Agglutinins: Substances, usually of biological origin, that cause cells or other organic particles to aggregate and stick to each other. They include those ANTIBODIES which cause aggregation or agglutination of particulate or insoluble ANTIGENS.Wheat Germ Agglutinins: Lectins purified from the germinating seeds of common wheat (Triticum vulgare); these bind to certain carbohydrate moieties on cell surface glycoproteins and are used to identify certain cell populations and inhibit or promote some immunological or physiological activities. There are at least two isoforms of this lectin.Peanut Agglutinin: Lectin purified from peanuts (ARACHIS HYPOGAEA). It binds to poorly differentiated cells and terminally differentiated cells and is used in cell separation techniques.Plant Lectins: Protein or glycoprotein substances of plant origin that bind to sugar moieties in cell walls or membranes. Some carbohydrate-metabolizing proteins (ENZYMES) from PLANTS also bind to carbohydrates, however they are not considered lectins. Many plant lectins change the physiology of the membrane of BLOOD CELLS to cause agglutination, mitosis, or other biochemical changes. They may play a role in plant defense mechanisms.Lectins: Proteins that share the common characteristic of binding to carbohydrates. Some ANTIBODIES and carbohydrate-metabolizing proteins (ENZYMES) also bind to carbohydrates, however they are not considered lectins. PLANT LECTINS are carbohydrate-binding proteins that have been primarily identified by their hemagglutinating activity (HEMAGGLUTININS). However, a variety of lectins occur in animal species where they serve diverse array of functions through specific carbohydrate recognition.Receptors, Mitogen: Glycoprotein molecules on the surface of B- and T-lymphocytes, that react with molecules of antilymphocyte sera, lectins, and other agents which induce blast transformation of lymphocytes.Cryoglobulins: Abnormal immunoglobulins, especially IGG or IGM, that precipitate spontaneously when SERUM is cooled below 37 degrees Celsius. It is characteristic of CRYOGLOBULINEMIA.Agglutination: The clumping together of suspended material resulting from the action of AGGLUTININS.Castor Bean: Common name for Ricinus communis, a species in the family EUPHORBIACEAE. It is the source of CASTOR OIL.Agglutination Tests: Tests that are dependent on the clumping of cells, microorganisms, or particles when mixed with specific antiserum. (From Stedman, 26th ed)Ricinus: A plant genus of the family EUPHORBIACEAE, order Euphorbiales, subclass Rosidae. The seed of Ricinus communis L. is the CASTOR BEAN which is the source of CASTOR OIL; RICIN; and other lectins.Galanthus: A plant genus in the family LILIACEAE (sometimes classified as Amaryllidaceae). Galanthus nivalis L. is the source of GALANTHAMINE.Concanavalin A: A MANNOSE/GLUCOSE binding lectin isolated from the jack bean (Canavalia ensiformis). It is a potent mitogen used to stimulate cell proliferation in lymphocytes, primarily T-lymphocyte, cultures.Arachis hypogaea: A plant species of the family FABACEAE that yields edible seeds, the familiar peanuts, which contain protein, oil and lectins.Acetylgalactosamine: The N-acetyl derivative of galactosamine.Hemagglutination: The aggregation of ERYTHROCYTES by AGGLUTININS, including antibodies, lectins, and viral proteins (HEMAGGLUTINATION, VIRAL).Anemia, Hemolytic, Autoimmune: Acquired hemolytic anemia due to the presence of AUTOANTIBODIES which agglutinate or lyse the patient's own RED BLOOD CELLS.Carbohydrates: The largest class of organic compounds, including STARCH; GLYCOGEN; CELLULOSE; POLYSACCHARIDES; and simple MONOSACCHARIDES. Carbohydrates are composed of carbon, hydrogen, and oxygen in a ratio of Cn(H2O)n.Receptors, N-Acetylglucosamine: Cell surface receptors that bind to ACETYLGLUCOSAMINE.Hemagglutination Tests: Sensitive tests to measure certain antigens, antibodies, or viruses, using their ability to agglutinate certain erythrocytes. (From Stedman, 26th ed)Glycoconjugates: Carbohydrates covalently linked to a nonsugar moiety (lipids or proteins). The major glycoconjugates are glycoproteins, glycopeptides, peptidoglycans, glycolipids, and lipopolysaccharides. (From Biochemical Nomenclature and Related Documents, 2d ed; From Principles of Biochemistry, 2d ed)Acetylglucosamine: The N-acetyl derivative of glucosamine.Abrin: A toxic lectin from the seeds of jequirity, Abrus precatorius L. Very active poison. Five different proteins have so far been isolated: Abrus agglutinin, the component responsible for: hemagglutinating activity, & abrins a-d, the toxic principals each consisting of two peptide chains are held together by disulfide bonds.Soybean Proteins: Proteins which are present in or isolated from SOYBEANS.Datura stramonium: A plant species of the genus DATURA, family SOLANACEAE, that contains TROPANES and other SOLANACEOUS ALKALOIDS.Glycoproteins: Conjugated protein-carbohydrate compounds including mucins, mucoid, and amyloid glycoproteins.Carbohydrate Sequence: The sequence of carbohydrates within POLYSACCHARIDES; GLYCOPROTEINS; and GLYCOLIPIDS.Ribosome Inactivating Proteins: N-Glycosidases that remove adenines from RIBOSOMAL RNA, depurinating the conserved alpha-sarcin loop of 28S RIBOSOMAL RNA. They often consist of a toxic A subunit and a binding lectin B subunit. They may be considered as PROTEIN SYNTHESIS INHIBITORS. They are found in many PLANTS and have cytotoxic and antiviral activity.Receptors, Concanavalin A: Glycoprotein moieties on the surfaces of cell membranes that bind concanavalin A selectively; the number and location of the sites depends on the type and condition of the cell.Chromatography, Affinity: A chromatographic technique that utilizes the ability of biological molecules to bind to certain ligands specifically and reversibly. It is used in protein biochemistry. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)Hemagglutinins: Agents that cause agglutination of red blood cells. They include antibodies, blood group antigens, lectins, autoimmune factors, bacterial, viral, or parasitic blood agglutinins, etc.Ribosome Inactivating Proteins, Type 2: Ribosome inactivating proteins consisting of two polypeptide chains, the toxic A subunit and a lectin B subunit, linked by disulfide bridges. The lectin portion binds to cell surfaces and facilitates transport into the ENDOPLASMIC RETICULUM.I Blood-Group System: A blood group related both to the ABO and P systems that includes several different antigens found in most people on erythrocytes, in milk, and in saliva. The antibodies react only at low temperatures.Neuraminidase: An enzyme that catalyzes the hydrolysis of alpha-2,3, alpha-2,6-, and alpha-2,8-glycosidic linkages (at a decreasing rate, respectively) of terminal sialic residues in oligosaccharides, glycoproteins, glycolipids, colominic acid, and synthetic substrate. (From Enzyme Nomenclature, 1992)Sialic Acids: A group of naturally occurring N-and O-acyl derivatives of the deoxyamino sugar neuraminic acid. They are ubiquitously distributed in many tissues.Sperm Agglutination: Agglutination of spermatozoa by antibodies or autoantibodies.Carbohydrate Conformation: The characteristic 3-dimensional shape of a carbohydrate.Oligosaccharides: Carbohydrates consisting of between two (DISACCHARIDES) and ten MONOSACCHARIDES connected by either an alpha- or beta-glycosidic link. They are found throughout nature in both the free and bound form.Galactose: An aldohexose that occurs naturally in the D-form in lactose, cerebrosides, gangliosides, and mucoproteins. Deficiency of galactosyl-1-phosphate uridyltransferase (GALACTOSE-1-PHOSPHATE URIDYL-TRANSFERASE DEFICIENCY DISEASE) causes an error in galactose metabolism called GALACTOSEMIA, resulting in elevations of galactose in the blood.Umbelliferones: 7-Hydroxycoumarins. Substances present in many plants, especially umbelliferae. Umbelliferones are used in sunscreen preparations and may be mutagenic. Their derivatives are used in liver therapy, as reagents, plant growth factors, sunscreens, insecticides, parasiticides, choleretics, spasmolytics, etc.N-Acetylneuraminic Acid: An N-acyl derivative of neuraminic acid. N-acetylneuraminic acid occurs in many polysaccharides, glycoproteins, and glycolipids in animals and bacteria. (From Dorland, 28th ed, p1518)Carbohydrate Metabolism: Cellular processes in biosynthesis (anabolism) and degradation (catabolism) of CARBOHYDRATES.Histocytochemistry: Study of intracellular distribution of chemicals, reaction sites, enzymes, etc., by means of staining reactions, radioactive isotope uptake, selective metal distribution in electron microscopy, or other methods.Abrus: A plant genus of the family FABACEAE. Members contain ABRIN.Glycosylation: The chemical or biochemical addition of carbohydrate or glycosyl groups to other chemicals, especially peptides or proteins. Glycosyl transferases are used in this biochemical reaction.Streptococcus mutans: A polysaccharide-producing species of STREPTOCOCCUS isolated from human dental plaque.Saliva: The clear, viscous fluid secreted by the SALIVARY GLANDS and mucous glands of the mouth. It contains MUCINS, water, organic salts, and ptylin.Precipitins: Antibodies which elicit IMMUNOPRECIPITATION when combined with antigen.Methylmannosides: Mannosides formed by the reaction of the hydroxyl group on the anomeric carbon atom of mannose with methyl alcohol. They include both alpha- and beta-methylmannosides.Electrophoresis, Polyacrylamide Gel: Electrophoresis in which a polyacrylamide gel is used as the diffusion medium.Wheat Germ Agglutinin-Horseradish Peroxidase Conjugate: The lectin wheatgerm agglutinin conjugated to the enzyme HORSERADISH PEROXIDASE. It is widely used for tracing neural pathways.Antigens, Tumor-Associated, Carbohydrate: Carbohydrate antigens expressed by malignant tissue. They are useful as tumor markers and are measured in the serum by means of a radioimmunoassay employing monoclonal antibodies.Molecular Sequence Data: Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.PolysaccharidesHymecromone: A coumarin derivative possessing properties as a spasmolytic, choleretic and light-protective agent. It is also used in ANALYTICAL CHEMISTRY TECHNIQUES for the determination of NITRIC ACID.Erythrocytes: Red blood cells. Mature erythrocytes are non-nucleated, biconcave disks containing HEMOGLOBIN whose function is to transport OXYGEN.Plants, Toxic: Plants or plant parts which are harmful to man or other animals.Monosaccharides: Simple sugars, carbohydrates which cannot be decomposed by hydrolysis. They are colorless crystalline substances with a sweet taste and have the same general formula CnH2nOn. (From Dorland, 28th ed)Cell Membrane: The lipid- and protein-containing, selectively permeable membrane that surrounds the cytoplasm in prokaryotic and eukaryotic cells.Triticum: A plant genus of the family POACEAE that is the source of EDIBLE GRAIN. A hybrid with rye (SECALE CEREALE) is called TRITICALE. The seed is ground into FLOUR and used to make BREAD, and is the source of WHEAT GERM AGGLUTININS.Blood Group Antigens: Sets of cell surface antigens located on BLOOD CELLS. They are usually membrane GLYCOPROTEINS or GLYCOLIPIDS that are antigenically distinguished by their carbohydrate moieties.Ricin: A protein phytotoxin from the seeds of Ricinus communis, the castor oil plant. It agglutinates cells, is proteolytic, and causes lethal inflammation and hemorrhage if taken internally.Mannose: A hexose or fermentable monosaccharide and isomer of glucose from manna, the ash Fraxinus ornus and related plants. (From Grant & Hackh's Chemical Dictionary, 5th ed & Random House Unabridged Dictionary, 2d ed)Binding Sites: The parts of a macromolecule that directly participate in its specific combination with another molecule.Molecular Weight: The sum of the weight of all the atoms in a molecule.Galactosides: Glycosides formed by the reaction of the hydroxyl group on the anomeric carbon atom of galactose with an alcohol to form an acetal. They include both alpha- and beta-galactosides.Disaccharides: Oligosaccharides containing two monosaccharide units linked by a glycosidic bond.Oscillatoria: A genus of filamentous CYANOBACTERIA in the order Oscillatoriales. It is commonly found in freshwater environments, especially hot springs.Chlamydomonas: A genus GREEN ALGAE in the order VOLVOCIDA. It consists of solitary biflagellated organisms common in fresh water and damp soil.Immune Sera: Serum that contains antibodies. It is obtained from an animal that has been immunized either by ANTIGEN injection or infection with microorganisms containing the antigen.Mistletoe: Parasitic plants that form a bushy growth on branches of host trees which are in the order Santalales. It includes the Christmas mistletoe family (VISCACEAE), the showy mistletoe family (LORANTHACEAE) and the catkin mistletoe family (Eremolepidaceae). The composition of toxins, lectins, tyramine, phenethylamines, and other compounds may be affected by the host.Antibodies: Immunoglobulin molecules having a specific amino acid sequence by virtue of which they interact only with the ANTIGEN (or a very similar shape) that induced their synthesis in cells of the lymphoid series (especially PLASMA CELLS).Fluorescein-5-isothiocyanate: Fluorescent probe capable of being conjugated to tissue and proteins. It is used as a label in fluorescent antibody staining procedures as well as protein- and amino acid-binding techniques.Anemia, Hemolytic: A condition of inadequate circulating red blood cells (ANEMIA) or insufficient HEMOGLOBIN due to premature destruction of red blood cells (ERYTHROCYTES).Rabbits: The species Oryctolagus cuniculus, in the family Leporidae, order LAGOMORPHA. Rabbits are born in burrows, furless, and with eyes and ears closed. In contrast with HARES, rabbits have 22 chromosome pairs.Acrosome: The cap-like structure covering the anterior portion of SPERM HEAD. Acrosome, derived from LYSOSOMES, is a membrane-bound organelle that contains the required hydrolytic and proteolytic enzymes necessary for sperm penetration of the egg in FERTILIZATION.Immunoglobulin M: A class of immunoglobulin bearing mu chains (IMMUNOGLOBULIN MU-CHAINS). IgM can fix COMPLEMENT. The name comes from its high molecular weight and originally being called a macroglobulin.Coombs Test: A test to detect non-agglutinating ANTIBODIES against ERYTHROCYTES by use of anti-antibodies (the Coombs' reagent.) The direct test is applied to freshly drawn blood to detect antibody bound to circulating red cells. The indirect test is applied to serum to detect the presence of antibodies that can bind to red blood cells.Macroglobulins: Serum globulins with high molecular weight. (Dorland, 28th ed)Protein Binding: The process in which substances, either endogenous or exogenous, bind to proteins, peptides, enzymes, protein precursors, or allied compounds. Specific protein-binding measures are often used as assays in diagnostic assessments.Helix (Snails): A genus of chiefly Eurasian and African land snails including the principal edible snails as well as several pests of cultivated plants.Toxins, Biological: Specific, characterizable, poisonous chemicals, often PROTEINS, with specific biological properties, including immunogenicity, produced by microbes, higher plants (PLANTS, TOXIC), or ANIMALS.Amino Acid Sequence: The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.Glycopeptides: Proteins which contain carbohydrate groups attached covalently to the polypeptide chain. The protein moiety is the predominant group with the carbohydrate making up only a small percentage of the total weight.GlucosamineHemagglutination Inhibition Tests: Serologic tests in which a known quantity of antigen is added to the serum prior to the addition of a red cell suspension. Reaction result is expressed as the smallest amount of antigen which causes complete inhibition of hemagglutination.Binding Sites, Antibody: Local surface sites on antibodies which react with antigen determinant sites on antigens (EPITOPES.) They are formed from parts of the variable regions of FAB FRAGMENTS.GalactosamineAcrosome Reaction: Changes that occur to liberate the enzymes of the ACROSOME of a sperm (SPERMATOZOA). Acrosome reaction allows the sperm to penetrate the ZONA PELLUCIDA and enter the OVUM during FERTILIZATION.Anomura: An infraorder of CRUSTACEA, in the order DECAPODA comprising the hermit crabs and characterized by a small fifth pair of legs.Ulex: A plant genus of the family FABACEAE (sometimes classified as Papilionaceae). Members contain LECTINS.Arisaema: A plant genus of the family ARACEAE. It has a stemless, tuberous root.Lactose: A disaccharide of GLUCOSE and GALACTOSE in human and cow milk. It is used in pharmacy for tablets, in medicine as a nutrient, and in industry.Microscopy, Electron: Microscopy using an electron beam, instead of light, to visualize the sample, thereby allowing much greater magnification. The interactions of ELECTRONS with specimens are used to provide information about the fine structure of that specimen. In TRANSMISSION ELECTRON MICROSCOPY the reactions of the electrons that are transmitted through the specimen are imaged. In SCANNING ELECTRON MICROSCOPY an electron beam falls at a non-normal angle on the specimen and the image is derived from the reactions occurring above the plane of the specimen.Periodic Acid: A strong oxidizing agent.Trypanosoma lewisi: A trypanosome found in the blood of adult rats and transmitted by the rat flea. It is generally non-pathogenic in adult rats but can cause lethal infection in suckling rats.Chromatography, Gel: Chromatography on non-ionic gels without regard to the mechanism of solute discrimination.Succinic Anhydrides: A subclass of anhydrides with the general structure of dihydrofurandione. They can be substituted on any carbon atom. They modify and inhibit proteins and enzymes and are used in the acylation of amino- and hydroxyl groups.Plants, Medicinal: Plants whose roots, leaves, seeds, bark, or other constituent parts possess therapeutic, tonic, purgative, curative or other pharmacologic attributes, when administered to man or animals.Chitin: A linear polysaccharide of beta-1->4 linked units of ACETYLGLUCOSAMINE. It is the second most abundant biopolymer on earth, found especially in INSECTS and FUNGI. When deacetylated it is called CHITOSAN.Marasmius: A genus of tiny mushrooms in the family Tricholomataceae. They help break down the decaying organic matter of the forest floor.Leptospira interrogans serovar canicola: A serovar of the bacterial species LEPTOSPIRA INTERROGANS, whose natural host is DOGS where disease is characterized by GASTROENTERITIS, and INTERSTITIAL NEPHRITIS.ABO Blood-Group System: The major human blood type system which depends on the presence or absence of two antigens A and B. Type O occurs when neither A nor B is present and AB when both are present. A and B are genetic factors that determine the presence of enzymes for the synthesis of certain glycoproteins mainly in the red cell membrane.2-Hydroxy-5-nitrobenzyl Bromide: A chemical reagent that reacts with and modifies chemically the tryptophan portion of protein molecules. Used for 'active site' enzyme studies and other protein studies. Sometimes referred to as Koshland's reagent.Staining and Labeling: The marking of biological material with a dye or other reagent for the purpose of identifying and quantitating components of tissues, cells or their extracts.Mucins: High molecular weight mucoproteins that protect the surface of EPITHELIAL CELLS by providing a barrier to particulate matter and microorganisms. Membrane-anchored mucins may have additional roles concerned with protein interactions at the cell surface.Soybeans: An annual legume. The SEEDS of this plant are edible and used to produce a variety of SOY FOODS.Chemistry: A basic science concerned with the composition, structure, and properties of matter; and the reactions that occur between substances and the associated energy exchange.Cold Temperature: An absence of warmth or heat or a temperature notably below an accustomed norm.

Some leptospira agglutinins detected in domestic animals in British Columbia. (1/437)

During a period of six years 7,555 bovine sera, 421 canine sera, 251 porcine sera and 135 equine sera were tested for agglutinins to Leptospira interrogans serotypes canicola, grippotyphosa, hardjo, icterohemorrhagiae, pomona and sejroe. The bovine sera reacted predominantly with hardjo and/or sejroe at a rate of 15% compared to 3.5% with pomona. Breeding or abortion problems were associated with pomona but not with sejroe/hardjo agglutinins. The canine sera reacted to canicola (9.9%y and icterohemorrhagiae (5.4%), tcted predominantly with canicola (8.9%) and icterohemorrhagiae (8.1%).  (+info)

Platelet high affinity low density lipoprotein binding and import of lipoprotein derived phospholipids. (2/437)

The binding of low density lipoprotein (LDL) to the platelet cell membrane could facilitate the transfer of phospholipids from LDL to the platelets. A polyclonal antibody against the platelet glycoproteins IIb/IIIa inhibited the high affinity binding of 125I-LDL by up to 80%. The transfer of pyrene (py)-labeled sphingomyelin (SM), phosphatidylcholine and phosphatidylethanolamine from LDL to the platelets was unaffected by the antibody. The lectin wheat germ agglutinin (WGA) reduced the binding of 125I-LDL to the platelets by approximately 80%. In contrast, the lectin stimulated the transfer of SM from LDL into the platelets by about three-fold. WGA also specifically augmented the transfer of py-SM between lipid vesicles and the platelets, the stimulation being abolished in the presence of N-acetylglucosamine. Dextran sulfate (DS) increased the specific binding of 125I-LDL to the platelets by up to 2.8-fold. On the other hand, the import of LDL-derived py-phospholipids was unaffected by DS. Together, the results indicate that the phospholipid transfer from LDL to the platelets is independent of the high affinity LDL binding to the platelets and is specifically stimulated by WGA. Thus, the interactions of platelets with LDL phospholipids differ markedly from those with the apoprotein components of the lipoproteins.  (+info)

Role of nonagglutinating antibody in the protracted immunity of vaccinated mice to Pseudomonas aeruginosa infection. (3/437)

Effective immunization against infection with Pseudomonas aeruginosa is difficult to evaluate because agglutinin levels decline rapidly. Because fractionation of hyperimmune sera often yields more specific antibody than can be accounted for by direct agglutination tests, an immunoglobulin-specific assay based on antiglobulin augmentation was used to characterize antibody responses of C3H/HeJ mice vaccinated with P. aeruginosa type 2 lipopolysaccharide. Nonagglutinating antibodies, initially detected at 2 weeks post-primary vaccination, were predominantly immunoglobulin G after 5 weeks, and they remained elevated at levels usually 32-fold higher than the direct titer throughout the 4-month study period. The sequential production of immunoglobulin M, then immunoglobulin G, followed that found in orthodox immunological responses. Sera that contained nonagglutinating antibodies but not direct agglutinins (14 to 16 weeks) enhanced phagocytosis of P. aeruginosa type 2 by macrophages from unimmunized mice and passively immunized mice against lethal challenge doses; bactericidal activity of these sera was not demonstrated in the presence or absence of complement. When challenged with 1, 10, and 100 50% lethal doses at 16 weeks, survival rates of actively immunized mice were significantly higher than those of unvaccinated mice (P < 0.001). Thus, at a time when no direct agglutinins were detectable, the augmented system detected nonagglutinating antibodies that could confer protracted resistance in vaccinated mice to pseudomonas infection.  (+info)

Expression of DMBT1, a candidate tumor suppressor gene, is frequently lost in lung cancer. (4/437)

DMBT1 is a candidate tumor suppressor gene located at 10q25.3-26.1. Homozygous deletion of the gene was found in a subset of medulloblastoma and glioblastoma multiforme; lack of expression was noted in the majority of these tumors. In adult tissues, DMBT1 is highly expressed only in lung and small intestine tissues, indicating its important role in these organs. By analyzing lung cancer cell lines and primary lung tumors using reverse transcription-PCR, we found that 100% (20 of 20) of small cell lung cancer (SCLC) cell lines and 43% (6 of 14) of non-small cell lung cancer (NSCLC) cell lines lacked DMBT1 expression. Furthermore, 45% (9 of 20) of the primary NSCLCs exhibited a markedly low level of gene expression compared with corresponding normal lung tissues, indicating that lack of gene expression also occurs in primary lung cancers. To determine the potential mechanisms for lack of DMBT1 expression in lung cancer, we analyzed tumor cell lines for potential intragenic homozygous deletions of the gene and found such homozygous deletions in 10% (4 of 40) of SCLC cell lines but in none of 14 NSCLC cell lines. Moreover, the loss of expression could not be rescued by treatment with a demethylation agent (5-azacytidine) in two NSCLC cell lines lacking DMBT1 expression, suggesting that de novo methylation of the promoter region of the gene is unlikely to play a role in inactivation of the gene. We then sequenced the whole coding region of DMBT1 in 8 NSCLC cell lines that expressed DMBT1 and 20 primary NSCLCs. A potential point mutation at codon 52 was detected in a NSCLC cell line and resulted in an amino acid change from serine to tryptophan. Three common polymorphisms were also detected in tissues analyzed. Our data demonstrate that DMBT1 expression is frequently lost in lung cancer due to gene deletion and to other not yet identified mechanisms, suggesting that inactivation of DMBT1 may play an important role in lung tumorigenesis.  (+info)

Complement receptor 1 (CD35) on human reticulocytes: normal expression in systemic lupus erythematosus and HIV-infected patients. (5/437)

The low levels of complement receptor 1 (CR1) on erythrocytes in autoimmune diseases and AIDS may be due to accelerated loss in the circulation, or to a diminished expression of CR1 on the red cell lineage. Therefore, we analyzed the expression of CR1 on reticulocytes (R) vs erythrocytes (E). Healthy subjects had a significant higher CR1 number per cell on R (919 +/- 99 CR1/cell) than on E (279 +/- 30 CR1/cell, n = 23), which corresponded to a 3. 5- +/- 1.3-fold loss of CR1. This intravascular loss was confirmed by FACS analysis, which showed that all R expressed CR1, whereas a large fraction of E was negative. The systemic lupus erythematosus (SLE), HIV-infected, and cold hemolytic Ab disease (CHAD) patients had a CR1 number on R identical to the healthy subjects, contrasting with a lower CR1 on their E. The data indicated a significantly higher loss of CR1 in the three diseases, i.e., 7.0- +/- 3.8-, 6.1- +/- 2.9-, and 9.6- +/- 5.6-fold, respectively. The intravascular loss was best exemplified in a patient with factor I deficiency whose CR1 dropped from 520 CR1/R to 28 CR1/E, i.e., 18.6-fold loss. In one SLE patient and in the factor I-deficient patient, the FACS data were consistent with a loss of CR1 already on some R. In conclusion, CR1 is lost progressively from normal E during in vivo aging so that old E are almost devoid of CR1. The low CR1 of RBC in autoimmune diseases and HIV-infection is due to a loss occurring in the circulation by an active process that remains to be defined.  (+info)

Hensin, the polarity reversal protein, is encoded by DMBT1, a gene frequently deleted in malignant gliomas. (6/437)

The band 3 anion exchanger is located in the apical membrane of a beta-intercalated clonal cell line, whereas the vacuolar H(+)-ATPase is present in the basolateral membrane. When these cells were seeded at confluent density, they converted to an alpha-phenotype, localizing each of these proteins to the opposite cell membrane domain. The reversal of polarity is induced by hensin, a 230-kDa extracellular matrix protein. Rabbit kidney hensin is a multidomain protein composed of eight SRCR ("scavenger receptor, cysteine rich"), two CUB ("C1r/C1s Uegf Bmp1"), and one ZP ("zona pellucida") domain. Other proteins known to have these domains include CRP-ductin, a cDNA expressed at high levels in mouse intestine (8 SRCR, 5 CUB, 1 ZP), ebnerin, a protein cloned from a rat taste bud library (4 SRCR, 3 CUB, 1 ZP), and DMBT1, a sequence in human chromosome 10q25-26 frequently deleted in malignant gliomas (9 SRCR, 2 CUB, 1 ZP). Rabbit and mouse hensin genomic clones contained a new SRCR that was not found in hensin cDNA but was homologous to the first SRCR domain in DMBT1. Furthermore, the 3'-untranslated regions and the signal peptide of hensin were homologous to those of DMBT1. Mouse genomic hensin was localized to chromosome 7 band F4, which is syntenic to human 10q25-26. These data suggest that hensin and DMBT1 are alternatively spliced forms of the same gene. The analysis of mouse hensin bacterial artificial chromosome (BAC) genomic clone by sequencing and Southern hybridization revealed that the gene also likely encodes CRP-ductin. A new antibody against the mouse SRCR1 domain recognized a protein in the mouse and rabbit brain but not in the immortalized cell line or kidney, whereas an antibody to SRCR6 and SRCR7 domains which are present in all the transcripts, recognized proteins in intestine, kidney, and brain from several species. The most likely interpretation of these data is that one gene produces at least three transcripts, namely, hensin, DMBT1, and CRP-ductin. Hensin may participate in determining the polarized phenotype of other epithelia and brain cells.  (+info)

The extracellular matrix in the mouse brain: its reactions to endo-alpha-N-acetylgalactosaminidase and certain other enzymes. (7/437)

As our previous studies have indicated, the cingulate cortex of the adult mouse brain contains many neurons with rich cell surface glycoproteins which are linked by collagenous ligands to perineuronal proteoglycans. The present study demonstrated that exclusive incubation with endo-alpha-N-acetylgalactosaminidase abolished the lectin Vicia villosa or Wisteria floribunda agglutinin (VVA or WFA) labeling of the nerve cell surface glycoproteins, while it neither interfered with the cationic iron colloid or aldehyde fuchsin stainings of the perineuronal proteoglycans nor abolished the Gomori's ammoniacal silver impregnation of the collagenous ligands. Double incubations with endo-alpha-N-acetylgalactosaminidase and collagenase did not eliminate the lectin VVA or WFA labeling of the nerve cell surface glycoproteins, though they did eliminate the cationic iron colloid and aldehyde fuchsin stainings of the perineuronal proteoglycans as well as the Gomori's ammoniacal silver impregnation of the collagenous ligands. Triple incubations with endo-alpha-N-acetylgalactosaminidase, collagenase, and endo-alpha-N-acetylgalactosaminidase abolished the lectin VVA or WFA labeling of the nerve cell surface glycoproteins, and also eliminated the cationic iron colloid and aldehyde fuchsin stainings of the perineuronal proteoglycans and the Gomori's ammoniacal silver impregnation of the collagenous ligands. These findings indicate that: the nerve cell surface glycoproteins or their terminal N-acetylgalactosamines are digested by endo-alpha-N-acetylgalactosaminidase; these galactosamines associated with the collagenous ligands or perineuronal proteoglycans are not digested by endo-alpha-N-acetylgalactosaminidase; and the terminal N-acetylgalactosamines newly exposed by collagenase incubation are digested by this galactosaminidase. It was further demonstrated that hyaluronidase incubation neither digests the collagenous ligands nor revives the lectin VVA or WFA labeling of the nerve cell surface proteoglycans.  (+info)

Purification and characterization of a natural agglutinin from the serum of the hermit crab Diogenes affinis. (8/437)

A natural agglutinin from the serum of the hermit crab Diogenes affinis was purified to homogeneity by a single-step affinity chromatography using N-acetylglucosamine-coupled Sepharose 6B. The purified serum agglutinin (PSA) showed a strong affinity for rat RBC, and its hemagglutinating (HA) activity was specifically dependent on Ca2+ and reversibly sensitive to EDTA. PSA in active form has a molecular mass estimate of 185 kDa and is composed of four non-identical subunits (51, 49, 42 and 39 kDa) cross-linked by interchain disulfide bonds. The homogeneity of PSA was corroborated by immunodiffusion and immunoelectrophoretic analyses using rabbit antiserum raised against the agglutinin. The antibodies in this antiserum appear to be specific for RBC-binding sites of the agglutinin molecules as revealed by the ability of the antiserum to neutralize HA activities of both whole serum and PSA of D. affinis. In HA-inhibition assays performed with several carbohydrates and glycoproteins, PSA showed a distinct and unique specificity for acetyl group in carbohydrates independently of the presence of this group on C-2 or C-5 and its stereochemical arrangement in the axial or equatorial orientation. Besides, this agglutinin appears to recognize the terminal N- and O- acetyl groups in the oligosaccharide chain of glycoconjugates. The HA activity of D. affinis agglutinin was also susceptible to inhibition by lipopolysaccharides from diverse gram-negative bacteria, which might indicate a significant in vivo role of this humoral agglutinin in the host immune response against bacterial infections.  (+info)

*Peanut agglutinin

... (PNA) is plant lectin protein derived from the fruits of Arachis hypogaea. Peanut agglutinin may also be ... Available Structures of peanut agglutinin Because peanut agglutinin specifically binds a particular carbohydrate sequence it ... Peanut agglutinin activity is inhibited by lactose and galactose which compete for the binding site. Other uses include: Potent ... The name "peanut agglutinin" originates from its ability to stick together (agglutinate) cells, such as neuramidase-treated ...

*Autoimmune hemolytic anemia

This is the case in both cold agglutinin disease and cold paroxysmal hematuria. In general, mixed warm and cold AIHA shows a ... Cold agglutinin disease is treated with avoidance of cold exposure. Patients with more severe disease (symptomatic anemia, ... Steroids and splenectomy are less efficacious in cold agglutinin disease. Paroxysmal cold hemoglobinuria is treated by removing ... which includes cold agglutinin disease and paroxysmal cold hemoglobinuria. These classifications are based on the ...

*Warm antibody autoimmune hemolytic anemia

Contrary to cold autoimmune hemolytic anemia (e.g., cold agglutinin disease and paroxysmal cold hemoglobinuria) which happens ...

*Agglutinin

When an agglutinin is added to a uniform suspension of particles such as bacteria or blood, agglutinin binds to the agglutinin- ... An agglutinin is a substance that causes particles to coagulate to form a thickened mass. Agglutinins can be antibodies that ... Agglutinin might also be associated with diseases of which the most common is an autoimmune disease known as cold agglutinin ... Agglutinins can also be any substance other than antibodies such as sugar-binding protein lectins. Agglutinins work by clumping ...

*Soybean agglutinin

Soybean agglutinins (SBA) also known as soy bean lectins (SBL) are lectins found in soybeans. It is a family of similar legume ... Consumption of soybean agglutinin resulted in a depletion of lipid and an overgrowth of small intestine and pancreas in rats. ... Li, Z; Li, D; Qiao, S; Zhu, X; Huang, C (Aug 2003). "Anti-nutritional effects of a moderate dose of soybean agglutinin in the ... Meanwhile, poor growth of spleen and kidneys and pancreatic hypertrophy was observed in the soybean agglutinin-fed rats. An ...

*Cold agglutinin disease

Individuals with cold agglutinin disease present with signs and symptoms of hemolytic anemia. Those with secondary agglutinin ... Waldenström's macroglobulinemia may also be positive for cold agglutinins. In children, cold agglutinin disease is often ... Cold agglutinin disease was first described in 1957. Cold agglutinin disease can be either primary (arising spontaneously) or ... Secondary cold agglutinin disease is a result of an underlying condition. In adults, this is typically due to a ...

*Wheat germ agglutinin

An agglutinin protein, it binds to N-acetyl-D-glucosamine and Sialic acid. N-acetyl-D-glucosamine in the natural environment of ... Wheat germ agglutinin or WGA is a lectin that protects wheat (Triticum vulgaris) from insects, yeast and bacteria. ... Proteopedia: 2uvo - High resolution crystal structure of Wheat Germ Agglutinin in complex with N-acetyl-D-glucosamine ... How Does Wheat-Germ Agglutinin Bind Sialoglycoconjugates ?". European Journal of Biochemistry. 104 (1): 147-153. 9 April 1979. ...

*Daedaleopsis confragosa

"Agglutinins (lectins) from some British higher fungi". Mycological Research. 98 (3): 277-90. doi:10.1016/S0953-7562(09)80455-3 ...

*Testicular immunology

Wilson L (1954). "Sperm agglutinins in human semen and blood". Proc Soc Exp Biol Med. 85 (4): 652-5. PMID 13167169. Barker CF, ...

*Autoagglutination

Erythrophagocytosis in cold agglutinin disease. Yarali N, Arikoglu T, Oruc M, Isik P, Tunc B. J Pediatr Hematol Oncol. 2011 Jul ... Autoagglutination is seen to occur in a type of immune mediated hemolytic anemia known as cold agglutinin disease. Here, the ... The development of the cold agglutinins (as cold reacting antibodies are also known as) may result from the following ...

*Autoimmunity

A receptor, Peanut agglutinin receptor(PNAR)). This fact gave rise to the idea that spontaneous autoimmunity may result when ...

*Jacalin-like lectin domain

... a plant seed lectin and agglutinin from Helianthus tuberosus (Jerusalem artichoke). Agglutinin from Calystegia sepium (Hedge ... Proteins containing this domain include: Jacalin, a tetrameric plant seed lectin and agglutinin from Artocarpus heterophyllus ( ... Lectin MPA, a tetrameric plant seed lectin and agglutinin from Maclura pomifera (Osage orange). Heltuba lectin, ... which binds to the T-antigen and acts as an agglutinin. This domain is found in 1 to 6 copies in lectins. The domain is also ...

*Ludwik Hirszfeld

He proposed the A and B designations for the agglutinins. In 1910-1911 Hirszfeld discovered the heritability of blood groups ...

*Robin Coombs

Coombs RR, Mourant AE, Race RR (1945). "Detection of weak and "incomplete" Rh agglutinins: a new test". Lancet. 246 (6358): 15- ...

*Sinorhizobium meliloti

Handelsman, J., Ugalde, R. A., and Brill, W. J. (1984). "Rhizobium meliloti competitiveness and the alfalfa agglutinin". J. ...

*Cold autoimmune hemolytic anemia

Pathologic cold agglutinins occur at titers over 1:1000 and react at 28-31 °C and sometimes at 37 °C. Cold agglutinin disease ... In chronic cold agglutinin disease, the patient is more symptomatic during the colder months. Cold agglutinin mediated ... Translocation (8;22) has also been reported in association with cold agglutinin disease. Transplantation: Cold agglutinin- ... Patients with cold agglutinin disease should include good sources of folic acid, such as fresh fruits and vegetables, in their ...

*List of hematologic conditions

"Cold Agglutinin Disease: Overview - eMedicine Pediatrics: General Medicine". Retrieved 2009-02-07. "Paroxysmal cold ...

*Eyespot (wheat)

Immunocytochemical Localization of Wheat Germ Agglutinin in Wheat. The Journal of cell Biology, Vol 92, No.3 Retrieved November ...

*Coombs test

Coombs, R. R.; Mourant, A. E.; Race, R. R. (1945). "A new test for the detection of weak and incomplete Rh agglutinins". ...

*Kell antigen system

A new test for the detection of weak and incomplete Rh agglutinins. Br J Exp Pathol 1945;26:255 Chown B, Lewis M, Kaita K (1957 ...

*J. Donald Capra

Partial List: Willims Jr, R. C.; Kunkel, H. G.; Capra, J. D. (1968). "Antigenic specificities related to the cold agglutinin ... "Nucleotide sequence analysis of the V regions of two IgM cold agglutinins. Evidence that the VH4-21 gene segment is responsible ...

*Blood type

Coombs RR, Mourant AE, Race RR (1945). "A new test for the detection of weak and incomplete Rh agglutinins". Br J Exp Pathol. ...

*Blakeslea trispora

... and acts as a signal for the synthesis of the surface protein agglutinin. Agglutinin allows the two TSAs to recognize each ...

*Rh blood group system

Rh agglutinins (antibodies) are capable of causing hemolytic transfusion reactions with extravascular hemolysis. They may also ... No name was given to this agglutinin when described. In 1940, Karl Landsteiner and Alexander S. Wiener made the connection to ... producing Rh agglutinins and causing the blood of the fetus to agglutinate. Symptoms in the newborn usually include an ...

*Calcofluor-white

It shows similar staining patterns as Wheat Germ Agglutinin (WGA). It is especially useful for the identification of Mucor and ...
The fungus C. albicans uses adhesins to interact with human epithelial surfaces in the processes of colonization and pathogenesis. The C. albicans ALS (agglutinin-like sequence) gene family encodes eight large cell-surface glycoproteins (Als1-Als7 and Als9) that have adhesive function. This study utilized C. albicans Δals mutant strains to investigate the role of the Als family in oral epithelial cell adhesion and damage, cytokine induction and activation of a MAPK-based (MKP1/c-Fos) signaling pathway that discriminates between yeast and hyphae. Of the eight Δals mutants tested, only the Δals3 strain showed significant reductions in oral epithelial cell adhesion and damage, and cytokine production. High fungal:epithelial cell multiplicities of infection were able to rescue the cell damage and cytokine production phenotypes, demonstrating the importance of fungal burden in mucosal infections. Despite its adhesion, damage and cytokine induction phenotypes, the Δals3 strain induced MKP1 ...
After mucosal damage or gingival inflammation, complement proteins leak into the oral cavity and mix with salivary proteins such as salivary agglutinin (SAG/gp-340/DMBT1). This protein is encoded by the gene Deleted in Malignant Brain Tumors 1 (DMBT1), and it aggregates bacteria, viruses and fungi, and activates the lectin pathway of the complement system. In the lectin pathway, carbohydrate structures on pathogens or altered self cells are recognized. SAG is highly glycosylated, partly on the basis of the donors blood group status. Whereas secretors express Lewis b, Lewis y, and antigens from the ABO-blood group system on SAG, non-secretors do not. Through mannose-binding lectin (MBL) binding and C4 deposition assays, we aimed to identify the chemical structures on SAG that are responsible for complement activation. The complement-activating properties of SAG were completely abolished by oxidation of its carbohydrate moiety. SAG-mediated activation of complement was also inhibited in the ...
The salivary agglutinin glycoprotein (SAG) is present in saliva but is also part of the salivary pellicle, playing a seemingly paradoxical role with regard to bacterial homeostasis. On the one hand, SAG aggregates bacteria in solution, thereby preven
serum agglutinin An antibody which coats erythrocytes; the cells do not agglutinate when suspended in saline, but do agglutinate when suspended in serum or other protein media such as albumin. ...
Deleted in Malignant Brain Tumors-1 protein (DMBT1), salivary agglutinin (DMBT1SAG), and lung glycoprotein-340 (DMBT1GP340) are three names for glycoproteins encoded by the same DMBT1 gene. All these proteins belong to the scavenger receptor cysteine-rich (SRCR) superfamily of proteins: a superfamily of secreted or membrane-bound proteins with SRCR domains that are highly conserved down to sponges, the most ancient metazoa. In addition to SRCR domains, all DMBT1s contain two CUB domains and one zona pellucida domain. The SRCR domains play a role in the function of DMBT1s, which is the binding of a broad range of pathogens including cariogenic streptococci, Helicobacter pylori and HIV. Mucosal defense proteins like IgA, surfactant proteins and lactoferrin also bind to DMBT1s through their SRCR domains. The binding motif on the SRCR domains comprises an 11-mer peptide in which a few amino acids are essential for binding (GRVEVLYRGSW). Adjacent to each individual SRCR domain are glycosylation domains,
Home » Immune agglutinin. Immune agglutinin --, agglutinin 1. An antibody that causes clumping or agglutination of the bacteria or other cells which either stimulated the formation of the agglutinin, or contain immunologically similar, reactive antigen. Synonym: agglutinating antibody, immune agglutinin. 2. A substance, other than a specific agglutinating antibody, that causes organic particles to agglutinate, commonly qualified, e.g., plant agglutinin. ...
Bain, G O., "Agglutinin response to sheep erythrocytes in mice following intra- peritoneal injection of allogeneic spleen cells." (1963). Subject Strain Bibliography 1963. 57 ...
Looking for agglutinin absorption? Find out information about agglutinin absorption. taking of molecules of one substance directly into another substance. It is contrasted with adsorption adsorption, adhesion of the molecules of liquids,... Explanation of agglutinin absorption
distinguishes 0 AB0 antigen fucose antigen A - N-ftsetilglyukozamin and antigen B - galactose.These determinants are attached, and the development of antibodies in the immune response.These antigens are taken into account when blood transfusion, as well as when counting the possible inheritance of blood.. system AB0 and inheritance Back in 1901 in human blood were discovered substances that can be glued erythrocytes among themselves, which are called agglutinins (plasma factors agglutination - α and β) and agglutinogens (erythrocyte factors bonding - A andB).Under this system, the scientists J. Jansky and Karl Landsteiner divided all people into 4 groups, they are also calculated and inheritance of blood groups in humans.So, I blood group are people who do not have blood agglutinogens, but the plasma contains both agglutinin.Their blood is denoted by αβ or 0. People from the II group of blood have agglutinin agglutinogen A and β (Aβ or A0), people with Group III, in contrast, have ...
Shop Alpha-agglutinin ELISA Kit, Recombinant Protein and Alpha-agglutinin Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
Find people with Autoimmunologiczna niedokrwistość hemolityczna / Cold Agglutinin Disease through the map. Connect with them and share experiences. Join the Autoimmunologiczna niedokrwistość hemolityczna / Cold Agglutinin Disease community.
Find people with Autoimunní hemolytická anémie / Cold Agglutinin Disease through the map. Connect with them and share experiences. Join the Autoimunní hemolytická anémie / Cold Agglutinin Disease community.
Treatment:. Patients with few clinical symptoms and mild anemia may not require treatment but only avoidance of cold. Keeping the patient warm may be sufficient treatment. Treat any underlying infection e.g. Clarithromycin or Azithromycin for Mycoplasma pneumoniae.. Anemia is generally mild. Only patients who have serious symptoms related to anemia or have a Raynaud-type syndrome that constitutes a threat to life or quality of life require active therapy.. Folic acid supplements for prevention and treatment of folate deficiency should be considered.. The disease is usually refractory to corticosteroids.. Rituximab may be an option for treatment in some cases.. In the presence of underlying lymphoma, chlorambucil or oral cyclophosphamide may be helpful.. Splenectomy is usually ineffective for the treatment of cold agglutinin disease, because the liver is the predominant site of sequestration. However, if the patient has splenomegaly, then the disease may respond to splenectomy. More importantly, ...
List of 31 causes for Abdomen blister and Cold agglutinin disease due to hiv and Tinnitus in children, alternative diagnoses, rare causes, misdiagnoses, patient stories, and much more.
A participant will be considered a responder if he or she did not receive a blood transfusion from Week 5 through Week 26 (EOT) and did not receive treatment for primary cold agglutinin disease (CAgD) beyond what is permitted per protocol. Additionally, the participants hemoglobin (Hgb) level must meet the following criterion: Hgb increase greater than or equal to (,=) 1.5 gram per deciliter (g/dL) from baseline (defined as the last Hgb value before administration of the first dose of study drug) at treatment assessment endpoint ...
Acrocyanosis is the bluish discoloration of the skin that occurs especially in the hands and feet. It can also affect the ears, nose, and nipples.
Cold agglutinin test is made to determine if high levels of cold agglutinins are resulting in a condition called autoimmune hemolytic anemia. Learn on reasons, results and more.
Cold agglutinin definition at Dictionary.com, a free online dictionary with pronunciation, synonyms and translation. Look it up now!
肺炎支原體(Mycoplasma pneumoniae、黴漿菌性肺炎)是一種可導致肺炎的支原體細菌,也有機會導致冷凝集素症(cold agglutinin disease)。這種由肺炎支原體引起的肺炎,又稱作黴漿菌性肺炎,盛行於學齡兒童。. 大多數患者只有輕微上呼吸道感染,有咳嗽、發燒、喉嚨痛、頭痛及疲倦等徵狀,有些患者有肺外症狀像是皮膚紅疹,嚴重者則可能患上肺炎,屬於非典型肺炎的一種。. 輕微黴漿菌性肺炎大多是自限性,不需藥物治療。但嚴重住院者,由於黴漿菌性肺炎不能用一般的肺炎藥來醫治,即使兒童感染了黴漿菌性肺炎,也只能用原來用於醫治成人肺炎的強效藥物來醫治,舉例來說,可以使用Macrolides類的抗生素像是Azithromycin。. ...
The British Society for Haematology is registered in England and Wales as a Company Limited by Guarantee, No 2645706 and as a Charity, No 1005735 Registered Office and correspondence address: 100 White Lion Street London N1 9PF. Phone: 020 7713 0990 ...
I I I I I I I I I I I I I I I I iI I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I ...
Cold Agglutinin hemolytic anemia due to cold autoantibodies associated with Mycoplasma pneumoniae is rare. Optimal treatment includes antibiotics and maintenance of a constant warm environment for the patient. This treatment, however, may result in a prolonged, costly, and confining hospitalization.. We report the use of an environmental suit for a patient with severe hemolysis due to M. pneumoniae pneumonia. This suit provides a constant temperature and has enabled the patient to journey outside his room, despite winter temperatures, yet avoid further hemolytic episodes. Early discharge was possible and has facilitated the patients return to home and work as well as ...
Red cell agglutinins are infrequently seen in infectious mononucleosis (∼1% of cases) and have been ascribed to polyclonal IgG/IgM cold agglutinins specific for the i antigen on the red cells. The weakly positive DAT using anti-C3d and the negative DAT using anti-IgG are characteristic for infectious mononucleosis, indicative of complement-mediated intravascular hemolysis that can occur 1 to 2 weeks after infection ...
This view is a gene level view. To access the transcript level displays select a Transcript ID in the table above and then navigate to the information you want using the menu at the left hand side of the page. To return to viewing gene level information click on the Gene tab in the menu bar at the top of the page. ...
111i II i Itl ill. 11111 I I I I I I I I I I I I t tit && I I I I I I J III I I II I J I I I " .,1 I I I II 1 . fr.II..iflll ...
Human milk contains immune molecules involved in the protection of newborns against infections. We analyzed the concentration of Deleted in Malignant Brain Tumors 1 (DMBT1), a protein with functions in innate immunity, in breast milk. DMBT1 was
People who run businesses on the internet are being assaulted by parasite Windows programs that silently divert money from legitimate e-commerce. These parasites are quietly loaded when you install an ordinary program or carrier.
本調査レポートでは、"トップ10ケアケミカルの世界市場予測(~2021):カラー化粧品、パーソナルケア成分、活性成分、香料成分、業務用I&I洗浄剤、界面活性剤、軟化エステル、化粧用顔料、化粧品防腐剤、エトキシレート"について調査・分析し、イントロダクション、エグゼクティブサマリー、市場概観、市場の成長要因、阻害要因、市場の機会と課題、産業動向、サプライチェーン分析、市場環境分析、市場の動態、地域別分析、市場規模及び予測、競争状況、新製品発売、主要企業(ベンダー)分析等の情報をお届けいたします ...
Publication Policy Emrrors and Omise.-ors AOa., insersir sh"ul,1 Mhe: r.a 5-ii r- ,a ir. Ir- i I r. l..A.i : r.,il r :. ,.hi h I.:.i, IW. 1 1. r,, 0 i.ut.i; rn ;, 3, .1 ,:.1 a cI ) 1.... slor i .r e -.r.:.r-; inr pu.i-,i.. .r, ...:,I I I. re *Ilen l The nri c ]l of nme ad loit h if. ira da/ ...
Looking for online definition of cold agglutinin disease in the Medical Dictionary? cold agglutinin disease explanation free. What is cold agglutinin disease? Meaning of cold agglutinin disease medical term. What does cold agglutinin disease mean?
TY - JOUR. T1 - A Waldenstrom macroglobulin that is both a cold agglutinin and a cryoglobulin because it binds N-acetylneuraminosyl residues. AU - Tsai, C. M.. AU - Zopf, D. A.. AU - Yu, Robert K. PY - 1977/1/1. Y1 - 1977/1/1. N2 - A purified human monoclonal IgM(κ) (cold agglutinin MKV) has been characterized as both a cold agglutinin and a cryoglobulin. Since its reactivity with human erythrocytes but not with dog erythrocytes is reduced by treatment of the cells with ficin and its reactivity with both is abolished by treatment of the cells with neuraminidase, it has by definition Pr2 specificity [Roelcke, D. (1974) Clin. Immunol. Immunopath. 2, 266-280]. Presumably, the membrane receptors for cold agglutinin MKV are sialic acid-containing glycoproteins in human cells and sialic acid-containing glycolipids in dog cells. Agglutination of erythrocytes is specifically inhibited by II3-N-acetylneuraminosyllactosylceramide (GM3) and N-acetylneuraminosylparagloboside but not by their ...
TY - JOUR. T1 - Cold agglutinin disease complicated by acrocyanosis and necrosis. AU - Gregory, Gareth P.. AU - Farrell, Ann. AU - Brown, Susan. PY - 2017/3/1. Y1 - 2017/3/1. KW - Acrocyanosis. KW - CAD. KW - CAIHA. KW - Hemolysis. KW - Necrosis. U2 - 10.1007/s00277-016-2905-6. DO - 10.1007/s00277-016-2905-6. M3 - Letter. VL - 96. SP - 509. EP - 510. JO - Annals of Hematology. JF - Annals of Hematology. SN - 0939-5555. IS - 3. ER - ...
Peanut agglutinin (PNA) is plant lectin protein derived from the fruits of Arachis hypogaea. Peanut agglutinin may also be referred to as Arachis hypogaea lectin. Lectins recognise and bind particular sugar sequences in carbohydrates; peanut agglutinin binds the carbohydrate sequence Gal-β(1-3)-GalNAc. The name "peanut agglutinin" originates from its ability to stick together (agglutinate) cells, such as neuramidase-treated erythrocytes, which have glycoproteins or glycolipids on their surface which include the Gal-β(1-3)-GalNAc carbohydrate sequence. The protein is 273 amino acids in length with the first 23 residues acting and a signal peptide which is subsequently cleaved. It has a Uniprot accession of P02872. There are over 20 structures of this protein in the PDB which reveal and all beta-sheet protein with a tetrameric quaternary structure. It is a member of the Lectin_legB PFAM family. Available Structures of peanut agglutinin Because peanut agglutinin specifically binds a particular ...
Section for Research and Innovation. Haugesund Hospital. Sigbjørn Berentsen Dr. med. is a specialist in internal medicine and a former head of section and senior lecturer. He has done research on autoimmune haemolytic anaemia with the emphasis on cold agglutinin disease.. The author has completed the ICMJE form and reports no conflicts of interest.. Maria Winther Gunnes and Kristin Gjerde Hagen have contributed equally to this article.. ...
Purified Native Wheat Germ Agglutinin Protein from Creative Biomart. Native Wheat Germ Agglutinin Protein can be used for research.
Definition of Wheat germ agglutinin with photos and pictures, translations, sample usage, and additional links for more information.
No són bons per a la cuina a causa fonamentalment de la seua mida i poca consistència. Tot i així, el cama-sec (Marasmius oreades) és de qualitat excel·lent i és possible conservar-lo en bones condicions mitjançant la seua dessecació.[9][4]. ...
Tulipa gesneriana agglutinin: agglutinates mouse erythrocytes; do not confuse with tulip lectin which preferentially agglutinates Saccharomyces yeasts; MW appr 40kDa; composed of 2 subunits with MW 26kDa & 14kDa
The ALS gene family encodes large cell-surface glycoproteins associated with C. albicans pathogenesis. Als proteins are thought to act as adhesin molecules binding to host tissues. Wide variation in expression levels among the ALS genes exists and is related to cell morphology and environmental conditions. ALS1, ALS3, and ALS4 are three of the four most highly expressed ALS genes. This work describes the production and use of specific high affinity monoclonal antibodies against Als1, Als3, and Als4 to evaluate protein production and localization at both the individual cell and population levels. Production and localization of these proteins is tightly regulated and occurs under specific growth conditions. When examined at a population level, it is clear that cells from the same culture can have different profiles of Als proteins on the cell surface. These results provide a very different view of the Als family than the view held by those who suggest that the Als family functions in antigenic ...
16 May 2003 This report represents my first set of observations with the SSP-4 (1mm detector). What I have tried to accomplish with this set of observations is to refine my observation technique so that I can make accurate and repeatable measurements. I feel this goal has been accomplished, that is, the SSP-4 photometer is capable of repeatable measurements with a predictable accuracy. I plan to add to this report as I gather more observations. In my next phase of observations I will concentrate on determination of the color transformation coefficients, airmass extinction terms, and the signal-to-noise (SNR) dependence with magnitude. Table 1 presents the results of differential photometry measurements taken with the Optec SSP-4 (1mm detector). The telescope used was a Meade 0.25m SCT in alt-az configuration. The column labeled "Comp SNR" and "Target SNR" represents the SNR of the comparison and target stars, respectively. The SNR is calculated from the ratio (average counts for n ...
Effect of a Dmbt1 deletion on ALT and AST levels after feeding a Western style diet in Dmbt1-/- and Dmbt1+/+ mice. Activity levels of (A) alanine-aminotrans
In a previous paper (1) we described rather paradoxical serologic interrelationships between four variant strains of an alkaligenes bacillus that had been derived experimentally from a common ancestor. Three of these strains, namely, K-97, K-84 and K-160, morphologically diverse, were serologically reciprocal and a fourth, K-134 showed a typical group and specific agglutinin interrelationship with strains K-97 and K-84. This is the equivalent of saying that the anti-serum of K-134 apparently did not contain agglutinins for K-97 and K-84 although their antisera contained group agglutinins for K-134.. Inasmuch as such relationships are quite well known they would not have been questioned had not the strain K-160 agglutinated in the supposedly specific K-134 antiserum, but since K-160 was serologically identical with K-97 and K-84 we sought the reason why these latter two strains did not also agglutinate in the specific anti-serum of K-134.. ...
Has worked for Mike for various gene synthesis targets lengths ~300bp - 1500bp. More difficult for ,1500bp. Use Joshs gene synthesis method or gBlocks and Gibson assembly for longer sequence genes. Rough protocol: Identify your target amino acid sequence. Plug it into DNAworks online software with your preferred excluded sequences (restriction sites, barcodes, screening primer sequences, etc.) and rough parameters - a rule of thumb that has worked in the past is 70 nt oligo length and ~63C annealing temp. You will get a set of primers out of the software. http://helixweb.nih.gov/dnaworks/ PAN oligo synthesis works for ordering all of these primers with enough fidelity to get a working full synthesis. This set will be an even number of oligos 1 - n, oligo number #1 and #n are the full length amplification oligos. The synthesis works by a two-step PCR process: First run an assembly PCR with all the oligos excluding the full length amplification oligos #1 and #n. A quick recipe for this PCR is to ...
Homologous recombination between DNA sequences residing in the chromosome and newly introduced, cloned DNA sequences (gene targeting) allows the transfer of any modification of the cloned gene into the genome of a living cell. This article discusses the current status of gene targeting with particular emphasis on germ line modification of the mouse genome, and describes the different methods so far employed to identify those rare embryonic stem cells in which the desired targeting event has occurred. ...
There are 14 twelve-letter words containing A, 3G and O: AGGLUTINOGEN AGGREGATIONS CONGREGATING ... TOBOGGANINGS WATCHDOGGING WATERLOGGING. Every word on this site can be played in scrabble. Build other lists, that start with or end with letters of your choice.
Guthrie, C. G. und Huck, J. G., On the existence of more than four isoagglutinin groups in human blood. Bull. Johns Hopkins Hosp. 1923. 34, 37-48; 34, 80 bis 88; 34, 128-135 (zit. nach 20).Google Scholar ...
In biology, agglutination can mean a couple of things: The clumping together of cells due to the binding of agglutinin (a protein) molecules...
100. YILINDA I. DÜNYA SAVAŞI ULUSLARARASI SEMPOZYUMU 1 03 KASIM / NOVEMBER 2014, PAZARTESİ / MONDAY SALON I / HALL I I. OTURUM / SESSION I I. Dünya Savaşı na Giden Yolda 1908 Reval Mülakatı ve Osmanlı
mill Nidulariales hallucinational fibroadenia blastophoric volcanization luminist photics estoile Culex undisturbed fluke colcothar rosinweed bahay dielectrically biquadrantal azimuthal overcovetous Bosnian culler [email protected] ...
Na ovom mestu predstavljam nakupljene enigmatske radove, do sada (u velikoj većini) neobjavljene, uz ponešto aktuelnijih i svežijih, bez garantovanja dugovečnosti bloga. Bilo kako bilo, svi rešavači i putnici-blogonamernici su dobrodošli ...
f I I I I I I I I I I I I I I I I ,I .1 FINAL REPORT LEGISLATWE COUNCIL STUDY COMMITIEE TO EVALUATE THE ARIZONA STATE RETIREMENT SYSTEM January 1991 I I I I I I I I I I I I I I I I I I I FINAL REPORT LEGISLATIVE COUNCIL STUDY COMMIITEE TO EVALUATE THE ARIZONA STATE RETIREMENT SYSTEM January 1991 This final report of the Legislative Council Study Committee to Evaluate the Arizona State Retirement System is submitted to the Speaker of the House of Representatives and the President of the Senate pursuant to Laws 1989, Chapter 310, section 22. Dr. Richard Smith yo \ cZ~~~ Mr. Lowell Sutton Senator Hill Senator Osborn Senator Mawhinney Representative Cajero Representative Wessel ./ / ./ r,1?L--7- ,-, ~# Representative Gertfrd / I I I ,I I, I I I I I I I I I I I I I I I I I I I I I I I I -I I I I I I II BACKGROUND Laws, 1989, Chapter 310, provided for the establishment of a fifteen member study committee to examine numerous issues relating to the Arizona State Retirement System (see Attachment ...
i i i.hi i;i i i ii i i il v . i rin i ii i i , h sl-i.ilal mil hi \,, nni 1 i in ehel 1 â- . els hi i ll"l ss ill till , im e e , ,,, ,,, l i \ ll i i i , lie iii il i ,,,, ojlub rates 11 i i i i i . . • i â- i • ••, ui i iii 1mm it \ i i s ii i • . , . i • u 1 j jli.fl £**&£ •» a i i i ii 1 â- v i i i i i 1 i i i i i i u .,. i.i i â- â- i , i . â- i \ - r v ii nil \ 1 \\ , v • . i i â- i i i i v i v â- . v liirn-r tift i i , i v i i , ,, li , v â- n v t i 1 i i,l \! j nn ispkci i s , 1 i in souili carolina sun ol i iiijk i a;.c it ii ir..,i..m-,i tn publish i i u \\ i.r.k a v \ ri;i ml li.u.i u . â- ! - in i i ir.rt . , i . â- i tli i tm iftaitgttii ... i i m hi , u : t . rl ul li 1itpcr vvif i ih i in â- â- i â- i â- injn i i in i . nml i r iii i build n,i in u . .•,. mi . i i • mi . miii i , i i mhi far hi - ii mi hi in iii i • . ii i vi .: â- . i im i mtpi im hi i uni ii h â- â- ...
Looking for the definition of isoagglutinin? Find out what is the full meaning of isoagglutinin on Abbreviations.com! The Webs largest and most authoritative acronyms and abbreviations resource.
Pisum sativum|/em| agglutinin is nearly identical in structure and carbohydrate specificity to |em|Lens culinaris|/em| agglutinin.
Mushroom Observer, Inc., has been recognized as a section 501(c)(3) public charity serving educational purposes. Your donations will help us maintain free online access to all the mycological observations already recorded, and to continue to improve the platform to make the collected information even more useful ...
Febrile Antigens are intended for the detection of bacterial agglutinins associated with a bacterial infection. Medical License Required. 5 mL
ATITH : Specimen must arrive within 10 days of draw. Container/Tube: Red top Specimen Volume: 2.5 mL Additional Information: 1. Include patients blood type and age. 2. If test BTITH / Isoagglutinin Titer, Anti-B, Serum is also requested for Type O patients, 1 tube containing 2.5 mL of serum is acceptable for both tests. Forms: If not ordering electronically, complete, print, and send a Benign Hematology Test Request Form (T755) with the specimen (http://www.mayomedicallaboratories.com/it-mmfiles/benign-hematology-test-request-form.pdf)
Wheat germ agglutinin (WGA) contains a group of closely related isolectins, with an isoelectric point about pH 9. The receptor sugar for WGA is |em|N|/em|-acetylglucosamine, with preferential binding to dimers and trimers of this sugar.
j i ii i vi i .: ii i i-i i i , ,, . nil kans t i.i i.i.i i i i m \, i \, li kill m mililit li 1 :. n tnl .. ii i . i , , ii ,. •:„ i • - , , . . iiiniil : "." li • i ... to - . tt i , ,, i i lull 1 1 â- " i , â- aililioll ill 1 , 111 i toil ... . -, j i i lunn i , mi innl i ,,,!.. i , â- i . 1 , i i il if i ol mllol it-ill 1 ... mil i i "• " ." â- â- i r.n.mi in ii . ,, i i i , nn i . i i : , .... i , i l,e /, ii ..,..., wi i .. .... .,,..:. . i . llm i ii.-i.-r , ml l im i ii.-l.-t n i . , n.-i i il fort lu il i.l on ... : . i ,, : 1 ii • .. kill li.-ur uf a iim iii in lllll nl ilinl.lv • it ,. ,,,, ii • r i . , ,. tl . i limit imii ii i i â- , - i 1,1 !..,â- " i linlfut lill.lt i . â- tl ,, , li.u , i 1 11 1 .,, . ii . ihi lit ll ll ,..!! ll 1,1 he , ,.. l i ball hi i l.l â- ii 1 i i ... i i i ..«-.-,.., i i a ri i i / i i i , â- tl : - â- â- i - â- i i • . - ii „ 7 - . -, i ui ii : . . ...
NOUN: A skin condition characterized by the development of recurring boils. ETYMOLOGY: Latin f runculus, furuncle; see furuncle + -osis. See also: Chronic furunculosis is a condition where you have crops of boils that occur over a period of time. The boils can develop continuously, or occur from time to time. Recurring boils (chronic furunculosis) If you develop recurring boils, your doctor may suggest some tests to look for an underlying cause. For example, to check if you have a poor immune system. One cause of recurring boils if you are otherwise healthy is that you, or someone in your family or household, may be a carrier of Staphylococcus bacteria. This means that a certain number of these bacteria live harmlessly on your skin, or in your nose. If you are a carrier you tend to be more prone to skin infections and boils. In particular, these bacteria may quickly invade and multiply in broken skin following a minor cut or injury. Treatment with antibiotics and/or antibiotic nasal cream ...
A List with 0 English Anagrams of AGGLUTININ -- FindTheWord.info is a search engine for English words. FindTheWord.info searches for partial words (both crossword solver and part of word), help with cheating in Scrabble and Wordfeud, finds anagrams, palindromes, and words in word, and much more.The dictionary used contains more than 589,000 English words.
I I I I I I I I I I I I I I I I I I J INSTITUT E FOR SIMULATION AND TRAINING Contract Number N61 339-92-C-004S September 26, 1994 Intervisibility Heuristics for Computer Generated Forces Institute for Simulation and Training 3280 Progress Drive Orlando FL 32826 University of Central Florida Division of Sponsored Research IST-TR-94-22 ...
The name carrier was used to denote that they carry the benefits of essential oils to the skin. Essential oils need to be diluted with carrier oils to reduce their concentration for they can otherwise cause severe skin irritation
Agglutination: …antibodies usually results in clumping-agglutination-of the red cells; therefore, antigens on the surfaces of these red cells are often referred to as agglutinogens.
1. The agglutination inhibition zone, artificially produced by heating, has been studied.. 2. The phenomenon is specific and is dependent upon the presence in the inhibition zone serum of altered agglutinin (agglutinoid).. ...
... Following typhoid infection, agglutinins usually appear by the end of 1st week, so blood taken earlier will give a negative result. Antibody titers increases steadily till the 3rd or the 4th week, aft
Looking for online definition of agglutination reaction in the Medical Dictionary? agglutination reaction explanation free. What is agglutination reaction? Meaning of agglutination reaction medical term. What does agglutination reaction mean?
Shop Soluble scavenger receptor cysteine-rich domain-containing protein ELISA Kit, Recombinant Protein and Soluble scavenger receptor cysteine-rich domain-containing protein Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
Wheat germ agglutinin (WGA) is a plant protein that binds specifically to sugars expressed, among many others, by human gastrointestinal epithelialand immune cells. WGA is a toxic compound and an anti-nutritional factor, but recent works have shown that it may have potential as an anti-tumor drug and as a carrier for oral drugs. To quantitate the toxicity threshold for WGA on normal epithelial cells we previously investigated the effects of the lectin on differentiated Caco2 cells, and showed that in the micromolar range of concentrations WGA could alter the integrity of the epithelium layer and increase its permeability to both mannitol and dextran. WGA was shown to be uptaken by Caco2 cells and only approximately 0.1% molecules were observed to cross the epithelium layer by transcytosis. Here we show that at nanomolar concentrations WGA is unexpectedly bioactive onimmune cells. The supernatants of WGA-stimulated peripheral blood mononuclear cells (PBMC) can alter the integrity of the ...
A novel agglutinin with specificity for sialic acid sequence of sugars in thyroglobulin is identified in the hemolymph of Scylla serrata. The physico-chemical characteristics of its binding affinity,...
This invention provides particles for agglutination reaction measurement with high antigen potency. They were characterized by revealing the antigen, which has polylysine from recombinant DNA, and have combined this with the particles for agglutination reaction measurement. The particles for agglutination reaction measurement do not carry the antigen (which is infectious) and are safe. The particles for agglutination reaction measurement can be manufactured easily and in large quantities ...
The experimental results which have been described demonstrate the following facts:. 1. In the type-specific agglutination reaction, when the organisms are not present in sufficient numbers to absorb completely all the antibodies from the serum, more antibody is bound by cellular S than is required for the process of agglutination.. 2. The excess of antibody thus bound can then unite with additional amounts of the specific substance when this is added in soluble form to the agglutinated material.. 3. If an excess of the free S is added to an agglutinated mass of antibody and bacteria, the organisms are redispersed and in the suspended state are again specifically agglutinable.. 4. When a solution of the specific polysaccharide is added in excess to an homologous immune serum, a prozone is created in which precipitation is inhibited; moreover, if, at this point, type-specific pneumococci are added to the mixture, inhibition of agglutination also occurs.. 5. The reactive substance in the ...
16.6 - Locating and Sequencing Genes Learning Objectives • Recap how DNA probes and DNA hybridisation is used to locate specific genes. • Learn how the exact order of nucleotides on a strand of DNA can be determined. • Learn how restriction mapping can be used to determine nucleotide sequences. DNA Probes • DNA probes are simple, short and single-stranded sections of DNA. • They will bind to complementary sections of other DNA strands. • Due to being labelled in some way, they make this other DNA easily identifiable. Labelling with radioactivity Labelling with fluorescence Remember that probes can be used as an easy method of screening (detecting) for mutated genes. But also remember that the probe needs to be complementary to the mutated gene. So this means, that to produce a probe, you first need to sequence your gene. How do we sequence genes? Meet Frederick Sanger... • • • • • Biochemist Cambridge University English Two Nobel Prizes Still Alive Sangers work in the ...
A method for separating plasma from red blood cells and a device utilizing the method in which a low-pressure filter is interposed in a pathway between an inlet port and a reaction area. The sole driving force for the movement of plasma from the filter to the reaction area is capillary force provided by a tubular capillary. The filter is selected from glass microfiber filters of specified characteristics, which can operate in the absence of agglutinins, and filters capable of separating agglutinated red cells from a plasma, which require the use of an agglutinin.
A method for separating plasma from red blood cells and a device utilizing the method in which a low-pressure filter is interposed in a pathway between an inlet port and a reaction area. The sole driving force for the movement of plasma from the filter to the reaction area is capillary force provided by a tubular capillary. The filter is selected from glass microfiber filters of specified characteristics, which can operate in the absence of agglutinins, and filters capable of separating agglutinated red cells from a plasma, which require the use of an agglutinin.
TJA-I is along with its isolectin TJA-II isolated from the root tubers of Japanese gourd. They are highly purified and one purification step involves bio specific affinity chromatography to ensure highest possible binding affinity. They both have affinity for lactose but while TJA-II favours fucose alpha1-greater than 2 lactose TJA-I favours acidic groups coupled to N-Acetyl-D-lactosamine in 1,4 position.
VOLUME XVII. COLUMBUS, SATURDAY EVENING, APEIL 8, 1854, NUMBER 227. piUji! l)t0JJtatc 3ottnml - 3 IS PlTj)I,lSIIED EVERY EVEVING, EXCEPT SIJdv7T j BY TUB OiaT)" SflllJ jllURXAL (II.HlM.NVr jnuRXU liUILMMig, Hllill ANO r4Rl (IWIHJI1U.M1 ON llli.ll T Ell MS Invariably in tvhnnct In Cniiiiiihurj, $ 00 a war ; by mail, S5.10. Dull r during th mIoo nf tlM Legislature, mi. I tri-Weekly for the rn-taindrr of the rimr, ii)0. Til 8 WLKKLY WKNAli to furui-h! to city sulwcruVra at PS, and by niiiil t LoO soar. Clubs of four and upwards, si Si5; el en and upnards, 100. Ill ii Tin-IV T.10KLY JOURNAL is 3 00 a year. M tS OF ADVEllTlSiyols THK DAILY JOUKS.il.. The following rars arid ruins bavs been agrsed upon between tli proprietori of the Oain Staiuman and thff fMio SMie Jotnnal, to he ohserrcd in all east, after this data. July 20, 1W One square, 10 lines or hwa of thli sized type, for one Insertion. 50c. ; w.li additional insertfon, 25o. i i i i i i I l I J I I 1 a! IJcf. Ss SoSt 8 8 18! 1 ...
The Ice Bucket Challenge, with garnered donations and awareness for ALS Assocation research two years ago, has helped fund a gene discovery.
In biology, agglutination can mean a couple of things: The clumping together of cells due to the binding of agglutinin (a protein) molecules...
CZ: Špička Bulliardova SK: Tanečnica Bulliardova PL: Twardzioszek nalistny NL: Dwergwieltje DE: Käsepilzchen Nadelstreu-Käsepilzchen DK: Furet ...
Project Noah is a tool that nature lovers can use to explore and document local wildlife and a common technology platform that research groups can use to harness the power of citizen scientists everywhere.
ret:RHE_PE00210 K00799 glutathione S-transferase [EC:2.5.1.18] , (GenBank) gste; glutathione S-transferase protein (A) MAYELYYWDGIQGRGEFVRLALEEAGADYVDVTRQPGRGTGAMLEIMKSEGEPHIPFAPP FLKDGDLLIPHVANILFYLGPKLGLAPEDESLRFVANGLQLTITDFVAEAHDTHHPIDLS LYYEDQKQEAKARSSAFIRDRIPKFLGYFERVLTRNPQGPNHMVGNALTYVDLSLFQMIE GLTYAFPKAMKKSKAEYPALLALHDAVAKRPNIARYLASPRRLAFNEEGIFRRYPELDAG S ...
S100兔多克隆抗体(ab34686)可与小鼠, 大鼠, 牛, 人样本反应并经WB, ELISA, IHC实验严格验证,被5篇文献引用并得到1个独立的用户反馈。所有产品提供质保服务,中国75%以上现货。
S100A12兔多克隆抗体(ab37657)可与人样本反应并经WB, ELISA, IHC实验严格验证,被5篇文献引用。所有产品均提供质保服务,中国75%以上现货。
ABO-incompatible (ABO-i) kidney transplantation (KT) has emerged for overcoming the shortage of organ donors. Although this technique initially achieved only low graft survival due to isoagglutinin, recently developed desensitization protocols have improved survival to levels that are comparable to ABO-compatible KT. However, isoagglutinin is still regarded as a major obstacle to ABO-i KT. In this study, we evaluate the impact of isoagglutinin titer on clinical outcomes as well as factors that may influence isoagglutinin titers. In total, data from 95 patients who underwent ABO-i KT were analyzed. Preoperatively, rituximab administration and plasmapheresis were performed until the titer was reduced to ≤1:4. Retrospective analysis included blood group; timing and dosage of rituximab; isoagglutinin titer; number of plasmapheresis; and clinical outcomes including graft survival and serum creatinine. Graft survival was 95.8% (n = 91) and average serum creatinine at 1- and 1.5-year post-ABOi-KT was ...
Mono- and Stereopictres of 5.0 Angstrom coordination sphere of Sodium atom in PDB 3ecq: Endo-Alpha-N-Acetylgalactosaminidase From Streptococcus Pneumoniae: Semet Structure
The protein encoded by this gene is a member of the scavenger receptor cysteine-rich (SRCR) superfamily, and is exclusively expressed in monocytes and macrophages. It functions as an acute phase-regulated receptor involved in the clearance and endocytosis of hemoglobin/haptoglobin complexes by macrophages, and may thereby protect tissues from free hemoglobin-mediated oxidative damage. This protein may also function as an innate immune sensor for bacteria and inducer of local inflammation. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Aug 2011 ...
Ricinus communis (castor bean) Agglutinin (RCA120)-biotin conjugate Secondary Antibodies RCA15-BTN Ricinus communis (castor bean) Agglutinin (RCA120)-biotin conjugate Secondary Antibodies RCA15-BTN
Hop on to get the meaning of Pa-il acronym / slang / Abbreviation. The Medical & Science Acronym / Slang Pa-il means... AcronymsAndSlang. The Pa-il acronym/abbreviation definition. The Pa-il meaning is Pseudomonas Aeruginosa Agglutinin. The definition of Pa-il by AcronymAndSlang.com
Intravascular clearance rates of gelatin-stabilized gold were compared with circulating titers of gelatin agglutinins in rats at increasing time intervals after blockading injections of gelatin-stabilized gold and S. marcescens endotoxin. The degree and duration of reticuloendothelial system (RES) blockade against the homologous colloid were directly related to the circulating levels of gelatin agglutinins. In contrast, plasma agglutinins were not decreased in endotoxin-induced blockade against the gelatin-stabilized colloid. In a further experiment, the plasma response to blockading injections of colloidal thorium dioxide, iron oxide, and zymosan was characterized by a transient increase in gelatin agglutinins suggesting the nonspecific release of opsonins from an extravascular source. The findings indicated that clearance rates of gelatin-stabilized colloids were dependent on the total available opsonin in the rat rather than the total circulating opsonin. It is suggested that RES blockade is ...
rdf:RDF xmlns:rdf="http://www.w3.org/1999/02/22-rdf-syntax-ns#" xmlns:bibo="http://purl.org/ontology/bibo/" xmlns:dc="http://purl.org/dc/elements/1.1/" xmlns:dcterms="http://purl.org/dc/terms/" xmlns:xsd="http://www.w3.org/2001/XMLSchema#" , ,rdf:Description rdf:about="https://kops.uni-konstanz.de/rdf/resource/123456789/9768", ,dcterms:available rdf:datatype="http://www.w3.org/2001/XMLSchema#dateTime",2011-03-24T18:14:16Z,/dcterms:available, ,dcterms:bibliographicCitation,First publ. in: Angewandte Chemie / International Edition 43 (2004), 7, pp. 900-903,/dcterms:bibliographicCitation, ,dc:contributor,Wittmann, Valentin,/dc:contributor, ,dcterms:issued,2004,/dcterms:issued, ,dc:format,application/pdf,/dc:format, ,dcterms:title,Spatial Screening of Cyclic Neoglycopeptides : Identification of Polyvalent Wheat-Germ Agglutinin Ligands,/dcterms:title, ,dc:date rdf:datatype="http://www.w3.org/2001/XMLSchema#dateTime",2011-03-24T18:14:16Z,/dc:date, ,dc:contributor,Seeberger, Sonja,/dc:contributor, ...
Rank: Genus. Status: Accepted Name: Marasmius. Author: Fr.. Citation: Fr., Fl. Scan.: 339 (1836). Deprecated Synonyms: Heliomyces Lév., Scorteus Earle, Tephrophana Earle, Androsaceus (Pers.) Pat., Polymarasmius Murrill, Agaricus sect. Androsaceus Pers., Discocyphella Henn., Hymenoconidium Zukal, Hymenomarasmius Overeem, Marasmius sect. Collybiopsis J. Schröt., Protomarasmius Overeem. Misspellings: Marsmius, Mirasmius, Marasimus. ...
Author summary Pseudomonas aeruginosa is an opportunistic pathogen that causes life-threatening infections. P. aeruginosa disease is increasing in prevalence while bacteria continue to evolve antibiotic resistance. It is not clear how mucosal fluids usually protect against opportunistic pathogens. Knowing the key ingredients would help us understand susceptibility and develop novel biocompatible therapeutics. Mucosal fluid factors suppressing bacterial virulence may induce less bacterial resistance than traditional antimicrobials. Here we show that DMBT1, an abundant mucosal fluid glycoprotein, enabled tear fluid to inhibit P. aeruginosa twitching motility. We also show DMBT1 directly binds pili, which mediate twitching motility, suggesting a potential mechanism for twitching inhibition. Reflecting the known importance of twitching motility in virulence, purified DMBT1 reduced P. aeruginosa traversal of human cornea epithelial cell layers in vitro, and protected against P. aeruginosa induced disease in
The endocrine system (hormones, neuropeptide and peptide hormones, and their receptors) controls almost every physiological function in the insect including reproduction, regulation of feeding, and development. The goal of this project is to identify neuropeptides and their receptors in both the codling moth, a major pest of apples, and a newly emerging pest insect of tree fruit, spotted-wing Drosophila. Our approach for identification of neuropeptides and receptors in codling moth is through generation of a transcriptome where we will sequence gene transcripts expressed in the brain (the source of neuropeptide production). We have collected thousands of codling moth heads (containing brains), extracted messenger RNA (the protein coding form of RNA) and converted the RNA to a more stable cDNA form. The cDNA has been sent to collaborators at Washington State University (Pullman, WA) to obtain DNA sequence information. For spotted-wing Drosophila, a different approach was used to identify ...
Marasmiaceae and Physalacriaceae mushrooms; Marasmius, Marasmiellus, Rhodocollybia, Macrocystidia, Armillaria pictures, habitat, identification guide
Disease prevention is the key to good health. It is always better to prevent a disease than to treat it. With this motive a mass immunization drive across the MET campus was organised by MET IOP. It is known that Typhoid is the 5th most common communicable disease in India. Whereas researches prove that in our country one in every twenty persons is a Hepatitis B virus carrier. Accidental contacts with such carriers, who are unaware about the virus they are harbouring, can transmit the virus to others. Having learnt this, MET IOP decided to have a vaccinations drive against Typhoid and Hepatitis B on Aug 08, 2009 for its staff, students and faculty as part of METs 2 Decade Celebration. On this occasion over 250 doses were administered.. ...
FOR IMMEDIATE RELEASE: WOODSIDE, CA: March 12, 2004: To determine if a saddle FITS a horses back, the laws of geometry require the comparison of all three (3) dimensions, of both surfaces, in relationship to each other. Unfortunately, saddles are not measured in three-dimensions. There is Gullet Width and Seat Length, but there are no standardized three-dimensional measurements to be able to relate the curvature of the horses backs to the shapes of saddles. This lack of an accurate calibrated measurement method is the reason why Equestrians have such difficulty finding a saddle to FIT their horse. To solve this challenge SADDLETECH has just released a new and improved MK I I edition of the CLASSIC SADDLETECH GAUGE that was originally released in 1997. The SADDLETECH GAUGE Mk I I is a simple mechanical instrument that permits the polyform of the shape of horses back and corresponding saddle to be defined by angles and arcs, providing the three-dimensional measurements required to determine ...
Gentaur molecular products has all kinds of products like :search , BioBasic \ Inclusion Body Solublization Buffer I \ I897294-100ml for more molecular products just contact us
BY ATT^raOMTY. By tlie President of tlte Uuited States. EN :.-!! : ! ■ ■ to 86, ijj.ju.ifYe. of towDxhip for ly six. efrange two. wwnfem, ,/■■■■ A-n, nineteen, and twenty, of :■:: r. icctlcm* oti eleven and I welve i ■ ■ i nd ! d« nn hip IS, the p irio :■- li ire m M tbe on ;:.;j. " ■■ I !, ■ i of February « G » ■ ■;■ i [lowing tuan- * i-..r- J .. i I ■;■.■..:... \ ;,. : Notts --■..: I to 30 I i . : ; th.- n rr li I .:- an J tin liana qf the •■-:■ iTf, ■.; li nt ths aorth half i noi : ;, . 14 . : ; , .. ■ .. . !■ .;.■■■; I I tu -.,: ■ f -.-..-■ .. and i ■ ths luilf ■■ north thi [Ul ■ ■■ ■ .1 .J ■■-..:. -.-:■ ui KOUl h sad a, tarter u tr, the nort bean q i ill ■■■ I it .:■.-... ■ on ■ . ■ ■■■■■ , : .. ■ . ■ .. i;. .■■ ■ . ! i ..-■■.: . .!■■ i . ; it;. 1, ir:■r ,f eant quarter 01 ■ ■ ■ . ■■.:.;.::■■■. half of northeaat Sluiir.)J norl ...
The style of terms in the index must be the same as the style in the text. | Alphabetization in indexes begins with the first letter of the term, eg, G period G phase G protein Commas precede letters in sorting order (examples from Thomas).cold, common cold agglutinin disease Vibrio, noncholera Vibrio cholerae infection Other punctuation is ignored. Omsk hemorrhagic fever virus Onyong-nyong virus For entries that are identical except for case, choose whether uppercase or lowercase will take precedence in sorting and be consistent throughout the index. abl1, 99, 106 110 Abl1, 95, 100 103 Brca1, 112 BRCA1, 54,
Rituximab, a chimeric anti-CD20 monoclonal antibody, has been shown to be highly effective in vitro in destroying B lymyhocytes using either human complement or antibody dependent cell mediated cytotoxicity. The drug action has also been reported to be equally efficient in vivo, as B lymphocytes became undetectable in peripheral blood after a single dose of drug.5 In view of its unique pharmacological property and highly selective action on CD20+ cells, rituximab has been chosen for treatment of various types of B lymphocyte mediated immune diseases, including non-Hodgkin lymphoma,6 myasthenia gravis,7 IgM related polyneuropathies,8 systemic lupus erythematosus,9 immune thrombocytopenia,10,11 and cold agglutinin disease.12 Recently, anti-B cell targeted immunotherapy has been tried on patients with refractory autoimmune haemolytic anaemia with various degree of success.2-4 However, its use in newborn infants has not been reported. This case report describes our experience of using this new ...
This page contains information about Dhatura Stramonium, also called Jimson Weed, very useful herb for treating asthma, medicinal properties Dhatura Stramonium, curative and healing qualities of Dhatura Stramonium, use of Dhatura Stramonium in Ayurvedic medicines, diseases that can be cured with Dhatura Stramonium
The classical pathway of complement plays multiple physiological roles including modulating immunological effectors initiated by adaptive immune responses as well as an essential homeostatic role in the clearance of damaged self-antigens. However, dysregulated classical pathway activation is associated with antibody-initiated, inflammatory diseases processes like cold agglutinin disease (CAD), acute intravascular hemolytic transfusion reaction (AIHTR) and acute/hyperacute transplantation rejection. To date, only one putative classical pathway inhibitor, C1 esterase inhibitor (C1-INH), is currently commercially available and its only approved indication is for replacement treatment in hereditary angioedema (HAE), which is predominantly a kinin pathway disease. Given the variety of disease conditions in which the classical pathway is implicated, development of therapeutics that specifically inhibit complement initiation represents a major unmet medical need. Our laboratory has identified a peptide that

Cold agglutinin disease | definition of cold agglutinin disease by Medical dictionaryCold agglutinin disease | definition of cold agglutinin disease by Medical dictionary

What is cold agglutinin disease? Meaning of cold agglutinin disease medical term. What does cold agglutinin disease mean? ... Looking for online definition of cold agglutinin disease in the Medical Dictionary? cold agglutinin disease explanation free. ... Related to cold agglutinin disease: cold antibody cold agglutinin disease. Etymology: AS, kald + L, agglutinare, to glue, dis, ... cold agglutinin disease. Cold agglutinin syndrome Clinical immunology An immune disorder characterized by IgM autoantibodies ...
more infohttp://medical-dictionary.thefreedictionary.com/cold+agglutinin+disease

Anti B cell targeted immunotherapy for treatment of refractory autoimmune haemolytic anaemia in a young infant | Archives of...Anti B cell targeted immunotherapy for treatment of refractory autoimmune haemolytic anaemia in a young infant | Archives of...

Lee EJ, Kueck B. Rituxan in the treatment of cold agglutinin disease. Blood1998;92:3490-1. ... Rituximab: a very efficient therapy in cold agglutinins and refractory autoimmune haemolytic anaemia associated with CD-20 ... The cold agglutinin titres for adult (I) cells, cord (I) cells, and patients cells were 32, 16, and 64 (normal range 1-32), ... 11 and cold agglutinin disease.12 Recently, anti-B cell targeted immunotherapy has been tried on patients with refractory ...
more infohttp://adc.bmj.com/content/88/4/337

Abrus precatorius - definition of Abrus precatorius by The Free DictionaryAbrus precatorius - definition of Abrus precatorius by The Free Dictionary

Abrin and agglutinin, lectins from the seeds of Abrus precatorius are type II ribosome-inactivating proteins that inhibit ...
more infohttp://www.thefreedictionary.com/Abrus+precatorius

Saga/Red Lucky Seed (Abrus precatorius Linn) | CCRCSaga/Red Lucky Seed (Abrus precatorius Linn) | CCRC

Abrin and agglutinin-I from the seeds of Abrus precatorius are type II ribosome-inactivating proteins that inhibit protein ... Abrin and agglutinin-I from the seeds of Abrus precatorius are type II ribosome-inactivating proteins that inhibit protein ... Abrus agglutinin (AAG), a hetero tetrameric gal beta (1-3) NAc gal specific lectin, is isolated from seeds of Abrus precatorius ... Abrus agglutinin (AAG), a hetero tetrameric gal beta (1-3) NAc gal specific lectin, is isolated from seeds of Abrus precatorius ...
more infohttp://ccrc.farmasi.ugm.ac.id/en/?page_id=129

Agglutinin - WikipediaAgglutinin - Wikipedia

When an agglutinin is added to a uniform suspension of particles such as bacteria or blood, agglutinin binds to the agglutinin- ... An agglutinin is a substance that causes particles to coagulate to form a thickened mass. Agglutinins can be antibodies that ... Agglutinin might also be associated with diseases of which the most common is an autoimmune disease known as cold agglutinin ... Agglutinins can also be any substance other than antibodies such as sugar-binding protein lectins. Agglutinins work by clumping ...
more infohttps://en.wikipedia.org/wiki/Agglutinin

Soybean agglutinin - WikipediaSoybean agglutinin - Wikipedia

Soybean agglutinins (SBA) also known as soy bean lectins (SBL) are lectins found in soybeans. It is a family of similar legume ... Consumption of soybean agglutinin resulted in a depletion of lipid and an overgrowth of small intestine and pancreas in rats. ... Li, Z; Li, D; Qiao, S; Zhu, X; Huang, C (Aug 2003). "Anti-nutritional effects of a moderate dose of soybean agglutinin in the ... Meanwhile, poor growth of spleen and kidneys and pancreatic hypertrophy was observed in the soybean agglutinin-fed rats. An ...
more infohttps://en.wikipedia.org/wiki/Soybean_agglutinin

Cold Agglutinins | LabCorpCold Agglutinins | LabCorp

Cold Agglutinins Related tests:. Complete Blood Count, Reticulocyte Count, Mycoplasma, Mono Test, Warm Agglutinins Why Get ... A cold agglutinin test may be used to help detect cold agglutinin disease and determine the cause of a persons hemolytic ... A cold agglutinin test may rarely be ordered to identify increased cold agglutinins if someone has a condition that has been ... This rare form of autoimmune hemolytic anemia is known as cold agglutinin disease. Cold agglutinin disease may be primary or ...
more infohttps://www.labcorp.com/help/patient-test-info/cold-agglutinins

Febrile/cold agglutinins: MedlinePlus Medical EncyclopediaFebrile/cold agglutinins: MedlinePlus Medical Encyclopedia

Agglutinins are antibodies that cause the red blood cells to clump together. ... Cold agglutinins: no agglutination in titers at or below 1:16. The examples above are common measurements for results of these ... Febrile (warm) agglutinins are active at normal body temperatures.. This article describes the blood test that is used to ... Warm agglutinins may occur with:. *Infections, including brucellosis, rickettsial disease, salmonella infection, and tularemia ...
more infohttps://medlineplus.gov/ency/article/003549.htm

RCPA - Cold agglutininsRCPA - Cold agglutinins

Cold agglutinins found in (idiopathic) cold haemagglutinin disease, mycoplasma pneumonia (anti-I); some lymphomas (anti-I or ...
more infohttps://www.rcpa.edu.au/Library/Practising-Pathology/RCPA-Manual/Items/Pathology-Tests/C/Cold-agglutinins

Agglutinin Disease - Circle of MomsAgglutinin Disease - Circle of Moms

one of my twins was recently-and finally-diagnosed with Agglutinin... ... agglutinin disease - i am a mother of 5 with my youngest being twins. ... All Communities , Stay at Home Moms , agglutinin disease agglutinin disease Conni - posted on 06/18/2010 ( 1 mom has responded ... one of my twins was recently-and finally-diagnosed with Agglutinin Disease- a form of cold urticaria. is there any other moms ...
more infohttps://www.circleofmoms.com/stay-at-home-moms/agglutinin-disease-554078

Cold Agglutinin Disease Clinical Presentation: History, Physical ExaminationCold Agglutinin Disease Clinical Presentation: History, Physical Examination

Cold agglutinin disease is a form of autoimmune hemolytic anemia caused by cold-reacting autoantibodies. Autoantibodies that ... encoded search term (Cold Agglutinin Disease) and Cold Agglutinin Disease What to Read Next on Medscape. Related Conditions and ... Cold Agglutinin Disease Clinical Presentation. Updated: Aug 28, 2018 * Author: Salman Abdullah Aljubran, MD; Chief Editor: ... Jacobs A. Cold agglutinin hemolysis responding to fludarabine therapy. Am J Hematol. 1996 Dec. 53(4):279-80. [Medline]. ...
more infohttps://emedicine.medscape.com/article/135327-clinical

Lectins:  Soybean Agglutinin (SBA), BiotinylatedLectins: Soybean Agglutinin (SBA), Biotinylated

div class=product-description-paragraph,Composed of four subunits of approximately equal size, soybean agglutinin is a family ... Biotinylated Soybean agglutinin has an appropriate number of biotins bound to provide the optimum staining characteristics for ... Biotinylated Soybean agglutinin has an appropriate number of biotins bound to provide the optimum staining characteristics for ... Composed of four subunits of approximately equal size, soybean agglutinin is a family of closely related isolectins. This ...
more infohttps://vectorlabs.com/biotinylated-soybean-agglutinin-sba.html

Wheat Germ Agglutinin 5 mgWheat Germ Agglutinin 5 mg

Wheat germ agglutinin (WGA) is one of the most widely used lectins in cell biology. The receptor sugar for WGA is N- ... Wheat germ agglutinin (WGA) is one of the most widely used lectins in cell biology. The receptor sugar for WGA is N- ...
more infohttps://www.mpbio.com/08790162-wheat-germ-agglutinin-5-mg

Lectins:  Peanut Agglutinin (PNA), Cy3 labeledLectins: Peanut Agglutinin (PNA), Cy3 labeled

Peanut agglutinin binds preferentially to the T-antigen, a galactosyl (β-1,3) ,em,N,/em,-acetylgalactosamine structure present ... Peanut agglutinin binds preferentially to the T-antigen, a galactosyl (β-1,3) N-acetylgalactosamine structure present in many ... Peanut agglutinin binds preferentially to the T-antigen, a galactosyl (β-1,3) N-acetylgalactosamine structure present in many ... Cy5 labeled Peanut agglutinin has an appropriate number of fluorochromes bound to provide the optimum staining characteristics ...
more infohttps://vectorlabs.com/cy5-labeled-peanut-agglutinin-pna.html

Clinical immunology of chronic cold agglutinin disease.Clinical immunology of chronic cold agglutinin disease.

We studied clinical and immunological characteristics of 15 patients with chronic cold agglutinin disease (CAD). Mean age at ... All patients had V(H)4-34 encoded IgM kappa cold agglutinins (CA) in high titre. In five patients IgM increased significantly ... We studied clinical and immunological characteristics of 15 patients with chronic cold agglutinin disease (CAD). Mean age at ...
more infohttp://www.biomedsearch.com/nih/Clinical-immunology-chronic-cold-agglutinin/10530415.html

peanut agglutinin Protocols and Video...'peanut agglutinin' Protocols and Video...

Video articles in JoVE about peanut agglutinin include Chemically-blocked Antibody Microarray for Multiplexed High-throughput ... Peanut Agglutinin: Lectin purified from peanuts (Arachis hypogaea). It binds to poorly differentiated cells and terminally ...
more infohttps://www.jove.com/keyword/peanut+agglutinin

Serum agglutinin - Biology-Online DictionarySerum agglutinin - Biology-Online Dictionary

serum agglutinin An antibody which coats erythrocytes; the cells do not agglutinate when suspended in saline, but do ... Retrieved from "https://www.biology-online.org/dictionary/index.php?title=Serum_agglutinin&oldid=42799" ...
more infohttps://www.biology-online.org/dictionary/Serum_agglutinin

Definition of AGGLUTININ (Meaning of AGGLUTININ), a 10 Letter WordDefinition of AGGLUTININ (Meaning of AGGLUTININ), a 10 Letter Word

... and antonyms of the term AGGLUTININ in the Online Dictionary. What is a 10 letter word that starts with A? ... AGGLUTININ: Review the definition, meaning, pronunciation, explanation, synonyms, ...
more infohttp://hyperdictionary.com/dictionary/agglutinin

Tulipa gesneriana agglutinin
     Summary Report | CureHunterTulipa gesneriana agglutinin Summary Report | CureHunter

Tulipa gesneriana agglutinin: agglutinates mouse erythrocytes; do not confuse with tulip lectin which preferentially ... Tulipa gesneriana agglutinin. Subscribe to New Research on Tulipa gesneriana agglutinin agglutinates mouse erythrocytes; do not ...
more infohttp://www.curehunter.com/public/keywordSummaryC052928-Tulipa-gesneriana-agglutinin.do

RCSB PDB - Protein Feature View 









 - Agglutinin isolectin 3 - P10969 (AGI3 WHEAT)RCSB PDB - Protein Feature View - Agglutinin isolectin 3 - P10969 (AGI3 WHEAT)

The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex assemblies. As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
more infohttp://www.rcsb.org/pdb/protein/P10969

RCSB PDB - Protein Feature View 









 - Agglutinin isolectin 2 - P02876 (AGI2 WHEAT)RCSB PDB - Protein Feature View - Agglutinin isolectin 2 - P02876 (AGI2 WHEAT)

The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex assemblies. As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
more infohttp://www.rcsb.org/pdb/protein/P02876

Cold Agglutinin Titer Blood TestCold Agglutinin Titer Blood Test

... you may suffer from Cold Agglutinin Disease. This autoimmune disorder can cause anemia and lead to serious health complications ... Cold Agglutinin Titer Blood Test. This test measures the level of Cold Agglutinin Autoantibodies in the blood. Cold Agglutinins ... Cold Agglutinin Titer Blood Test. This test measures the level of Cold Agglutinin Autoantibodies in the blood. Cold Agglutinins ... Cold Agglutinin Titer Blood Test. This test measures the level of Cold Agglutinin Autoantibodies in the blood. Cold Agglutinins ...
more infohttps://requestatest.com/cold-agglutinin-titer-blood-test

Cold Agglutinin Disease E-Support Site - NORD (National Organization for Rare Disorders)Cold Agglutinin Disease E-Support Site - NORD (National Organization for Rare Disorders)

The Cold Agglutinin Disease E-Support Site is a website created by and for people with cold agglutinin disease (CAD) whose goal ... Cold Agglutinin Disease E-Support Site. Address. c/o Betty Usdan. 146 Greens Rd.. Hollywood, FL 33021 ... Home / For Patients and Families / Find a Patient Organization / Cold Agglutinin Disease E-Support Site ... Cold agglutinin disease (cold antibody hemolytic anemia) is a rare autoimmune disorder characterized by the premature ...
more infohttps://rarediseases.org/organizations/cold-agglutinin-disease-e-support-site/

Cold Agglutinin Disease Medication: Immunosuppressants, Corticosteroids, Immunomodulators, Vitamin, Water Soluble,...Cold Agglutinin Disease Medication: Immunosuppressants, Corticosteroids, Immunomodulators, Vitamin, Water Soluble,...

Cold agglutinin disease is a form of autoimmune hemolytic anemia caused by cold-reacting autoantibodies. Autoantibodies that ... encoded search term (Cold Agglutinin Disease) and Cold Agglutinin Disease What to Read Next on Medscape. Related Conditions and ... Cold Agglutinin Disease Medication. Updated: Aug 28, 2018 * Author: Salman Abdullah Aljubran, MD; Chief Editor: Michael A ... Jacobs A. Cold agglutinin hemolysis responding to fludarabine therapy. Am J Hematol. 1996 Dec. 53(4):279-80. [Medline]. ...
more infohttps://emedicine.medscape.com/article/135327-medication

Wheat Germ Agglutinin (WGA) Conjugates | BiotiumWheat Germ Agglutinin (WGA) Conjugates | Biotium

Wheat Germ Agglutinin (WGA) Conjugates This product is wheat germ agglutinin (WGA) labeled with Biotiums CF® Dyes or HRP. WGA ... Wheat germ agglutinin binds specifically to N-acetylglucosamine in the peptidoglycan layer of gram-positive bacteria. The Live ... This product is wheat germ agglutinin (WGA) labeled with Biotiums CF® Dyes or HRP. WGA is a carbohydrate-binding lectin that ... Bacterial Gram Stain Kit contains wheat germ agglutinin (WGA) conjugated to CF®594 to stain the surface of gram-positive cells ...
more infohttps://biotium.com/product/wheat-germ-agglutinin-wga-cf-dye-conjugates/
  • We sought to determine whether a negative DAT using anti-human complement (anti-C3) rules out elevated cold agglutinin (CA) titers and the diagnosis of CAD. (ovid.com)
  • The severity of the clinical manifestations of the cold agglutinins themselves varies from an inconsequential laboratory finding, in cases of the benign variety, to serious manifestations, such as acute hemolytic crises and Raynaud-type phenomena, in cases of the more malignant variety. (medscape.com)
  • Some conditions, such as infectious mononucleosis , are frequently associated with elevated cold agglutinins but rarely associated with anemia. (labcorp.com)
  • The exact temperature at which this will occur will vary as some cold agglutinins will react over a wider temperature range than others. (labcorp.com)
  • These antibodies are most commonly IgG, and react with proteins on the surface of red blood cells at normal body temperature (warm agglutinins). (neurologyadvisor.com)
  • The production of excess cold agglutinins is often linked to other conditions such as Mycoplasma Pneumoniae, infectious mononucleosis, some cancers, bacterial infections, parasitic infections, viral infections such as HIV and influenza. (requestatest.com)
  • Molecular docking analysis of zanamavir with haem agglutinin neuraminidase of human para influenza virus type 3. (nih.gov)
  • Sometimes a cold agglutinin test may be run at one or more additional temperatures that are lower than body temperature but warmer than 4°C, such as performed at 30°C (86°F) to determine the point at which the RBCs start to clump. (labcorp.com)
  • Febrile (warm) agglutinins are active at normal body temperatures. (medlineplus.gov)
  • As a result, the blood of a host applied to a diagnostic kit causes the aggregation of the pathogenic particles due to the antigen-agglutinin interaction. (wikipedia.org)
  • It is of interest to study the interaction of haem agglutinin neuraminidase with zanamavir (4-GU-DANA), a known antiviral drug. (nih.gov)
  • the active substances of the sera, the iso-agglutinins, must also be present in a specific distribution. (todayinsci.com)
  • This information may be important for someone who has chronically elevated cold agglutinins and is being considered for a surgery that involves body cooling. (labcorp.com)