognition; that is, it is able to recognize ...

*Fatty liver

The serum alanine transaminase level usually is greater than the aspartate transaminase level in the nonalcoholic variant and ...

*Liver disease

serum proteins, serum albumin, serum globulin, alanine transaminase, aspartate transaminase, prothrombin time, partial ...

*Alanine transaminase

... (ALT) is a transaminase enzyme (EC 2.6.1.2). It is also called alanine aminotransferase (ALAT) and was ... Alanine transaminase shows a marked diurnal variation.[citation needed] The ratio of ALT to AST (aspartate aminotransferase) ... It catalyzes the two parts of the alanine cycle. Serum ALT level, serum AST (aspartate transaminase) level, and their ratio ( ... Red Cross Donor Requirements Clin Chem 2000;46:2027-2049 Alanine transaminase at the US National Library of Medicine Medical ...

*Alanine-oxomalonate transaminase

Other names in common use include alanine-oxomalonate aminotransferase, L-alanine-ketomalonate transaminase, and alanine- ... In enzymology, an alanine-oxomalonate transaminase (EC 2.6.1.47) is an enzyme that catalyzes the chemical reaction L-alanine + ... This enzyme belongs to the family of transferases, specifically the transaminases, which transfer nitrogenous groups. The ... ketomalonate (mesoxalate) transaminase. It employs one cofactor, pyridoxal phosphate. Nagayama H, Muramatsu M, Shimura K (1958 ...

*Alanine-glyoxylate transaminase

... alanine-glyoxylic aminotransferase, and L-alanine-glycine transaminase. This enzyme participates in alanine and aspartate ... In enzymology, an alanine-glyoxylate transaminase (EC 2.6.1.44) is an enzyme that catalyzes the chemical reaction L-alanine + ... The systematic name of this enzyme class is L-alanine:glyoxylate aminotransferase. Other names in common use include AGT, ... Noguchi T, Okuno E, Takada Y, Minatogawa Y, Okai K, Kido R (1978). "Characteristics of hepatic alanine-glyoxylate ...

*Beta-alanine-pyruvate transaminase

Other names in common use include beta-alanine-pyruvate aminotransferase, and beta-alanine-alpha-alanine transaminase. This ... In enzymology, a beta-alanine-pyruvate transaminase (EC 2.6.1.18) is an enzyme that catalyzes the chemical reaction L-alanine ... the two substrates of this enzyme are L-alanine and 3-oxopropanoate, whereas its two products are pyruvate and beta-alanine. ... HAYAISHI O, NISHIZUKA Y, TATIBANA M, TAKESHITA M, KUNO S (1961). "Enzymatic studies on the metabolism of beta-alanine". J. Biol ...

*Alanine-oxo-acid transaminase

Other names in common use include L-alanine-alpha-keto acid aminotransferase, leucine-alanine transaminase, alanine-keto acid ... In enzymology, an alanine-oxo-acid transaminase (EC 2.6.1.12) is an enzyme that catalyzes the chemical reaction L-alanine + a 2 ... Wilson DG, King KW, Burris RH (1954). "Transaminase reactions in plants" (PDF). J. Biol. Chem. 208 (2): 863-874. Molecular and ... ALTENBERN RA, HOUSEWRIGHT RD (1953). "Transaminases in smooth Brucella abortus, strain 19" (PDF). J. Biol. Chem. 204 (1): 159- ...

*Pyruvic acid

Transamination by alanine transaminase produces alanine. Reduction by lactate dehydrogenase produces lactate. Pyruvate is sold ... It can also be used to construct the amino acid alanine and can be converted into ethanol or lactic acid via fermentation. ... to the amino acid alanine, and to ethanol. Therefore, it unites several key metabolic processes. In glycolysis, ...

*Serine-pyruvate transaminase

Other names in common use include SPT, and hydroxypyruvate:L-alanine transaminase. This enzyme participates in glycine, serine ... In enzymology, a serine-pyruvate transaminase (EC 2.6.1.51) is an enzyme that catalyzes the chemical reaction L-serine + ... Sallach HJ (1956). "Formation of serine from hydroxypyruvate and L-alanine". J. Biol. Chem. 223: 1101-1108. Molecular and ... This enzyme belongs to the family of transferases, specifically the transaminases, which transfer nitrogenous groups. The ...

*Cefovecin

Mildly increased serum alanine transaminase (ALT) and gamma-glutamyltransferase may also occur. Other reported events in dogs ...

*Ribociclib

16%). The drug also increases QT time and liver enzymes (alanine transaminase, aspartate transaminase). As ribociclib is mainly ...

*Elevated transaminases

The two transaminases commonly measured are alanine transaminase (ALT) and aspartate transaminase (AST). These levels ... In medicine, the presence of elevated transaminases, commonly the transaminases alanine transaminase (ALT) and aspartate ... Elevated transaminases that persist less than six months are termed 'acute' in nature, and those values that persist for six ... The liver has transaminases to synthesize and break down amino acids and to convert energy storage molecules. The ...

*Dicarboxylic aminoaciduria

Below is an example of how glutamate is used to synthesize alanine via alanine transaminase. Glutamate + pyruvate ⇌ α- ... ketoglutarate + Alanine Another example is the conversion of aspartate to glutamate via the enzyme aspartate transaminase. ... In the case of dicarboxylic aminoaciduria, where glutamate and aspartate transport are impaired, the alanine, aspartate and ...

*Phenelzine

... of which are alanine transaminase (ALA-T), and γ-Aminobutyric acid transaminase (GABA-T), the latter of which is not caused by ... "Effects of the antidepressant/antipanic drug phenelzine on alanine and alanine transaminase in rat brain". Cellular and ... Transaminases such as GABA-transaminase have been shown to be dependent upon vitamin B6 and may be involved in a potentially ... phenelzine causes an increase in the alanine and GABA levels in the brain and body. GABA is the major inhibitory ...

*Ruxolitinib

Laboratory abnormalities have included alanine transaminase (ALT) abnormalities, aspartate transaminase (AST) abnormalities, ...

*Wilson's disease

Most have slightly abnormal liver function tests such as a raised aspartate transaminase, alanine transaminase and bilirubin ...

*AST/ALT ratio

Aspartate transaminase Alanine transaminase Liver function tests Elevated transaminases Nyblom H, Berggren U, Balldin J, Olsson ... The AST/ALT ratio is the ratio between the concentrations of the enzymes aspartate transaminase (AST) and alanine transaminase ... De Ritis F, Coltorti M, Giusti G (July 2006). "An enzymic test for the diagnosis of viral hepatitis: the transaminase serum ...

*Tocilizumab

The enzyme alanine transaminase was also elevated in at least 5% of patients, but in most cases without symptoms. Elevated ...

*TBC1D10A

... alanine transaminase and alkaline phosphatase levels. GRCh38: Ensembl release 89: ENSG00000099992 - Ensembl, May 2017 GRCm38: ...

*Pirfenidone

... can increase hepatic enzyme levels, especially those of aspartate transaminase (AST), alanine transaminase (ALT) ...

*Alpha-Ketoglutaric acid

The alanine transaminase (ALT) enzyme converts α-Ketoglutarate and L-alanine to L-glutamate and pyruvate, respectively, as a ...

*Thioacetamide

... which include elevation in the levels of serum alanine transaminase, aspartate transaminase and aspartic acid. Schwarz, G. ( ...

*Transaminase

... and alanine transaminase (ALT), also called alanine aminotransferase (ALAT) or serum glutamate-pyruvate transaminase (SGPT). ... Two important transaminase enzymes are aspartate transaminase (AST), also known as serum glutamic oxaloacetic transaminase ( ... This alanine cycle is analogous to the Cori cycle, which allows anaerobic metabolism by muscles. The transaminase enzymes are ... Valproic acid - a GABA transaminase inhibitor KARMEN, A; WROBLEWSKI, F; LADUE, JS (January 1955). "Transaminase activity in ...

*Mirror syndrome

Platelet count, aspartate transaminase, alanine transaminase, and haptoglobin are usually unaffected and may be used to ...

*Asparagine-oxo-acid transaminase

This enzyme participates in alanine and aspartate metabolism and tetracycline biosynthesis. It employs one cofactor, pyridoxal ... In enzymology, an asparagine-oxo-acid transaminase (EC 2.6.1.14) is an enzyme that catalyzes the chemical reaction L-asparagine ... This enzyme belongs to the family of transferases, specifically the transaminases, which transfer nitrogenous groups. The ...

*Non-alcoholic fatty liver disease

While many treatments appear to improve biochemical markers such as alanine transaminase levels, most have not been shown to ...
Aoki, Y.-h., Ohkoshi, S., Yamagiwa, S., Yano, M., Takahashi, H., Waguri, N., Igarashi, K., Sugitani, S.-i., Takahashi, T., Ishikawa, T., Kamimura, T., Wakabayashi, H., Watanabe, T., Matsuda, Y., Nomoto, M. and Aoyagi, Y. (2011), Characterization of elevated alanine aminotransferase levels during pegylated-interferon α-2b plus ribavirin treatment for chronic hepatitis C. Hepatology Research, 41: 118-125. doi: 10.1111/j.1872-034X.2010.00749.x ...
Background: About 25% of patients with chronic hepatitis C virus (HCV) infection have persistently normal alanine aminotransferase (ALT) values (1). No agreement about management of these patients exists (2). The standard of care for chronic HCV infection is the combination of peginterferon plus ribavirin, and the addition of amantadine may increase the virologic response (3, 4). However, optimal treatment in patients with persistently normal ALT levels has not been investigated ...
Phenobarbital (PB) therapy is frequently associated with elevated serum alanine aminotransferase (ALT) and alkaline phosphatase (AP) activities in dogs without clinical signs of liver disease. The goal of this study was to determine if increased serum ALT and AP activities in clinically healthy PB-treated epileptic dogs are due to hepatic enzyme induction or to subclinical liver injury. Liver biopsies were obtained from 12 PB-treated dogs without clinical signs of liver disease but with elevated Show morePhenobarbital (PB) therapy is frequently associated with elevated serum alanine aminotransferase (ALT) and alkaline phosphatase (AP) activities in dogs without clinical signs of liver disease. The goal of this study was to determine if increased serum ALT and AP activities in clinically healthy PB-treated epileptic dogs are due to hepatic enzyme induction or to subclinical liver injury. Liver biopsies were obtained from 12 PB-treated dogs without clinical signs of liver disease but with elevated ...
Results: Risk factors for ALT elevation differed by gender. Predictor variables that were significantly associated with ALT elevation in both sexes included; elevated baseline ALT level [β=10.14 (95%CI 7.34- 12.96); P,0.001], [β=13.52 (95%CI 9.36 -17.68); P , 0.001] and renal disease [β=5.44 (95%CI 2.62 - 8.25); P ,0.001], [β=11.52 (95%CI 3.46 - 19.60); P = 0.005] in females and males respectively. Ethnicity had a protective effect in both sexes; [β-6.61(95%CI- 9.28, -3.93); P, 0.001] in males and [β-1.20 (95% CI-2.39, -0.01); P= 0.048] in females. Among the different ethnic groups, Nilotes and Cushites had lower ALT levels compared to Bantus. Other factors that were significant included; smoking (P=0.001), concurrent illnesses (P=0.045), previous adverse drug reactions (P=0.040) in females and a longer duration of anti-retroviral therapy [β 1.81(95%CI 0.89 - 2.73); P , 0.001] in males. Poor adherence had a protective effect [β -1.62(95%CI -3.20, -0.04); P=0.045] among females, whereas ...
Previous animal studies have shown that Curcuma longa (turmeric) improves liver function. Turmeric may thus be a promising ingredient in functional foods aimed at improving liver function. The purpose of the study is to investigate the hepatoprotective effect of fermented turmeric powder (FTP) on liver function in subjects with elevated alanine transaminase (ALT) levels. A randomised, double-blind, placebo-controlled trial was conducted between November 2010 and April 2012 at the clinical trial center for functional foods of the Chonbuk National University Hospital. The trial included 60 subjects, 20 years old and above, who were diagnosed mild to moderate elevated ALT levels between 40 IU/L and 200 IU/L. Sixty subjects were randomised to receive FTP 3.0 g per day or placebo 3.0 g per day for 12 weeks. The treatment group received two capsules of FTP three times a day after meals, for 12 weeks. The primary efficacy endpoint was change in the ALT levels in the two groups. The secondary efficacy endpoints
The clinical pharmacokinetics of etoposide were studied in eight pediatric patients with refractory solid tumors. The α-phase half-life, β-phase half-life, volume of distribution, and elimination rate constant averaged 0.82 hr, 6.5 hr, 4.0 liters/sq m, and 0.25 hr-1, respectively. Noncompartmental parameters such as systemic clearance, mean residence time, and volume of distribution at steady-state averaged 20.9 ml/min/sq m, 7.8 hr, and 7.2 liters/sq m, respectively. A significant relationship between serum glutamic pyruvic transaminase and systemic clearance was observed, with patients having elevated serum glutamic pyruvic transaminase showing slower systemic clearance of etoposide. Systemic clearance, mean residence time, and β-phase half-life of etoposide were significantly lower in those patients who had received cisplatin prior to their Phase II etoposide trial. The average pharmacokinetic values derived from these eight pediatric patients with solid tumors did not differ significantly ...
Hepatitis Research and Treatment is a peer-reviewed, Open Access journal that publishes original research articles, review articles, and clinical studies related to all aspects of hepatitis.
Some chronic hepatitis C (CHC) patients exhibit persistently normal alanine aminotransferase (ALT) levels (PNAL). Patients with PNAL experience significantly milder disease. In order to understand the differences between CHC patients with elevated ALT levels compared with those with PNAL better, we compared epidemiological, immunological and histological findings, in particular, the value of proliferating hepatocyte activity (PCNA) between the two groups of patients. We studied 40 chronic hepatitis C virus (HCV) carriers with increased ALT who underwent liver biopsy for histological diagnosis and determination of clinical prognosis, and 24 PNAL patients under follow-up for 10 years. Immunological response to different HCV genomic epitopes was tested in both the control group and in PNAL subjects. PCNA values from liver specimens of all patients as well as liver biopsies of PNAL patients at time points 0 and 5 years were calculated according to Hall et al.Age, sex and body mass index (BMI) were ...
To the editor: Previous studies (1, 2) have established a direct relation between elevated alanine aminotransferase (ALT) levels in donor blood and the risk for post-transfusion hepatitis. In an independent study (3), we determined the extent to which continuing transaminase elevation is a manifestation of chronic persistent hepatitis (non-A, non-B chronic persistent hepatitis) or of insignificant steatosis.. Of 103 patients with persistent or intermittent asymptomatic transaminase elevation, no patient had acute or chronic infectious hepatitis, autoimmune hepatitis, primary biliary cirrhosis, or thesaurismosis, or was receiving hepatotoxic drugs. Seronegative chronic hepatitis (group 1) was differentiated from steatosis (group 2) by biopsy means. The histologic findings in group 1 were mild portal infiltration rich in lymphocytes and plasma cells, and lymph follicles with germinal centers and bile duct lesions.. Group 1 comprised 46 patients with different modes of infection (posttransfusion h ...
Introduction: Cardiovascular diseases (CVD) are major causes of mortality among U.S. Hispanic/Latino farmworkers. Since Hispanics/Latinos, in general, are twice as likely as non-Hispanic whites to have elevated alanine aminotransferase (ALT), a biomarker of suspected nonalcoholic fatty liver disease, it is vital to understand the CVD risk factor-ALT relationship in Hispanic/Latino farmworkers. This study investigated the elevated ALT status in Hispanic/Latino farmworkers and the relationships between ALT and CVD risk markers.Methods: In 210 Hispanic/Latino farmworkers (48% female; aged 35.2 ± 9.2 years), fasting blood samples were measured for serum ALT, and elevated ALT was defined by | 43 U/L. CVD risk markers were measured with standard methods and defined according to the definitions of metabolic syndrome.Results: The overall prevalence for elevated ALT was 12.4%. Significant linear upward trends across tertiles of serum ALT were observed for body mass index, waist circumference, fasting glucose
Case Reports in Hepatology is a peer-reviewed, Open Access journal that publishes case reports and case series related to the management of disorders affecting the liver, gallbladder, biliary tree, and pancreas.
Between December 1990 and August 1998, 19 patients with acute hepatitis B were admitted to our institution. A diagnosis of acute hepatitis B was based on elevated serum alanine aminotransferase activity, detection of HBsAg and immunoglobulin M antibody to hepatitis B core antigen (anti-HBc) in the serum, and the recent onset of jaundice and other typical symptoms. Coinfection with hepatitis A, C, D, or E; Epstein-Barr virus; or cytomegalovirus was ruled out because of the negative results of serologic tests. Confounding etiology of liver disease, human immunodeficiency virus infection, and other immunodeficient diseases were not found in any patient. In 2000, this complete series of patients with acute hepatitis B was contacted for follow-up. Fourteen patients (74%) revisited our institution and were reevaluated for clinical, serologic, histologic, and virologic recovery from the disease. The group comprised 11 men and 3 women ranging in age from 26 to 65 years (median, 43 years). All patients ...
Diabetes is a less-recognized association of hepatitis-C virus (HCV) infection, although several recent studies provide data linking HCV infection and diabetes (1-5). To investigate whether patients with chronic HCV infection without evidence of cirrhosis have an increased risk of diabetes, we conducted a case-control study in 44 consecutive eligible patients with HCV infection and no clinical or histological evidence of cirrhosis and in 20 control subjects without liver disease who were matched by age, sex, and BMI. All 44 patients with chronic HCV infection had biochemical evidence of ongoing inflamation with elevated alanine aminotransferase activity and histologic confirmation. There was no evidence of decompensated liver disease. No patient received any antiviral, immunomodulatory, or immunosuppressive therapy. Immunoreactive insulin was determined by double-antibody radiomimmunosassay (Coat-a-count; Diagnostic Products, Los Angeles, CA). Serum leptin level was determined by the ...
Management of Chronic Viral Hepatitis is an A5 sized multiauthor textbook of over 300 pages which forms one of eight books in a gastroenterology and hepatology series. Curiously, the only other hepatological title in this series is a book entitled Viral Hepatitis: Diagnosis, Treatment, Prevention by a different editor. The stated intention of the book is to bring the recent advances in clinical and basic research into the doctors office. Through the use of clinical vignettes, it tries to cover some of the recent advances in the treatment of viral hepatitis and to demonstrate how these treatments are incorporated into everyday practice. This is a good idea, which works well, particularly in those chapters concerning treatment. In addition to looking at the general treatment of viral hepatitis, the book also has informative chapters on specific disease subsets such as those with chronic hepatitis C and normal alanine aminotransferase levels or those with human immunodeficiency virus (HIV) and ...
The changes in the gut microbiota of healthy hepatitis B virus (HBV) carriers, including asymptomatic and non-cirrhotic subjects, have been rarely scrutinized. From 1463 faecal samples in health examinees, in total 112 subjects, including 36 hepatitis B surface antigen (HBsAg)-positive and 76 control subjects, were included. Twenty-eight of 36 HBsAg-positive individuals (78%) showed normal alanine aminotransferase (ALT) levels (normal ALT group), whereas eight subjects exhibited elevated ALT levels (22%, high ALT group). By using 16S rRNA gene sequencing, the distance between normal and high ALT groups among HBsAg-positive subjects showed a significant separation after the pairwise comparison of weighted UniFrac distance (permutational analysis of variance q-value = 0.039), when compared with the distances to the control group. In comparison with the control group, the normal ALT group had Anaerostipes as a significant taxon that showed a positive association (Coefficient (Coef.) = 0.028, q = 0.039).
An alanine aminotransferase (ALT) test measures the amount of this enzyme in the blood. ALT is found mainly in the liver, but also in smaller amounts in the kidneys, heart, muscles, and pancreas. ALT was formerly called serum glutamic pyruvic transaminase (SGPT).. ALT is measured to see if the liver is damaged or diseased. Low levels of ALT are normally found in the blood. But when the liver is damaged or diseased, it releases ALT into the bloodstream, which makes ALT levels go up. Most increases in ALT levels are caused by liver damage.. The ALT test is often done along with other tests that check for liver damage, including aspartate aminotransferase (AST), alkaline phosphatase, lactate dehydrogenase (LDH), and bilirubin. Both ALT and AST levels are reliable tests for liver damage.. ...
Percentage of overall number of adverse events experienced during Weeks 0-144 by adverse event type. Doctors asked participants for adverse events, grouped them into categories given in the electronic case report form (eCRF). The list of adverse events included in the eCRF were hypertriglyceridemia, hypercholesterolemia, low high density lipoprotein (HDL) cholesterol, high low density lipoprotein (LDL) cholesterol, hyperglycemia, hyperbilirubinemia, elevated aspartate aminotransferase (AST), elevated alanine aminotransferase (ALT), elevated gamma glutamyl transferase (γGT), elevated alkaline phosphatase, stomatitis, nausea, vomiting, diarrhea, abdominal pain, mood disorder, neurocerebellar disorder, neurocontrol disorder, headache, fatigue, fever, other (listed as 'not specified&apos ...
Percentage of overall number of adverse events experienced during Weeks 0-144 by adverse event type. Doctors asked participants for adverse events, grouped them into categories given in the electronic case report form (eCRF). The list of adverse events included in the eCRF were hypertriglyceridemia, hypercholesterolemia, low high density lipoprotein (HDL) cholesterol, high low density lipoprotein (LDL) cholesterol, hyperglycemia, hyperbilirubinemia, elevated aspartate aminotransferase (AST), elevated alanine aminotransferase (ALT), elevated gamma glutamyl transferase (γGT), elevated alkaline phosphatase, stomatitis, nausea, vomiting, diarrhea, abdominal pain, mood disorder, neurocerebellar disorder, neurocontrol disorder, headache, fatigue, fever, other (listed as not specified ...
Diagnosis and monitoring of liver disease associated with hepatic necrosisAlanine transaminase (ALT) is also called alanine aminotransferase (ALAT) and was formerly called serum glutamate-pyruvate transaminase (SGPT) or serum glutamic-pyruvic transaminase (SGPT). ALT is found in plasma and in various body tissues, but is most common in the liver. This test is commonly measured clinically as biomarkers for liver health. The tests is a are part of Liver function test (LFT). ...
Reference: Ilin V.S., Kovner F.Ia., Hexokinase, aspartate and alanine aminotransferase activity in transplanted rat sarcomas, Voprosy meditsinskoi khimii, 1971, vol: 17(6), 644-649 ...
Miriam Vos, MD, from Emory University and Childrens Healthcare in Atlanta, Georgia, and colleagues reviewed data on 10,359 adolescents 12 to 18 years of age from the National Health and Examination Survey, spanning 1988 to 2008. Suspected NAFLD was defined as a body mass index at least in the 85th percentile and elevated alanine aminotransferase (ALT; above 25.8 U/L for boys and above 22.1 U/L for girls). To allow for comparisons with earlier studies, they also analyzed the data based on ALT levels above 30.0 U/L ...
SGPT/Serum Glutamic Pyruvic Transaminase (Alanine Transaminase /ALT) adalah enzim yang ditemukan terutama di sel-sel hati dan ginjal, dan dalam jumlah yang lebih kecil ditemukan di jantung dan otot ...
Lutful Haque Saran, Mohsina Mukti, Md. Reyad-Ul-Ferdous*, A. H. M. Mahmudur Rahman, Md. Mamun- Ur- Rashid, Naim Islam, Adnan Taher. ABSTRACT. Objective: In recent era diabetics becomes most pathological condition worldwide. Maximum populations in both develop and developing countries suffering from diabetic. There are several diseases associated with diabetics like as kidney, liver, heart diseases etc. Methods: In this study, retrospectively study conducted at BUSB. Then data were entered into computer and results were calculated with the help of Microsoft Excel. Results: In the study, it has been found that the percentage of female is found to be 53% with diabetes and the percentage of male is found to be 46%.The level of Serum glutamic pyruvic transaminase (SGPT) also called (Alanin Transaminase) is found to be relatively high amongst the diabetes patient who reflects that the liver problems are prominent amongst diabetes patients. The average value of alanine transaminase which is released ...
SGPT, or serum glutamic pyruvic transaminase, is an enzyme that enters the blood when the heart or liver are damaged, according to MedicineNet. When a condition like hepatitis C causes damage to the...
The investigators reported that of 5780 eligible persons aged 18 to 75 years, 3345 agreed to participate in the study.. The team defined subjects with suspected liver disease on the basis of elevated serum alanine aminotransferase and -glutamyl-transferase activity.. Suspected liver disease was also defined on the basis of hepatitis B surface antigen, or hepatitis C virus-RNA positivity.. The subjects were matched with randomly selected subjects of the same age and sex without suspected liver disease.. The investigators reported that 311 subjects with and 287 without suspected liver disease underwent clinical, laboratory, and anthropometrical evaluation.. Fatty liver was diagnosed by ultrasonography, and alcohol intake was assessed by using a 7-day diary.. The investigative team used multinomial logistic regression to detect risk factors for normal liver versus nonalcoholic fatty liver disease and vice versa.. The investigators found that the prevalence of nonalcoholic fatty liver disease was ...
Definition : Clinical chemistry reagents intended to perform qualitative and/or quantitative chemical analyses of body fluids (typically serum) to determine the level of the enzyme alanine transferase (ALT), also known as alanine aminotransferase. ALT in serum is typically increased in liver diseases associated with hepatic necrosis, such as viral hepatitis and infectious mononucleosis with involvement of the liver.. Entry Terms : "Glutamic-Pyruvic Transaminase (GPT) Reagents" , "ALT (Alanine Transferase) Determination Reagents" , "Alanine Transferase (ALT) Determination Reagents" , "Alanine Transaminase Reagents" , "Alanine Amino-Transferase Determination Reagents" , "Alanine Aminotransferase Determination Reagents" , "Reagents, Clinical Chemistry, Enzyme, Alanine Transferase". UMDC code : 18872 ...
Acute and chronic liver injuries increase serum concentrations of aspartate aminotransferase (AST) and alanine aminotransferase (ALT). Abnormal AST and ALT liver enzymes may signal liver damage. ALT elevation is more specific for liver damage because AST is present in the heart, skeletal muscle, kidneys, brain, and red blood cells. AST and ALT elevations greater than 10 times the normal limit are associated with acute hepatic injury (eg, toxic liver injury or acute viral hepatitis). Cirrhosis and chronic hepatitis also increase AST and ALT, but not to the same degree as acute injury. AST and ALT levels may be within the normal range in patients with cirrhosis or chronic liver disease. Elevations in alkaline phosphatase (alk phos) and γ-Glutamyl transpeptidase (GGT) may accompany cholestatic liver disease (eg, drug-induced cholestasis, cholangitis). Alk phos and GGT are present in other tissues; therefore, they lack specificity for liver disease. Though also nonspecific for liver disease, ...
Primate model of sepsis. (a) Lethal E. coli infusion alone. (b) Lethal E.coli plus Activated Protein C infusion. SGPT, serum glutamic pyruvic transaminase (indi
alaA; glutamate-pyruvate aminotransferase; glutamic-pyruvic transaminase (GPT); alanine transaminase; K14260 alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2] ...
alaA; glutamate-pyruvate aminotransferase; glutamic-pyruvic transaminase (GPT); alanine transaminase; K14260 alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2] ...
Alanine aminotransferase (ALT or GPT) test Liver Function Panel Colorimetric Technique General Concept 1) Names:- Formal name: Alanine Aminotransferase and abbreviated as (ALT) Also known as: Serum Glutamic-Pyruvic Transaminase; SGPT; GPT; Alanine Transaminase. 2) What is the ALT? Read about it... Continue reading → ...
Purpose: It has been shown that liver fibrosis, and even cirrhosis, may be reversible in humans. For this reason there is a great need for the imminent introduction of non-invasive and clinically useful methods in order to monitor fibrosis in patients [1, 2]. A body of evidence points to the fact that MRE is a highly useful candidate towards this end [3]. However, before using such techniques more widely, it is important to verify that comparable physical measures are provided by alternative and clinically relevant MRE approaches. The aim of this pilot study was to compare 2D and 3D MRE, also known as MR Rheology, using a commercially available 2D system, with an acoustic transducer, and 3D MRE research system, with an electromagnetic transducer, with respect to liver stiffness and elasticity in patients with diffuse or suspected diffuse liver disease. Materials and Methods: Seven patients, referred to our hospital for evaluation of elevated serum alanine aminotransferase (ALT) and/or alkaline ...
abbr. (in clinical biochemistry): ALT; EC 2.6.1.2; systematic name: l‐alanine:2‐oxoglutarate aminotransferase; other names: glutamic‐pyruvic transaminase; glutamic‐alanine transaminase. An enzyme that catalyses the reversible reaction:. l‐alanine + 2‐oxoglutarate = pyruvate + l‐glutamate.. [...] ...
Endotoxin-mediated proinflammatory cytokines play a significant role in the pathogenesis of acute and chronic liver diseases. Heat shock protein 90 (molecular weight, 90 kDa) (hsp90) functions as an important chaperone of lipopolysaccharide (LPS) signaling and is required for the production of proinflammatory cytokines. We hypothesized that inhibition of hsp90 would prevent LPS-induced liver injury by decreasing proinflammatory cytokines. C57BL/6 mice were injected intraperitoneally with an hsp90 inhibitor, 17-dimethylamino-ethylamino-17-demethoxygeldanamycin (17-DMAG), and LPS. Parameters of liver injury, proinflammatory cytokines, and associated mechanisms were studied by in vivo and in vitro experiments. Inhibition of hsp90 by 17-DMAG prevented LPS-induced increases in serum alanine aminotransferase activity and significantly reduced serum tumor necrosis factor alpha (TNFalpha) and interleukin-6 (IL-6) protein as well as messenger RNA (mRNA) in liver. Enhanced DNA-binding activity of heat shock
Pazopanib is a multitargeted tyrosine kinase inhibitor that is approved for the treatment of advanced renal cell carcinoma and soft tissue sarcomas. However, treatment of patients with advanced disease can be challenging due to impaired liver function from metastasis. Pazopanibs package insert has a black box warning due to severe and fatal hepatotoxicity observed in clinical trials and currently there is limited information regarding pazopanib in patients with liver dysfunction. In a phase I study of pazopanib in patients with advanced hepatocellular carcinoma, the maximum-tolerated dose was determined to be 600 mg per day. Evidence of antitumor activity was seen at this dose; however, the 800 mg per day dose was not tolerable due to dose-limiting toxicities of grade 3 malaise and grade 3 AST/ALT elevation. Liver abnormalities were seen in a majority of the patients with hepatocellular carcinoma treated with pazopanib. AST elevation was seen in 63% of the patients. ALT elevation occurred in ...
Alanine Transaminase antibody LS-C100675 is an unconjugated rabbit polyclonal antibody to human Alanine Transaminase (GPT ). Validated for Flow, IHC and WB.
Alanine Transaminase antibody LS-C292687 is an unconjugated rabbit polyclonal antibody to rat Alanine Transaminase (GPT ). Validated for WB.
The Mammalian Phenotype (MP) Ontology is a community effort to provide standard terms for annotating phenotypic data. You can use this browser to view terms, definitions, and term relationships in a hierarchical display. Links to summary annotated phenotype data at MGI are provided in Term Detail reports.
The Mammalian Phenotype (MP) Ontology is a community effort to provide standard terms for annotating phenotypic data. You can use this browser to view terms, definitions, and term relationships in a hierarchical display. Links to summary annotated phenotype data at MGI are provided in Term Detail reports.
Of the 275 participants, 88 (32%) had HIV infection, 76% were black, and 67% were men. The group averaged 58 years in age, and time from HCV diagnosis to SVR averaged 9.3 years. Time since SVR averaged 18 months. HAI fibrosis stages were 0-1 in 60%, 2-3 in 27%, and 4 in 13%. Thirty-two people (12%) had cirrhosis, and 69 (31%) had grade 1 or worse steatosis. More than half of participants, 58%, had a history of injecting drugs ...
SGPT blood test is a test used to measure the amount of the enzyme glutamate pyruvate transaminase in blood serum. Know significance, benefits & features.
Of 446 patient charts reviewed, 280 patients were treatment-na ve, and were judged to have no contraindications to receiving interferon-based therapy.. Of these, 115 opted to defer treatment, and are the subject of this analysis.. The team found women declining therapy outnumbered men by approximately 3 to 2.. Middle-aged patients were most likely to choose expectant therapy compared with older or younger individuals.. The team found that the 48% of African American patients who deferred therapy vs 37% of non-African American patients.. More than 90% of the patients choosing to be followed were genotype 1.. The team noted that peak alanine aminotransferase values were normal in 37%, and less than 2 times the upper limits of normal in another 40%.. The estimated duration of chronic Hepatitis C infection was over 16 years in approximately 75% of individuals.. The investigators found that the most common source of the patients infection was intravenous drug use followed by ...
Alanine transaminase mildly elevated chronic hepatitis disease activity,For the HBsAg positive patients with normal aminotransferase, we are called HBV carriers. One of the HBV DNA positive we referred to as chro
Grantham, James P; Staub, Kaspar; Rühli, Frank J; Henneberg, Maciej (2014). Metabolic Cause of Obesity: The Role of Alanine Transaminase in Increasing BMI, Cholesterol, Blood Pressure and Blood Glucose. In: Bose, Kaushik; Chakraborty, Raja. Health Consequences of Human Central Obesity (Public Health in the 21st Century). Hauppauge NY: Nova Science Pub Inc, 1-20. ...
Alanine aminotransferase (ALT) measurements are useful in the diagnosis and treatment of certain liver diseases, e.g., viral hepatitis and cirrhosis and heart disease. ALT is an enzyme involved in amino acid metabolism and is, therefore, found in many tissues. Tissue destruction leads to the release of the intracellular enzyme into the circulating blood. Markedly elevated serum ALT levels may be found in a variety of diseases which involve the liver, such as hepatitis, mononucleosis and cirrhosis. These very high levels of ALT are not usually observed in other disease processes, e.g. myocardial infarction, thus ALT is regarded as a reasonably specific indicator of liver disease ...
1. Kim W, Flamm SL, Di Bisceglie AM, Bodenheimer HC. Serum activity of alanine aminotransferase (ALT) as an indicator of health and disease. Hepatology. 2008;47(4):1363-1370 2. Schwartz MK. [261c] Clinical aspects of aspartate and alanine aminotransferases. Methods in enzymology. 1971;17:866-875 3. Giannini EG, Testa R, Savarino V. Liver enzyme alteration: a guide for clinicians. Canadian medical association journal. 2005;172(3):367-379 4. Clark JM, Brancati FL, Diehl AM. The prevalence and etiology of elevated aminotransferase levels in the United States. The American journal of gastroenterology. 2003;98(5):960-967 5. Eckel RH, Grundy SM, Zimmet PZ. The metabolic syndrome. The Lancet. 2005;365(9468):1415-1428 6. Yun JE, Kim SY, Kang H-C, Lee SJ, Kimm H, Jee SH. Alanine aminotransferase is associated with metabolic syndrome independently of insulin resistance. Circulation journal: official journal of the Japanese Circulation Society. 2010;75(4):964-969 7. Liu Z, Hu Y, Yang X, Tan A, Gao Y, Qin ...
He told me to lose weight, eliminate fatty foods and alcohol and that I may live another 10 years. Because it sure feels like it. Now i wanted to what are symptoms of liver damage know if these little red spots on my body that are popping up over the last 4-5years have anything to do with this. Ive had my gallbladder removed (due to numerous stones - and paper thin gallbladder) at least a year ago, then had to go back to ER two weeks later due to stones being do kidney problems cause back pain left inside me and had to have stint placed for awhile. Abdominal pain, that goes to the back shoulder blade.. In a study of 145 healthy subjects who were randomized to receive placebo or 4 grams of Tylenol daily for two weeks, subjects in the placebo group experienced no elevations of ALT, a liver enzyme, but 33%-44% of the subjects in the Tylenol group had ALT elevations greater than three times the upper limits of normal. There are alot of symptons that I have with my liver disease and then alot of ...
Patients with pre-existing acute or chronic liver disease, or those with serum ALT ,2 times the upper limit of normal (ULN) before initiating treatment, should not normally be treated with AUBAGIO. In clinical trials, if ALT elevation was ,3 times the ULN on 2 consecutive tests, patients discontinued AUBAGIO and underwent accelerated elimination. Consider additional monitoring if co-administering AUBAGIO with other potentially hepatotoxic drugs; monitor patients who develop symptoms suggestive of hepatic dysfunction (eg, unexplained nausea, vomiting, abdominal pain, fatigue, anorexia, or jaundice and/or dark urine).. Before starting therapy, use of reliable contraception must be confirmed, and the patient counseled on risks to the fetus. Patients with delayed onset of menses or other reason to suspect pregnancy should immediately see their physician for pregnancy testing. Patients who become pregnant or wish to become pregnant should discontinue treatment, followed by accelerated elimination ...
Objective To study the effect of fast food-based hyper-alimentation on liver enzymes and hepatic triglyceride content (HTGC).. Design Prospective interventional study with parallel control group.. Setting University Hospital of Linkoping, Sweden. Participants 12 healthy men and six healthy women with a mean (SD) age of 26 (6.6) years and a matched control group.. Intervention Subjects in the intervention group aimed for a body weight increase of 5-15% by eating at least two fast food-based meals a day with the goal to double the regular caloric intake in combination with adoption of a sedentary lifestyle for four weeks. Main outcome measures Weekly changes of serum aminotransferases and HTGC measured by proton nuclear magnetic resonance-spectroscopy at baseline and after the intervention. Results Subjects in the intervention group increased from 67.6 (9.1) kg to 74.0 (11) kg in weight (p,0.001). Serum ALT increased from 22.1 (11.4) U/l at study start to an individual mean maximum level of 97 ...
A previously described digitonin-perfusion technique [Quistorff, Grunnet & Cornell (1985) Biochem. J. 226, 289-297], by which intracellular material of rat liver could be liberated, has been refined, now allowing release of cytosol of high purity from both periportal and perivenous parts of the same liver. The cytosolic fractions are obtained by perfusing the liver for short intervals (10-20 s) with digitonin (4-5 mg/ml), first in the normal perfusion direction and then, after an interval of 1-2 min, in the retrograde direction, the eluate being collected during and after both intervals. The technique is termed dual-digitonin-pulse perfusion. The eluate fractions showed a peak specific activity of the cytosolic enzymes alanine aminotransferase (ALAT), lactate dehydrogenase (LDH) and pyruvate kinase (PK) of 3-5-fold higher than obtained in a biopsy from the same liver. For glutamine synthetase (GS) a 10-fold higher specific activity was obtained. Zonation, defined as the ratio of the specific ...
Feeling ALANINE AMINOTRANSFERASE INCREASED while using Thyroid? ALANINE AMINOTRANSFERASE INCREASED Causes, Patient Concerns and Latest Treatments and Thyroid Reports and Side Effects.
Purpose RGB-286638 is a multi-targeted inhibitor with targets comprising the family of cyclin dependent kinases (CDKs) and a range of other cancer relevant Tyrosine and Serine/Threonine kinases. The objectives of this first in human trial of RGB-286638, given intravenously on D1-5 every 28 days, were to determine the maximum tolerated dose (MTD) and to evaluate the pharmacokinetic (PK) and pharmacodynamic (PD) profiles of this new drug. Experimental Design Sequential cohorts of 3-6 patients were treated per dose level. Blood, urine samples and skin biopsies for full PK and/or PD analyses were collected. Results Twenty-six patients were enrolled in 6 dose-levels from 10 to 160 mg/day. Four dose limiting toxicities were observed in 2 of the 6 patients enrolled at the highest dose-level. These toxicities were AST/ALT elevations in one patient, paroxysmal SVTs, hypotension, and an increase in Troponin T in another patient. The plasma PK of RGB-286638 was shown to be linear over the studied doses. ...
Alanine amino acid molecule. Alanine is one of the twenty amino acids coded for by DNA. Atoms are colour-coded: carbon black, hydrogen white, nitrogen blue and oxygen red. - Stock Video Clip K002/8714
sgpt - MedHelps sgpt Center for Information, Symptoms, Resources, Treatments and Tools for sgpt. Find sgpt information, treatments for sgpt and sgpt symptoms.
Makalah tentang alat optik beserta gambarnya, makalah fisika alat optik doc, makalah alat optik pdf, makalah tentang alat optik download, makalah alat optik mata, makalah alat optik kamera dalam fisika, materi alat optik fisika, materi optik fisika kelas xi, makalah cahaya dan alat optik. Daftar isi; Pengertian mata, bagian-bagian mata (Kornea, Lensa Krisalin, Iris, Aqueous Humor, Pupil, Retina/Selaput jara, Syaraf Optik, Otot mata, Vitreus humor, Bintik kuning), Pembentukan bayangan pada mata, Jangkauan penglihatan mata, Daya akomodasi mata, Cacat mata, Miopi (Rabun jauh), Hipermetropi (Rabun Dekat), Cacat Mata Presbiopi, Astigmatisma (Mata silindris), Buta warna, Katarak, Cacat mata dapat diatasi dengan Kacamata (Kacamata Berlensa Cekung untuk Miopi, Kacamata Berlensa Cembung untuk Hipermetropi, Kacamata untuk Presbiopi dan Astigmatisma, Lensa kontak). File dalam format docx microsoft word.
Accepted name: β-alanine pyruvate transaminase. Reaction: L-alanine + 3-oxopropanoate = pyruvate + β-alanine. Other name(s): β-alanine-pyruvate aminotransferase; β-alanine-α-alanine transaminase. Systematic name: L-alanine:3-oxopropanoate aminotransferase. Comments: A pyridoxal-phosphate protein.. Links to other databases: BRENDA, EXPASY, GTD, KEGG, Metacyc, PDB, CAS registry number: 61461-61-8. References: 1. Hayaishi, O., Nishizuka, Y., Tatibana, M., Takeshita, M. and Kuno, S. Enzymatic studies on the metabolism of β-alanine. J. Biol. Chem. 236 (1961) 781-790.. 2. Stinson, R.A. and Spencer, M.S. β-Aalanine aminotransferase(s) from a plant source. Biochem. Biophys. Res. Commun. 34 (1969) 120-127. [PMID: 5762452]. ...
Gentaur molecular products has all kinds of products like :search , Ray Biotech \ Recombinant Human Alanine Aminotransferase \ 228-10043-2 for more molecular products just contact us
Everyday From 9 am to 10 pm. EXCEPT Friday from 10 am to 5 pm (Tahrir, Faisal, MT Mohandseen 2(Medical Tower) , Maadi, Heliopolis, Shoubra 2) ...
Question - SGPT 32 mg/ dl and SGOT 30 mg/dl. Should I take medicines?. Ask a Doctor about Alanine transaminase, Ask a Radiologist
List of all the English words with 17 letters not containing letter F. aminophenanthrene, aminophospholipid, aminophosphonates, aminosiloxydienes, aminostratigraphy, aminotransaminase, aminotripeptidase, amitriptylinoxide, amphignathodontid, amphitheatrically
It looks like Im not going to die. Which is good, right? Ahh fuck. Man. Im still going to be here for another week at least. Okay so normal ALT levels are 0 - 40. On tuesday mine was 300. Then on Wednesday instead of dropping they went up to 4900. Then yesterday they dropped to 4300. Which is apparently good news. So now they are pumping me full of this rat poison drug, but its good as far as I know because I guess anything is better than a fucking transplant. But yes, lets hope that more than a third of my liver survives, because then Im toast. The boy came to visit yesterday. He brings lunch for two and we eat. Im slowly coming to terms with us being over. Which is nice of course. But then yesterday he came here and was touching my leg and making inappropriate eye contact. He also did this thing that we used to do when we were still ...
This website uses cookies in order to give you the best possible visitor experience. Please click here to find out more information about how we use cookies and how you can manage them. By continuing to use our website you are consenting to such use of cookies.. ...
dya:Dyak_GE17071 K00814 alanine transaminase [EC:2.6.1.2] , (RefSeq) uncharacterized protein, isoform A (A) MLKNREIMSRMLIKPAAATVSAALQQQQRQQQQYVIRRWKSFLHNNSNNANRRAAKSTAA STAAVAATSQRHGTSGDFIQPLDVRRSFSTSHKMPSSSKALTLDNINPNFIAMEYAVRGP LVIRAGEIEKELEKGVKKPFDQVIRANIGDCHAMGQQPLTFLRQLMALTFETRLLDSPDY PEDVKKRACAILDGCQGQSVGSYTDSAGLEVVRRQVAQYIERRDGGIAADWQNIYLTAGA SPGIKSILSMINSEVGSKPPGVMVPIPQYPLYSATISEYGMTKVDYYLEEETGWSLGRKE LQRSFDEAKKICNPRALVVINPGNPTGQVLTRENIEEIIKFAHDNKVLVLADEVYQDNVY DKNSKFWSFKKVAYEMGEPYRSLEMVSFLSTSKGYLGECGIRGGYMEVLNLDPKVKAMLT KSITAALCSTTAGQVAVSALVNPPQPGEPSYELYKKERDAILAALKERAELVHKALNSFE GYKVNPVQGAMYVFPQIVIPPKAIEAAKAKGMAPDVFYAFELLETSGICIVPGSGFGQKA GTWHFRSTILPQTDKLKLMMEKFRVFHTEFMKKYK ...
mtm:MYCTH_2306437 K00814 alanine transaminase [EC:2.6.1.2] , (RefSeq) hypothetical protein (A) MASNSGRRLNIDNINPHVRAAKYAVRGELAVKSEEYRAALQNGATDLPFKQVISANIGNP QQLDQKPITFIRQVLSILENPALLEKGDVLVNHLGYKPDVLERAKKLLAAVGSVGAYSPS NGAPAIRQSIAEFLERRDGFPANPADIYMSAGASSGVNTLLHIICADEKSGVLVPIPQYP LYTASLSVLNATCVPYYLDEQKNWGTDLATIRAAHEKAKAEGVDVRAIVIINPGNPTGAS LPEEDIRAVIEFARQERLVILADEVYQTNVFIGEFISFKRMLRQMQKEQPGTYDNIELAS LHSVSKGMIGECGHRGGYFELVGFDPLVQAEIYKFVSIMLCAPVIGQCLVELMVNPPKPG EPSYDLYIQEYNAIFNGLHERATALHKAFEQMEGVECGVPQGSMYLFPTIKLPPKAAKAA AAEGRTPDEFYCLRMLEATGVCVVPGSGFGQKEGTLHFRTTFLAPGTEWVGSIVKFHKEF MDKYR ...
ALT catalyzes the transfer of the amino group from L-alanine to α-ketoglutarate resulting in the formation of pyruvate and L-glutamate. Lactate dehydrogenase catalyzes the reduction of pyruvate and the simultaneous oxidation of NADH to NAD. The resulting rate of decrease in absorbance is directly proportional to ALT activity.. ...
Jual alat modalitas dasar fisioterapi lengkap dan resmi. Dapatkan harga alat modalitas dasar fisioterapi murah hanya di Medicalogy.
Are Tazocin Side Effects Putting Your Health at Risk? | Jan 11, 2018 Check these Tazocin side effect reports: A 98-year-old male patient was diagnosed with pneumonia, treated with TAZOCIN and reported death,alanine aminotransferase increased. Dosage: 4.5 G, 3x/day. Patient was hospitalized.
1. Membraphone Membraphone adalah jenis alat musik yang berasal dari kulit atau membran.Bunyinya ditimbulkan dari getaran kulit yang dipukul. Con...
Es wird mit Hilfe der Elektrophorese nachgewiesen, dass Glutaminsäure-Oxalessigsäure-Transaminase im Gegensatz zu Glutaminsäure-Brenztraubensäure-Transaminase in zwei verschiedenen Fraktionen des...
Temukan berbagai macam produk untuk alat monitoring kesehatan lingkungan (kesling) dan sanitarian kit meliputi pengukuran udara air tanah vektor suara kebisingan makanan limbah sanitarian kit dan alat kesehatan lingkungan
CV. Akmal Djaya Khatulistiwa Jual Mesin Hemodialisis Harga Terjangkau untuk kebutuhan rumahsakit, klinik maupun pribadi. Informasi Perusahaan CV. AKMAL DJAYA P
Synonyms for dibucaine in Free Thesaurus. Antonyms for dibucaine. 1 word related to dibucaine: intravenous anesthetic. What are synonyms for dibucaine?
Looking for online definition of serum glutamic-pyruvic transaminase (SGPT) in the Medical Dictionary? serum glutamic-pyruvic transaminase (SGPT) explanation free. What is serum glutamic-pyruvic transaminase (SGPT)? Meaning of serum glutamic-pyruvic transaminase (SGPT) medical term. What does serum glutamic-pyruvic transaminase (SGPT) mean?
Define glutamic oxaloacetic transaminase. glutamic oxaloacetic transaminase synonyms, glutamic oxaloacetic transaminase pronunciation, glutamic oxaloacetic transaminase translation, English dictionary definition of glutamic oxaloacetic transaminase. Noun 1. glutamic oxaloacetic transaminase - an enzyme involved in transamination glutamic oxalacetic transaminase aminopherase, aminotransferase,...
Aim: Elevation of alanine aminotransferase (ALT) levels during pegylated-interferon (peg-IFN) plus ribavirin therapy in patients with chronic hepatitis C [CHC] is a problem that cannot be disregarded. The aim of this study is to assess the frequency and to characterize clinical parameters of this phenomenon.. Methods: Two hundred and thirty-five (235) CHC patients with genotype 1b receiving peg-IFN α-2b plus ribavirin therapy were analyzed. Clinical parameters that may be associated with abnormal ALT values during treatment and therapy outcomes were evaluated statistically. One hundred and sixteen (116) patients treated with peg-IFN α-2a plus ribavirin were also included for partial analysis.. Results: Abnormal ALT values during treatment were observed in 23.0% of patients. It was observed in 14.5% of those with sustained virological response (SVR) and 17.8% of those with relapse, in whom viral clearance was observed during therapy. Multivariate logistic regression analysis revealed that ...
Reference: Ponomareva T.F., Glutamic oxaloacetic and glutamic pyruvic transaminase activities in various human tumors, Voprosy meditsinskoi khimii, 1963, vol: 9(6), 575-581 ...
AV Fasano, BA Kasprow, JT Velardo. Glutamic oxalacetic and glutamic pyruvic transaminase activity in the pineal gland of the albino rat during the estrous cycle. J Am Osteopath Assoc 1972;72(2):185. doi: .. Download citation file:. ...
Looking for online definition of alanine transaminase in the Medical Dictionary? alanine transaminase explanation free. What is alanine transaminase? Meaning of alanine transaminase medical term. What does alanine transaminase mean?
Recently there have been news stories on a dengue strain that affects the liver. This condition is also called dengue hepatitis. It leads to severe organ malfunction and in some cases even organ failure. In the case of dengue hepatitis, fever lasts longer, often for more than a week, and leaves the patient extremely exhausted. An indication of this condition, according to experts is the sudden rise in SGOT (Serum Glutamic Oxaloacetic Transaminase) and SGPT (Serum Glutamic Pyruvic Transaminase) levels, sometime almost 20 times higher than the normal level. Dengue hepatitis is characterized by high fever, lasting more than a week, extreme weakness. The blood tests show an increase in SGPT and SGOT levels, a drop in platelet count and WBCs ...
It is uncertain whether patients with nonalcoholic fatty liver disease (NAFLD) and normal alanine aminotransferase (ALT) have a milder disease and should undergo liver biopsy. We reviewed the histological data of 458 Italian patients with NAFLD in whom liver biopsy was indicated by altered liver enzymes (395 cases, 86%), or persistently elevated ferritin or long-lasting severe steatosis (63 cases). Factors associated with nonalcoholic steatohepatitis (NASH) and fibrosis ≥ 2 were identified by multivariate analysis. Patients with normal ALT were significantly older, had lower body mass index, fasting triglycerides, insulin resistance according to homeostasis model assessment (HOMA-IR), ALT, and gamma-glutamyltransferase, but a higher prevalence of hypertension. NASH was diagnosed in 59% and 74% of the patients with normal and increased ALT, respectively (P = 0.01). In the overall series of patients, NASH was independently predicted by ALT (odds ratio [OR], 1.11; 95% confidence interval [CI], ...
Objectives: A non-invasive, simple and non-expensive test to predict cirrhosis would be highly desirable. The aspartate aminotransferase/ alanine aminotransferase (AST/ALT) ratio has been proven to be such an indicator of cirrhosis in alcoholic liver disease, hepatitis C. Aim: To test whether the AST/ALT ratio is a marker of cirrhosis also in patients with primary biliary cirrhosis (PBC). Methods: The study consisted of 160 patients. In 126 patients, we had clinical and laboratory data at the time of diagnosis and follow-up with outcome: liver-related death, liver transplantation and survival. In 121 patients, we had laboratory data and liver histology. Results: We found that the AST/ALT ratio was significantly higher in cirrhotic patients than in non-cirrhotic patients. A high AST/ALT ratio was significantly associated with esophageal varices and ascites. In a multivariate analysis, bilirubin and ALP were predictors of poor prognosis. Conclusion: The AST/ALT ratio seems to be of clinical value ...
Liver enzyme elevation is an important and common adverse effect among patients with immune-mediated diseases who receive tumour necrosis factor inhibitors (anti-TNF), and has various causes. Hence, we evaluated the relative risks of developing liver enzyme elevation in anti-TNF users with differing hepatitis B virus (HBV) infection status. At a hospital in central Taiwan, 407 patients with rheumatoid arthritis, ankylosing spondylitis, or psoriasis/psoriatic arthritis received anti-TNF therapy between 1 January 2004 and 30 June 2012. We performed a nested case-control study (n = 368) of cases with serum alanine aminotransferase (ALT) | 40 international units/L ≤ 12 months after starting anti-TNF therapy, and corresponding controls without liver enzyme elevation. Conditional logistic regression was used to evaluate associations between liver enzyme elevation and HBV serostatus, as well as other risk factors. Thirty cases were compared to 338 controls. After adjustment for potential confounders, HBV
Autoimmune hepatitis has been recognised since 1940s and was then known as chronic active hepatitis (CAH), described as a novel form of hepatitis found in females noted to have hypergammaglobulinaemia. In the 1960s it was noted to respond to corticosteroids, and in 1993, AIH was endorsed as a clinical entity. AIH is an unresolving chronic inflammatory condition of the liver resulting from an unknown cause. For this to happen there is a complex interaction of trigger factors, autoantigens, genetic predispositions, and immune-regulatory systems. AIH is characterized by interface hepatitis and piecemeal necrosis, with a plasmalymphocytic infiltration on histological examination. In addition to this there is increased immunoglobulin G (IgG), elevated alanine aminotransferase (ALT) levels, and liver specific and non-liver specific autoantibodies autoantibodies in the serum. A quick diagnosis and immunosuppressive therapy in patients with AIH can contain the disease activity and result in a normal life
Aspartate transaminase (AST) or aspartate aminotransferase, also known as AspAT/ASAT/AAT or serum glutamic oxaloacetic transaminase (SGOT), is a pyridoxal phosphate (PLP)-dependent transaminase enzyme (EC 2.6.1.1) that was first described by Arthur Karmen and colleagues in 1954. AST catalyzes the reversible transfer of an α-amino group between aspartate and glutamate and, as such, is an important enzyme in amino acid metabolism. AST is found in the liver, heart, skeletal muscle, kidneys, brain, and red blood cells. Serum AST level, serum ALT (alanine transaminase) level, and their ratio (AST/ALT ratio) are commonly measured clinically as biomarkers for liver health. The tests are part of blood panels. Aspartate transaminase catalyzes the interconversion of aspartate and α-ketoglutarate to oxaloacetate and glutamate. Aspartate (Asp) + α-ketoglutarate ↔ oxaloacetate + glutamate (Glu) As a prototypical transaminase, AST relies on PLP (Vitamin B6) as a cofactor to transfer the amino group from ...
Abstract Glutamic oxaloacetic transaminase (GOT) and glutamic pyruvic transaminase (GPT) activity were measured in precutaneous needle biopsy specimens of human liver tissue and co..
metformin or metformin er commander du metformine acheter metformine sans ordonnance metformin vs metformin er weight loss metformine. diabetes metformine.Effects of Metformin and Weight Loss on Serum Alanine Aminotransferase Activity in the Diabetes. of abnormal ALT concentrations was not.. Always bear in mind that if perhaps you can not speak and walk at. that diabetes is certainly not. fat destruction simply by taking weight loss...Maternally inherited diabetes and deafness. the onset of deafness precedes that of diabetes. The severity of the hearing loss is. low body weight and the.Looking for a metformin? Not a. metformin online buy metformin mexico purchase metformin weight loss metformin to buy order metformin canada can i order.Diabetes may lead to psychological effects such as loss of a. diabetes, but it is not known whether. the effects of diabetes on physical appearance. Weight ...
The present work was undertaken in order to investigate the effects of magnetic field (MF) on hematopoiesis and fuel metabolites in female rats. At thermoneutrality (25 C), the exposition of rats 1 hour/day for 10 consecutive days to a MF of 128 mT (m Tesla) induced an increase in hematocrit and hemoglobin compared to controls. Exposure to MF also induced an increase in blood glucose levels but had no effect on triglyceride concentrations. Moreover, serum alanine aminotransferase activity remained unchanged in treated rats, while aspartate aminotransferase and lactate dehydrogenase activities increased by about 22% and 33%, respectively, following MF exposure. It was concluded that sub-acute exposure to MF induced elevations in hematocrit, hemoglobin, plasma fuel metabolites and tissue enzymes release within the blood. Key words: Magnetic field, hematology, glucose, triglycerides, plasma enzymes, rat.. Keywords: Magnetic field, glucose, triglycerides, plasma ...
Cholestasis is a significant risk factor for immediate hepatic failure due to ischemia reperfusion (I/R) injury in patients undergoing liver surgery or transplantation. We recently demonstrated that inhibition of Hedgehog (Hh) signaling with cyclopamine (CYA) before I/R prevents liver injury. In this study we hypothesized that Hh signaling may modulate I/R injury in cholestatic rat liver. Cholestasis was induced by bile duct ligation (BDL). Seven days after BDL, rats were exposed to either CYA or vehicle for 7 days daily before being subjected to 30 min of ischemia and 4 h of reperfusion. Expression of Hh ligands (Sonic Hedgehog, Patched-1 and Glioblastoma-1), assessment of liver injury, neutrophil infiltration, cytokines, lipid peroxidation, cell proliferation and apoptosis were determined. Significant upregulation of Hh ligands was seen in vehicle treated BDL rats. I/R injury superimposed on these animals resulted in markedly elevated serum alanine transaminase (ALT), aspartate transaminase ...
Saputri, F. C., Astari, C., Janatry, D. A., ., A., & Kusmana, D. (2018). HEPATOPROTECTIVE EFFECT OF BELLAMYA JAVANICA: ASPARTATE TRANSAMINASE, ALANINE AMINOTRANSFERASE, AND ALKALINE PHOSPHATASE ACTIVITY, AND LIVER HISTOPATHOLOGY IN MICE INDUCED WITH CARBON TETRACHLORIDE. International Journal of Applied Pharmaceutics, 10(1), 203-207. https://doi.org/10.22159/ijap.2018. ...
Nonalcoholic fatty liver disease is a common condition associated with metabolic syndrome. It is the most common cause of elevated liver enzymes in U.S. adults, and is diagnosed after ruling out other causes of steatosis (fatty infiltration of liver), particularly infectious hepatitis and alcohol abuse. Liver biopsy may be considered if greater diagnostic and prognostic certainty is desired, particularly in patients with diabetes, patients who are morbidly obese, and in patients with an aspartate transaminase to alanine transaminase ratio greater than one, because these patients are at risk of having more advanced disease. Weight loss is the primary treatment for obese patients with nonalcoholic fatty liver disease. Medications used to treat insulin resistance, hyperlipidemia, and obesity have been shown to improve transaminase levels, steatosis, and histologic findings. However, no treatments have been shown to affect patient-oriented outcomes.
Serum Glutamic Pyruvate Transaminase (SGPT) is an enzyme that is found in the cells of the liver. Find out the various causes of liver test for SGPT.
Alanine aminotransaminase (ALT), is an enzyme that normally resides in serum and body tissues, especially in the liver. It is released into the serum as a result of tissue injury; hence the concentration of ALT in the serum may be increased with acute damage to hepatic cells. A single use, disposable biosensor, comprising iridium nano-particle as catalyst dispersed on carbon paste, has been developed for the determination of ALT concentration. The biosensor is based on quantifying H2O2 concentration produced by a serial of ALT enzymatic reactions. It operates well at room temperature in different physiological fluids: phosphate buffer, calf serum and human serum for ALT concentration of 0-544 ng/mL. Experimental results in human serum are compared to those obtained by spectrophotometric assays with excellent agreement. Therefore, the Ir/C biosensor shows good relationship on the dilution of concentrated ALT clinical applications.
Results The distribution of AST and ALT showed normal distribution. Overall, AST levels were19.7±3 IU/L and ALT levels were 13.8±3.1 IU/L in all patients, AST levels were 19.8±3 IU/L and 12.9±2.9 IU/L and ALT levels were 14.4±3.2 IU/L and 9.9±3.5 IU/L in male and female patients, respectively. AST level was the highest in the 6th decade and ALT level was in the 5th decade ...
The study aimed to compare using Noni juice and Palm sugar on Serum Glutamate Oxaloacetat Transaminase (SGOT) and Glutamate Pyruvate Transaminase (SGPT) levels. Research involved 100 broiler chickens by using a Completely Randomized Design. Treatments were: ration without Palm Sugar (R0) and 3 rations which contained Noni juice and Palm Sugar at different levels, which were R1 (Palm Sugar 2% + Noni Juice 0.3%;), R2 (Palm Sugar 3% + Noni Juice 0.3%), and R3 Palm Sugar 4% + Noni Juice 0.3%), each treatment was repeated 5 times, reared up to 4 weeks of age. Water were given ad libitum to all group. After four weeks, each group was observed level SGOT and SGPT. Result showed no significant difference using 3% NJ and 0.3% PS (R3) on SGPT level (p>0.05), but tend to decrease until 25.94% (from 234,67 U/L to 186.33, U/L), compare to control, and R1 dan R2 gaves the same respons with control. On the other hand, there were no significant (p>0.05) difference found at all treatment on SGOT level, so the ...
Could it be possible that HSV could result in elevated liver enzyme levels??? Or does it cause levels to be elevated? I just got some blood test results back and it seems Ive got elevated liver enzy...
Our study is the first clinical characterization of post-SVR aminotransferase elevation with an unexpected high prevalence that affect approximately one third of all patients upon viral eradication. Since CHC is both a virologic and fibrotic disease [20-21], the high prevalence of ongoing liver inflammation likely impact the future course of disease, cirrhosis progression and cancer development in thousands of patients with so far unrecognized burden to public health worldwide. Baseline factors that were (i) significantly associated and (ii) strongly correlated with ongoing elevation of ALT levels after SVR were male gender, the use of IFN in antiviral treatment regimens, and markers of advanced liver disease or steatosis. We observed body weight as significant baseline predictor that justify clinical concerns as high body weight might favor the development or worsening of pre-existing fatty liver disease or steatohepatitis (NASH) upon successful antiviral treatment. Due to the enormous ...
1 Answer - Posted in: nonalcoholic fatty liver disease, liver, disease - Answer: The elevated ALT (almost twice normal maximum) indicates current ...
Florida. In early September 2003, a previously healthy woman aged 52 years visited an emergency department (ED) with a 2-day history of headache, abdominal pain, diarrhea, lethargy, right axillary lymphadenopathy, progressive myalgias, and pain in her distal extremities. On physical examination, she was afebrile and hypotensive (blood pressure: 82/40 mmHg) with left-sided abdominal tenderness and scleral icterus; no rash was noted. Laboratory tests indicated a mildly elevated white blood cell count of 13,800 cells/µL (normal: 5,000--10,000 cells/µL), thrombocytopenia (71,000 platelets/µL [normal: 130,000--500,000 platelets/µL]), elevated alanine aminotransferase of 112 U/L (normal: 20--52 U/L), elevated aspartate aminotransferase of 154 U/L (normal: ,40 U/L), elevated total bilirubin of 5.8 mg/dL (normal: 0.2--1.2 mg/dL), elevated blood urea nitrogen of 55 mg/dL (normal: 7--23 mg/dL), and elevated creatinine of 2.9 mg/dL (normal: 0.7--1.5 mg/dL). The patient was admitted to the intensive ...
Autoimmune sclerosing cholangitis is an overlap syndrome characterized by features of both autoimmune hepatitis and primary sclerosing cholangitis, the latter usually involving the large bile ducts. Autoimmune sclerosing cholangitis occurs more often in children than in adults and is frequently associated with inflammatory bowel disease, predominantly ulcerative colitis. We report a unique case of a 10-year-old Danish boy with severe small duct autoimmune sclerosing cholangitis and synchronic Crohn colitis. He was referred with a history of weight loss, abdominal pain, vomiting and diarrhea. Biochemical anomalies included elevated alanine aminotransferase, γ-glutamyl transferase and immunoglobulin G levels and the presence of smooth muscle antibodies and perinuclear antineutrophil cytoplasmic antibodies but normal alkaline phosphatase. Liver biopsy specimen revealed features of both autoimmune hepatitis and sclerosing cholangitis, the latter characterized by acute, hyperplastic and destructive
TY - JOUR. T1 - Methane attenuates hepatic ischemia/reperfusion injury in rats through antiapoptotic, anti-inflammatory, and antioxidative actions. AU - Ye, Zhouheng. AU - Chen, Quyang. AU - Zhang, Rongjia. AU - Nakao, Atsunori. AU - Fan, Danfeng. AU - Zhang, Ting. AU - Gu, Zhengyong. AU - Tao, Hengyi. AU - Sun, Xuejun. PY - 2015/9/1. Y1 - 2015/9/1. N2 - Hepatic ischemia/reperfusion (I/R) injury, which occurs in various diseases, introduces severe tissue damage and liver dysfunction. However, no promising therapies for such a significant condition currently exist. Methane has been suggested to exert a protective effect against intestinal I/R injury. In this study, we introduced methane to treat hepatic I/R injury to show its promising protective effect. Also, intraperitoneal injection with methane-rich saline, which could have potential clinical applications, was applied as a new method. Partial liver warm ischemia was applied in Sprague-Dawley rats for 60 min followed by succedent reperfusion. ...
Background: Serial monitoring of hepatitis B virus (HBV) DNA and serum alanine transaminase (ALT) for at least one year is recommended to define an inactive carrier state. Recent studies proposed HBsAg levels as a marker for monitoring HBV infected patients. The aim of our study is to evaluate spontaneous HBV DNA fluctuations among Tunisian HBV infected patients and to assess the role of HBsAg quantification in the determination of viral disease activity. Methods: Seventy three untreated HBeAg negative asymptomatic HBV infected patients were followed up prospectively during a one year period (2014). Patients with persistently serum HBV DNA levels , 2000 IU/ml and persistently normal ALT for at least one year,were considered as inactive carrier of HBsAg. Patients with HBV DNA level fluctuation ≥2000 IU/ml and/or ALT elevation were classified as chronic hepatitis B (CHB) patients.Serum samples for HBV DNA and ALT quantification were obtained at three times with an interval of 6 months (M0, M6 ...
Probiotics have been proposed as a treatment option for patients with non-alcoholic fatty liver disease and non-alcoholic steatohepatitis because of their balancing role on the flora of the gut that may act as a potential source of hepatotoxic oxidative injury. This review did not identify any randomised clinical trials with probiotics in non-alcoholic fatty liver disease and non-alcoholic steatohepatitis. Even if the results from pilot studies seem promising, randomised clinical trials are necessary to asses the clinical implication of probiotics therapy in non-alcoholic fatty liver disease and non-alcoholic steatohepatitis. ...
Four Chinese patients with non-Hodgkins lymphoma and asymptomatic chronic hepatitis B infection developed fulminant hepatitis three to four weeks after two to five courses of chemotherapy. One was initially positive for hepatitis B e antigen and three were positive for antibody to HBeAg. They had normal initial serum aminotransferase levels. In all four patients, the hepatic illness appeared to be caused by reactivation of hepatitis B virus replication as evidenced by the appearance of HBV DNA in serum at the onset of hepatitis, seroreversion from anti-HBe to HBeAg positivity, and the absence of other incriminating drugs or viral markers. All died within three weeks after the onset of jaundice. Serum HBV DNA level dropped to undetectable level as the hepatitis progessed. We postulate that potent cytotoxic therapy reactivated HBV replication and permitted widespread infection of hepatocytes. Upon withdrawal of chemotherapy, the immunologic rebound resulted in rapid destruction of infected ...
The nuclear protein high-mobility group box 1 (HMGB1) is a key trigger for the inflammatory reaction during liver ischemia reperfusion injury (IRI). Hydrogen treatment was recently associated with down-regulation of the expression of HMGB1 and pro-inflammatory cytokines during sepsis and myocardial IRI, but it is not known whether hydrogen has an effect on HMGB1 in liver IRI. A rat model of 60 minutes 70% partial liver ischemia reperfusion injury was used. Hydrogen enriched saline (2.5, 5 or 10 ml/kg) was injected intraperitoneally 10 minutes before hepatic reperfusion. Liver injury was assessed by serum alanine aminotransferase (ALT) enzyme levels and histological changes. We also measured malondialdehyde (MDA), hydroxynonenal (HNE) and 8-hydroxy-guanosine (8-OH-G) levels as markers of the peroxidation injury induced by reactive oxygen species (ROS). In addition, pro-inflammatory cytokines including TNF-α and IL-6, and high mobility group box B1 protein (HMGB1) were measured as markers of post
Forsythiae Fructus is known to have diuretic, anti-bacterial, and anti-inflammatory activities. This study examined the hepatoprotective effects of pinoresinol, a lignan isolated from Forsythiae Fructus, against carbon tetrachloride (CCl4)-induced liver injury. Mice were treated intraperitoneally with vehicle or pinoresinol (25, 50, 100, and 200 mg/kg) 30 min before and 2 h after CCl4 (20 μl/kg) injection. In the vehicle-treated CCl4 group, serum aminotransferase activities were significantly increased 24 h after CCl4 injection, and these increases were attenuated by pinoresinol at all doses. Hepatic glutathione contents were significantly decreased and lipid peroxidation was increased after CCl4 treatment. These changes were attenuated by 50 and 100 mg/kg of pinoresinol. The levels of protein and mRNA expression of inflammatory mediators, including tumor necrosis factor-α, inducible nitric oxide synthase, and cyclooxygenase-2, were significantly increased after CCl4 injection; and these ...

Alanine transaminase - WikipediaAlanine transaminase - Wikipedia

Redirected from Alanine aminotransferase). Alanine transaminase (ALT) is a transaminase enzyme (EC 2.6.1.2). It is also called ... It catalyzes the two parts of the alanine cycle. Serum ALT level, serum AST (aspartate transaminase) level, and their ratio ( ... Alanine+transaminase at the US National Library of Medicine Medical Subject Headings (MeSH) ... Alanine transaminase shows a marked diurnal variation.[citation needed]. The AST/ALT ratio (with AST being aspartate ...
more infohttps://en.m.wikipedia.org/wiki/Alanine_aminotransferase

ALANINE TRANSAMINASE (ALT), SERUMALANINE TRANSAMINASE (ALT), SERUM

ID:1,Note:Reference Interval has been last updated on 22 Apr 2013.,Date:2013-04-29T10:20:00.000Z,Deleted:false,IsNew:true ...
more infohttps://www.sgh.com.sg/patient-care/specialties-services/Pathology/Pages/ALANINE-TRANSAMINASE-ALT-SERUM.aspx

Recombinant Rat Alanine Transaminase protein (ab207123) | AbcamRecombinant Rat Alanine Transaminase protein (ab207123) | Abcam

Buy our Recombinant Rat Alanine Transaminase protein. Ab207123 is a full length protein produced in Escherichia coli and has ... Recombinant Rat Alanine Transaminase protein. See all Alanine Transaminase proteins and peptides. ... Amino-acid degradation; L-alanine degradation via transaminase pathway; pyruvate from L-alanine: step 1/1. ... Catalyzes the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate. Participates in ...
more infohttps://www.abcam.com/recombinant-rat-alanine-transaminase-protein-ab207123.html

Recombinant Human Alanine Transaminase protein (ab113862) ReferencesRecombinant Human Alanine Transaminase protein (ab113862) References

References for Abcams Recombinant Human Alanine Transaminase protein (ab113862). Please let us know if you have used this ...
more infohttp://www.abcam.com/recombinant-human-alanine-transaminase-protein-ab113862-references.html

Alanine transaminase | definition of alanine transaminase by Medical dictionaryAlanine transaminase | definition of alanine transaminase by Medical dictionary

What is alanine transaminase? Meaning of alanine transaminase medical term. What does alanine transaminase mean? ... Looking for online definition of alanine transaminase in the Medical Dictionary? alanine transaminase explanation free. ... Synonym(s): alanine transaminase, glutamic-pyruvic transaminase, serum glutamic:pyruvic transaminase. alanine transaminase. /al ... Related to alanine transaminase: Aspartate transaminase. alanine transaminase. [al´ah-nēn trans-am´ĭ-nās] an enzyme that ...
more infohttps://medical-dictionary.thefreedictionary.com/alanine+transaminase

decreased circulating alanine transaminase level Mammalian Phenotype Term (MP:0002942)decreased circulating alanine transaminase level Mammalian Phenotype Term (MP:0002942)

The Mammalian Phenotype (MP) Ontology is a community effort to provide standard terms for annotating phenotypic data. You can use this browser to view terms, definitions, and term relationships in a hierarchical display. Links to summary annotated phenotype data at MGI are provided in Term Detail reports.
more infohttp://www.informatics.jax.org/vocab/mp_ontology/MP:0002942

increased circulating alanine transaminase level Mammalian Phenotype Term (MP:0002941)increased circulating alanine transaminase level Mammalian Phenotype Term (MP:0002941)

The Mammalian Phenotype (MP) Ontology is a community effort to provide standard terms for annotating phenotypic data. You can use this browser to view terms, definitions, and term relationships in a hierarchical display. Links to summary annotated phenotype data at MGI are provided in Term Detail reports.
more infohttp://www.informatics.jax.org/vocab/mp_ontology/MP:0002941

Three Stars Medical Supplies - Alanine transaminase Manufacturer & ExportersThree Stars Medical Supplies - Alanine transaminase Manufacturer & Exporters

We are leading Manufacturer of Alanine transaminase, UREA UV, Hemoglobin Kit, laboratory diagnostics, Bilurubin Total from ...
more infohttp://www.indianyellowpages.com/three-stars-medical/

Alanine transaminase - WikipediaAlanine transaminase - Wikipedia

Alanine transaminase (ALT) is a transaminase enzyme (EC 2.6.1.2). It is also called alanine aminotransferase (ALAT) and was ... Alanine transaminase shows a marked diurnal variation.[citation needed] The ratio of ALT to AST (aspartate aminotransferase) ... It catalyzes the two parts of the alanine cycle. Serum ALT level, serum AST (aspartate transaminase) level, and their ratio ( ... Red Cross Donor Requirements Clin Chem 2000;46:2027-2049 Alanine transaminase at the US National Library of Medicine Medical ...
more infohttps://en.wikipedia.org/wiki/Alanine_transaminase

HIE Multimedia - Alanine transaminase (ALT) blood testHIE Multimedia - Alanine transaminase (ALT) blood test

Alanine transaminase (ALT) blood test. SGPT; Serum glutamate pyruvate transaminase; Alanine transaminase; Alanine ... Alanine aminotransferase (ALT, alanine transaminase, SGPT) - serum. In: Chernecky CC, Berger BJ, eds. Laboratory Tests and ... The alanine transaminase (ALT) blood test measures the level of the enzyme ALT in the blood.. Enzyme. Enzymes are complex ... Tests for Alanine transaminase (ALT) blood test. *Alanine transaminase (ALT) blood test ...
more infohttps://ssl.adam.com/content.aspx?productid=117&isarticlelink=false&pid=1&gid=003473&site=summithealth.adam.com&login=SUMM2111

Anti-GPT / Alanine Transaminase Antibody | Rabbit anti-Human  | LSBioAnti-GPT / Alanine Transaminase Antibody | Rabbit anti-Human | LSBio

Alanine Transaminase antibody LS-C100675 is an unconjugated rabbit polyclonal antibody to human Alanine Transaminase (GPT ). ... Alanine Transaminase antibody LS-C100675 is an unconjugated rabbit polyclonal antibody to human Alanine Transaminase (GPT ). ... GPT / Alanine Transaminase Antibody (aa31‑80) LS‑C80760 Species: Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, ... GPT / Alanine Transaminase Antibody (aa86‑112) LS‑C100675 GPT / Alanine Transaminase Antibody (aa86‑112) LS‑C100675 ...
more infohttps://www.lsbio.com/antibodies/gpt-antibody-alanine-transaminase-antibody-aa86-112-flow-ihc-wb-western-ls-c100675/102247?trid=247

Anti-GPT / Alanine Transaminase Antibody | Rabbit anti-Rat WB | LSBioAnti-GPT / Alanine Transaminase Antibody | Rabbit anti-Rat WB | LSBio

Alanine Transaminase antibody LS-C292687 is an unconjugated rabbit polyclonal antibody to rat Alanine Transaminase (GPT ). ... Alanine Transaminase antibody LS-C292687 is an unconjugated rabbit polyclonal antibody to rat Alanine Transaminase (GPT ). ... GPT / Alanine Transaminase Antibody (aa31‑80) LS‑C80760 Species: Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, ... GPT / Alanine Transaminase Antibody (aa1‑496) LS‑C292687 GPT / Alanine Transaminase Antibody (aa1‑496) LS‑C292687 ...
more infohttps://www.lsbio.com/antibodies/anti-gpt-antibody-alanine-transaminase-antibody-aa1-496-wb-western-ls-c292687/302601?trid=247

Clinical, histological, and virological features of hepatitis C virus carriers with persistently normal or abnormal alanine...Clinical, histological, and virological features of hepatitis C virus carriers with persistently normal or abnormal alanine...

... and virological features of hepatitis C virus carriers with persistently normal or abnormal alanine transaminase levels. ... and virological features of hepatitis C virus carriers with persistently normal or abnormal alanine transaminase levels. ... Assessment of liver function in patients with hepatitis C and normal transaminase levels. Eur J Gastroenterol Hepatol 1996; 8: ... Liver histology in hepatitis C infection: a comparison between patients with persistently normal or abnormal transaminases. Gut ...
more infohttp://onlinelibrary.wiley.com/doi/10.1002/hep.510260603/references?globalMessage=0

Improved Performance of Serum Alpha-Fetoprotein for Hepatocellular Carcinoma Diagnosis in HCV cirrhosis with Normal Alanine...Improved Performance of Serum Alpha-Fetoprotein for Hepatocellular Carcinoma Diagnosis in HCV cirrhosis with Normal Alanine...

Results: HCV etiology, Non-White race, and serum alanine transaminase (ALT) predicted elevated AFP in cirrhotics. Non-White ... Performance of Serum Alpha-Fetoprotein for Hepatocellular Carcinoma Diagnosis in HCV cirrhosis with Normal Alanine Transaminase ... Performance of Serum Alpha-Fetoprotein for Hepatocellular Carcinoma Diagnosis in HCV cirrhosis with Normal Alanine Transaminase ... Performance of Serum Alpha-Fetoprotein for Hepatocellular Carcinoma Diagnosis in HCV cirrhosis with Normal Alanine Transaminase ...
more infohttp://cebp.aacrjournals.org/content/early/2017/03/03/1055-9965.EPI-16-0747

AID 1106867 - Hepatoprotective activity against CCL4-induced toxicity in human HuH7 cells assessed as decrease in alanine...AID 1106867 - Hepatoprotective activity against CCL4-induced toxicity in human HuH7 cells assessed as decrease in alanine...

Hepatoprotective activity against CCL4-induced toxicity in human HuH7 cells assessed as decrease in alanine transaminase level ...
more infohttps://pubchem.ncbi.nlm.nih.gov/bioassay/1106867

Metabolic Cause of Obesity: The Role of Alanine Transaminase in Increasing BMI, Cholesterol, Blood Pressure and Blood Glucose  ...Metabolic Cause of Obesity: The Role of Alanine Transaminase in Increasing BMI, Cholesterol, Blood Pressure and Blood Glucose ...

... The Role of Alanine Transaminase in Increasing BMI, Cholesterol, Blood Pressure and Blood Glucose. In: Bose, Kaushik; ...
more infohttp://www.zora.uzh.ch/id/eprint/101805/

alanine transaminase - oialanine transaminase - oi

alanine transaminase can also refer to... alanine transaminase The Association of Alanine Transaminase With Aging, Frailty, ... pyruvic transaminase; glutamic‐alanine transaminase. An enzyme that catalyses the reversible reaction:. l‐alanine + 2‐ ... Fine Particle Pollution, Alanine Transaminase, and Liver Cancer: A Taiwanese Prospective Cohort Study (REVEAL-HBV) ... Elevated serum alanine transaminase in patients with type 1 or type 2 diabetes mellitus ...
more infohttp://oxfordindex.oup.com/view/10.1093/oi/authority.20110803095359442

Cairoscan | Alanine Transaminase (ALT)Cairoscan | Alanine Transaminase (ALT)

Also known as: Serum glutamic-pyruvic transaminase; SGPT; Alanine transaminase; AST/ALT ratio. Formal name: Alanine ...
more infohttp://www.cairoscan.com.eg/Potassium_K_/Alanine_Transaminase_ALT____________

Cairoscan | Alanine Transaminase (ALT)Cairoscan | Alanine Transaminase (ALT)

Also known as: Serum glutamic-pyruvic transaminase; SGPT; Alanine transaminase; AST/ALT ratio. Formal name: Alanine ...
more infohttp://www.cairoscan.com.eg/24_hour_Urine_Protein______________________/Alanine_Transaminase_ALT____________

Alanine Transaminase Posts on MedivizorAlanine Transaminase Posts on Medivizor

... Common Tests: Liver Function. Posted by Kathleen Hoffman on Jun 30, 2018 in Blog , 0 ...
more infohttps://medivizor.com/blog/tag/alanine-transaminase/

Alanine Transaminase (ALT/SGPT) - MolQAlanine Transaminase (ALT/SGPT) - MolQ

Diagnosis and monitoring of liver disease associated with hepatic necrosisAlanine transaminase (ALT) is also called alanine ... or serum glutamic-pyruvic transaminase (SGPT). ALT is found in plasma and in various body tissues, but is most common in the ... aminotransferase (ALAT) and was formerly called serum glutamate-pyruvate transaminase (SGPT) ...
more infohttps://molq.in/product/alanine-transaminase-alt-sgpt/

The effectiveness of fermented turmeric powder in subjects with elevated alanine transaminase levels: a randomised controlled...The effectiveness of fermented turmeric powder in subjects with elevated alanine transaminase levels: a randomised controlled...

... on liver function in subjects with elevated alanine transaminase (ALT) levels. A randomised, double-blind, placebo-controlled ... The effectiveness of fermented turmeric powder in subjects with elevated alanine transaminase levels: a randomised controlled ... on liver function in subjects with elevated alanine transaminase (ALT) levels. ... Flow chart for the study subjects. AEs, adverse events; ALT, alanine aminotransferase; FTP, fermented turmeric powder; ITT, ...
more infohttps://bmccomplementalternmed.biomedcentral.com/articles/10.1186/1472-6882-13-58

JCDR -
        Alanine transaminase, Alkaline phosphatase, Aspartate transaminase, Bilirubin, Blood lead level, Blood urea,...JCDR - Alanine transaminase, Alkaline phosphatase, Aspartate transaminase, Bilirubin, Blood lead level, Blood urea,...

Journal of Clinical and Diagnostic Research aims to publish findings of doctors at grass root level and post graduate students, so that all unique medical experiences are recorded in literature.
more infohttps://jcdr.net/article_fulltext.asp?issn=0973-709x&year=2019&month=January&volume=13&issue=1&page=BC01-BC04&id=12442

Alanine-oxomalonate transaminase - WikipediaAlanine-oxomalonate transaminase - Wikipedia

Other names in common use include alanine-oxomalonate aminotransferase, L-alanine-ketomalonate transaminase, and alanine- ... In enzymology, an alanine-oxomalonate transaminase (EC 2.6.1.47) is an enzyme that catalyzes the chemical reaction L-alanine + ... This enzyme belongs to the family of transferases, specifically the transaminases, which transfer nitrogenous groups. The ... ketomalonate (mesoxalate) transaminase. It employs one cofactor, pyridoxal phosphate. Nagayama H, Muramatsu M, Shimura K (1958 ...
more infohttps://en.wikipedia.org/wiki/Alanine%E2%80%94oxomalonate_transaminase

Assessment of Liver Functions u062F u0635u0627u0628u0631 | Liver | Alanine TransaminaseAssessment of Liver Functions u062F u0635u0627u0628u0631 | Liver | Alanine Transaminase

glutamic oxaloacetic transaminase (sGOT). Alanine aminotransferase (ALT) = Serum glutamic. pyruvic transaminase (sGPT) ... Serum enzymes: Transaminase (ALT,. AST), alkaline phosphate(ALP), 5nucleotidase, LDH isoenzyme.. Synthetic function: ...
more infohttps://ru.scribd.com/document/293916382/Assessment-of-Liver-Functions-u062F-u0635u0627u0628u0631
  • But pay attention to a point, "small Sanyang" patients, the hepatitis B virus (HBV DNA) higher than 10 of the 5 party, no matter how much can transaminase, HBeAg negative chronic hepatitis B. Why, in general, the immune function under the action of "big 3 this world" to "small three", HBV DNA will soon turn. (scleritis.net)
  • In our study the laboratory parameter was observed alanine transaminase to be lower in dengue patients than the reference ranges. (thefreedictionary.com)
  • However, if there is any damage to the liver, alanine transaminase is released in the blood. (1mg.com)
  • Although the lack of IL-17 did not affect the outcome of infection or pathology, lack of IL-22 resulted in 50% mortality within 12 days after infection with significantly greater weight loss at the peak of infection and significant increase in alanine transaminase in the plasma in the acute infection. (frontiersin.org)
  • Alanine Transaminase is an enzyme which is found in the cells of the liver and kidney. (1mg.com)