Adrenomedullin: A 52-amino acid peptide with multi-functions. It was originally isolated from PHEOCHROMOCYTOMA and ADRENAL MEDULLA but is widely distributed throughout the body including lung and kidney tissues. Besides controlling fluid-electrolyte homeostasis, adrenomedullin is a potent vasodilator and can inhibit pituitary ACTH secretion.Receptors, Adrenomedullin: G-protein-coupled cell surface receptors for ADRENOMEDULLIN. They are formed by the heterodimerization of CALCITONIN RECEPTOR-LIKE PROTEIN and either RECEPTOR ACTIVITY-MODIFYING PROTEIN 2 or RECEPTOR ACTIVITY-MODIFYING PROTEIN 3.Calcitonin Receptor-Like Protein: A receptor protein that is associated with RECEPTOR ACTIVITY-MODIFYING PROTEINS. When bound to RECEPTOR ACTIVITY-MODIFYING PROTEIN 1 it forms the CALCITONIN GENE-RELATED RECEPTOR. When bound to RECEPTOR ACTIVITY-MODIFYING PROTEIN 2 or RECEPTOR ACTIVITY-MODIFYING PROTEIN 3 it forms the ADRENOMEDULLIN RECEPTOR.Peptides: Members of the class of compounds composed of AMINO ACIDS joined together by peptide bonds between adjacent amino acids into linear, branched or cyclical structures. OLIGOPEPTIDES are composed of approximately 2-12 amino acids. Polypeptides are composed of approximately 13 or more amino acids. PROTEINS are linear polypeptides that are normally synthesized on RIBOSOMES.Receptor Activity-Modifying Protein 2: A receptor activity-modifying protein that heterodimerizes with CALCITONIN RECEPTOR-LIKE PROTEIN to form the ADRENOMEDULLIN RECEPTOR. In addition, an isoform of the ISLET AMYLOID POLYPEPTIDE RECEPTOR is formed from this protein dimerizing with the CALCITONIN RECEPTOR.Receptor Activity-Modifying Proteins: A family of proteins that bind to CELL SURFACE RECEPTORS and alter their specificity, signaling mechanism, or mode of intracellular transport.Receptor Activity-Modifying Protein 3: A receptor activity-modifying protein that heterodimerizes with CALCITONIN RECEPTOR-LIKE PROTEIN to form the ADRENOMEDULLIN RECEPTOR. In addition, an isoform of the ISLET AMYLOID POLYPEPTIDE RECEPTOR is formed from this protein dimerizing with the CALCITONIN RECEPTOR.Receptors, Calcitonin: Cell surface proteins that bind calcitonin and trigger intracellular changes which influence the behavior of cells. Calcitonin receptors outside the nervous system mediate the role of calcitonin in calcium homeostasis. The role of calcitonin receptors in the brain is not well understood.Calcitonin Gene-Related Peptide: Calcitonin gene-related peptide. A 37-amino acid peptide derived from the calcitonin gene. It occurs as a result of alternative processing of mRNA from the calcitonin gene. The neuropeptide is widely distributed in neural tissue of the brain, gut, perivascular nerves, and other tissue. The peptide produces multiple biological effects and has both circulatory and neurotransmitter modes of action. In particular, it is a potent endogenous vasodilator.Receptors, Calcitonin Gene-Related Peptide: Cell surface proteins that bind CALCITONIN GENE-RELATED PEPTIDE with high affinity and trigger intracellular changes which influence the behavior of cells. CGRP receptors are present in both the CENTRAL NERVOUS SYSTEM and the periphery. They are formed via the heterodimerization of the CALCITONIN RECEPTOR-LIKE PROTEIN and RECEPTOR ACTIVITY-MODIFYING PROTEIN 1.Receptors, Peptide: Cell surface receptors that bind peptide messengers with high affinity and regulate intracellular signals which influence the behavior of cells.Receptor Activity-Modifying Protein 1: A receptor activity-modifying protein that is a subunit of specific G-PROTEIN COUPLED RECEPTORS. The CALCITONIN GENE-RELATED PEPTIDE RECEPTOR is formed from a dimer of this protein and CALCITONIN RECEPTOR-LIKE PROTEIN, while an isoform of the ISLET AMYLOID POLYPEPTIDE RECEPTOR is formed from this protein dimerizing with the CALCITONIN RECEPTOR.Vasodilator Agents: Drugs used to cause dilation of the blood vessels.Miotics: Agents causing contraction of the pupil of the eye. Some sources use the term miotics only for the parasympathomimetics but any drug used to induce miosis is included here.Cyclic AMP: An adenine nucleotide containing one phosphate group which is esterified to both the 3'- and 5'-positions of the sugar moiety. It is a second messenger and a key intracellular regulator, functioning as a mediator of activity for a number of hormones, including epinephrine, glucagon, and ACTH.Radioimmunoassay: Classic quantitative assay for detection of antigen-antibody reactions using a radioactively labeled substance (radioligand) either directly or indirectly to measure the binding of the unlabeled substance to a specific antibody or other receptor system. Non-immunogenic substances (e.g., haptens) can be measured if coupled to larger carrier proteins (e.g., bovine gamma-globulin or human serum albumin) capable of inducing antibody formation.Atrial Natriuretic Factor: A potent natriuretic and vasodilatory peptide or mixture of different-sized low molecular weight PEPTIDES derived from a common precursor and secreted mainly by the HEART ATRIUM. All these peptides share a sequence of about 20 AMINO ACIDS.Antihypertensive Agents: Drugs used in the treatment of acute or chronic vascular HYPERTENSION regardless of pharmacological mechanism. Among the antihypertensive agents are DIURETICS; (especially DIURETICS, THIAZIDE); ADRENERGIC BETA-ANTAGONISTS; ADRENERGIC ALPHA-ANTAGONISTS; ANGIOTENSIN-CONVERTING ENZYME INHIBITORS; CALCIUM CHANNEL BLOCKERS; GANGLIONIC BLOCKERS; and VASODILATOR AGENTS.Receptors, Islet Amyloid Polypeptide: G-protein coupled receptors that are formed through the dimerization of the CALCITONIN RECEPTOR with a RECEPTOR ACTIVITY-MODIFYING PROTEIN. Their affinity for ISLET AMYLOID POLYPEPTIDE is dependent upon which of several receptor activity-modifying protein subtypes they are bound to.Insulinoma: A benign tumor of the PANCREATIC BETA CELLS. Insulinoma secretes excess INSULIN resulting in HYPOGLYCEMIA.Abstracting and Indexing as Topic: Activities performed to identify concepts and aspects of published information and research reports.Data Mining: Use of sophisticated analysis tools to sort through, organize, examine, and combine large sets of information.Periodicals as Topic: A publication issued at stated, more or less regular, intervals.Petasites: A plant genus of the family ASTERACEAE. Members contain SESQUITERPENES. The common name of sweet coltsfoot is similar to the common name for TUSSILAGO.Pheochromocytoma: A usually benign, well-encapsulated, lobular, vascular tumor of chromaffin tissue of the ADRENAL MEDULLA or sympathetic paraganglia. The cardinal symptom, reflecting the increased secretion of EPINEPHRINE and NOREPINEPHRINE, is HYPERTENSION, which may be persistent or intermittent. During severe attacks, there may be HEADACHE; SWEATING, palpitation, apprehension, TREMOR; PALLOR or FLUSHING of the face, NAUSEA and VOMITING, pain in the CHEST and ABDOMEN, and paresthesias of the extremities. The incidence of malignancy is as low as 5% but the pathologic distinction between benign and malignant pheochromocytomas is not clear. (Dorland, 27th ed; DeVita Jr et al., Cancer: Principles & Practice of Oncology, 3d ed, p1298)Adrenal Medulla: The inner portion of the adrenal gland. Derived from ECTODERM, adrenal medulla consists mainly of CHROMAFFIN CELLS that produces and stores a number of NEUROTRANSMITTERS, mainly adrenaline (EPINEPHRINE) and NOREPINEPHRINE. The activity of the adrenal medulla is regulated by the SYMPATHETIC NERVOUS SYSTEM.Cardiomegaly: Enlargement of the HEART, usually indicated by a cardiothoracic ratio above 0.50. Heart enlargement may involve the right, the left, or both HEART VENTRICLES or HEART ATRIA. Cardiomegaly is a nonspecific symptom seen in patients with chronic systolic heart failure (HEART FAILURE) or several forms of CARDIOMYOPATHIES.Hypertrophy: General increase in bulk of a part or organ due to CELL ENLARGEMENT and accumulation of FLUIDS AND SECRETIONS, not due to tumor formation, nor to an increase in the number of cells (HYPERPLASIA).Hypertrophy, Left Ventricular: Enlargement of the LEFT VENTRICLE of the heart. This increase in ventricular mass is attributed to sustained abnormal pressure or volume loads and is a contributor to cardiovascular morbidity and mortality.Heart: The hollow, muscular organ that maintains the circulation of the blood.Myocardium: The muscle tissue of the HEART. It is composed of striated, involuntary muscle cells (MYOCYTES, CARDIAC) connected to form the contractile pump to generate blood flow.Hydrops Fetalis: Abnormal accumulation of serous fluid in two or more fetal compartments, such as SKIN; PLEURA; PERICARDIUM; PLACENTA; PERITONEUM; AMNIOTIC FLUID. General fetal EDEMA may be of non-immunologic origin, or of immunologic origin as in the case of ERYTHROBLASTOSIS FETALIS.Capillary Permeability: The property of blood capillary ENDOTHELIUM that allows for the selective exchange of substances between the blood and surrounding tissues and through membranous barriers such as the BLOOD-AIR BARRIER; BLOOD-AQUEOUS BARRIER; BLOOD-BRAIN BARRIER; BLOOD-NERVE BARRIER; BLOOD-RETINAL BARRIER; and BLOOD-TESTIS BARRIER. Small lipid-soluble molecules such as carbon dioxide and oxygen move freely by diffusion. Water and water-soluble molecules cannot pass through the endothelial walls and are dependent on microscopic pores. These pores show narrow areas (TIGHT JUNCTIONS) which may limit large molecule movement.Systemic Inflammatory Response Syndrome: A systemic inflammatory response to a variety of clinical insults, characterized by two or more of the following conditions: (1) fever >38 degrees C or HYPOTHERMIA 90 beat/minute; (3) tachypnea >24 breaths/minute; (4) LEUKOCYTOSIS >12,000 cells/cubic mm or 10% immature forms. While usually related to infection, SIRS can also be associated with noninfectious insults such as TRAUMA; BURNS; or PANCREATITIS. If infection is involved, a patient with SIRS is said to have SEPSIS.Endothelial Cells: Highly specialized EPITHELIAL CELLS that line the HEART; BLOOD VESSELS; and lymph vessels, forming the ENDOTHELIUM. They are polygonal in shape and joined together by TIGHT JUNCTIONS. The tight junctions allow for variable permeability to specific macromolecules that are transported across the endothelial layer.Shock, Septic: Sepsis associated with HYPOTENSION or hypoperfusion despite adequate fluid resuscitation. Perfusion abnormalities may include, but are not limited to LACTIC ACIDOSIS; OLIGURIA; or acute alteration in mental status.Sepsis: Systemic inflammatory response syndrome with a proven or suspected infectious etiology. When sepsis is associated with organ dysfunction distant from the site of infection, it is called severe sepsis. When sepsis is accompanied by HYPOTENSION despite adequate fluid infusion, it is called SEPTIC SHOCK.Myocardial Infarction: NECROSIS of the MYOCARDIUM caused by an obstruction of the blood supply to the heart (CORONARY CIRCULATION).Heart Failure: A heterogeneous condition in which the heart is unable to pump out sufficient blood to meet the metabolic need of the body. Heart failure can be caused by structural defects, functional abnormalities (VENTRICULAR DYSFUNCTION), or a sudden overload beyond its capacity. Chronic heart failure is more common than acute heart failure which results from sudden insult to cardiac function, such as MYOCARDIAL INFARCTION.Mouth FloorDiabetes Mellitus, Type 1: A subtype of DIABETES MELLITUS that is characterized by INSULIN deficiency. It is manifested by the sudden onset of severe HYPERGLYCEMIA, rapid progression to DIABETIC KETOACIDOSIS, and DEATH unless treated with insulin. The disease may occur at any age, but is most common in childhood or adolescence.Microcirculation: The circulation of the BLOOD through the MICROVASCULAR NETWORK.Diabetic Nephropathies: KIDNEY injuries associated with diabetes mellitus and affecting KIDNEY GLOMERULUS; ARTERIOLES; KIDNEY TUBULES; and the interstitium. Clinical signs include persistent PROTEINURIA, from microalbuminuria progressing to ALBUMINURIA of greater than 300 mg/24 h, leading to reduced GLOMERULAR FILTRATION RATE and END-STAGE RENAL DISEASE.Diabetes Mellitus, Type 2: A subclass of DIABETES MELLITUS that is not INSULIN-responsive or dependent (NIDDM). It is characterized initially by INSULIN RESISTANCE and HYPERINSULINEMIA; and eventually by GLUCOSE INTOLERANCE; HYPERGLYCEMIA; and overt diabetes. Type II diabetes mellitus is no longer considered a disease exclusively found in adults. Patients seldom develop KETOSIS but often exhibit OBESITY.Exercise: Physical activity which is usually regular and done with the intention of improving or maintaining PHYSICAL FITNESS or HEALTH. Contrast with PHYSICAL EXERTION which is concerned largely with the physiologic and metabolic response to energy expenditure.Exercise Test: Controlled physical activity which is performed in order to allow assessment of physiological functions, particularly cardiovascular and pulmonary, but also aerobic capacity. Maximal (most intense) exercise is usually required but submaximal exercise is also used.Community-Acquired Infections: Any infection acquired in the community, that is, contrasted with those acquired in a health care facility (CROSS INFECTION). An infection would be classified as community-acquired if the patient had not recently been in a health care facility or been in contact with someone who had been recently in a health care facility.Pneumonia: Infection of the lung often accompanied by inflammation.Pneumonia, Bacterial: Inflammation of the lung parenchyma that is caused by bacterial infections.Protein PrecursorsPneumonia, Pneumococcal: A febrile disease caused by STREPTOCOCCUS PNEUMONIAE.Severity of Illness Index: Levels within a diagnostic group which are established by various measurement criteria applied to the seriousness of a patient's disorder.

Role of nitric oxide-cGMP pathway in adrenomedullin-induced vasodilation in the rat. (1/693)

We previously reported that adrenomedullin (AM), a potent vasodilator peptide discovered in pheochromocytoma cells, stimulates nitric oxide (NO) release in the rat kidney. To further investigate whether the NO-cGMP pathway is involved in the mechanisms of AM-induced vasodilation, we examined the effects of E-4021, a cGMP-specific phosphodiesterase inhibitor, on AM-induced vasorelaxation in aortic rings and perfused kidneys isolated from Wistar rats. We also measured NO release from the kidneys using a chemiluminescence assay. AM (10(-10) to 10(-7) mol/L) relaxed the aorta precontracted with phenylephrine in a dose-dependent manner. Denudation of endothelium (E) attenuated the vasodilatory action of AM (10(-7) mol/L AM: intact (E+) -25.7+/-5.2% versus denuded (E-) -7. 8+/-0.6%, P<0.05). On the other hand, pretreatment with 10(-8) mol/L E-4021 augmented AM-induced vasorelaxation in the intact aorta (-49. 0+/-7.9%, P<0.05) but not in the denuded one. E-4021 also enhanced acetylcholine (ACh)-induced vasorelaxation in the rat intact aorta (10(-7) mol/L ACh -36.6+/-8.4% versus 10(-8) mol/L E-4021+10(-7) mol/L ACh -62.7+/-3.1%, P<0.05). In perfused kidneys, AM-induced vasorelaxation was also augmented by preincubation with E-4021 (10(-9) mol/L AM -15.4+/-0.6% versus 10(-8) mol/L E-4021+10(-9) mol/L AM -23.6+/-1.2%, P<0.01). AM significantly increased NO release from rat kidneys (DeltaNO: +11.3+/-0.8 fmol. min-1. g-1 kidney at 10(-9) mol/L AM), which was not affected by E-4021. E-4021 enhanced ACh-induced vasorelaxation (10(-9) mol/L ACh -9.7+/-1.7% versus 10(-8) mol/L E-4021+10(-9) mol/L ACh -18.8+/-2.9%, P<0.01) but did not affect ACh-induced NO release from the kidneys. In the aorta and the kidney, 10(-4) mol/L of NG-nitro-L-arginine methyl ester, an NO synthase inhibitor, and 10(-5) mol/L of methylene blue, a guanylate cyclase inhibitor, reduced the vasodilatory effect of AM. These results suggest that the NO-cGMP pathway is involved in the mechanism of AM-induced vasorelaxation, at least in the rat aorta and kidney.  (+info)

Adrenomedullin is upregulated in the heart and aorta during the early and late stages of sepsis. (2/693)

Although circulating levels of adrenomedullin (ADM), a newly reported vasodilatory peptide with 52 amino acid residues in the human and 50 amino acid residues in the rat, are elevated during the early and late stages of sepsis, ADM levels in cardiovascular tissues and its precise localization remain to be determined. To study this, rats were subjected to sepsis by cecal ligation and puncture (CLP), followed by administration of 3 ml/100 g b.wt. normal saline to these and sham-operated animals. The heart and thoracic aorta were harvested at 5 h (i.e. the early stage of sepsis) and 20 h (late sepsis) after CLP. Tissue levels of ADM were determined by radioimmunoassay. The localization of ADM in the left ventricle and thoracic aorta was examined by using immunohistochemistry and electron microscopy techniques. The results indicated that ADM levels in the heart and thoracic aorta increased significantly at 5 h after CLP and remained elevated at 20 h after the onset of sepsis. Immunohistochemistry findings showed that ADM immunoreaction products were localized in the cytoplasm of the cardiac myocytes and aortic endothelial cells. Using electron microscopy, ADM immunoreaction products were found in the cytoplasmic matrixes. The immunostainings were also associated with the outer membranes of mitochondria and vesicles of the myocytes as well as vascular endothelial cells. It appears that the cardiovascular tissues, among other organ systems, contribute to the increased levels of plasma ADM under those conditions. Since ADM is localized in different cell populations in the heart and the large blood vessel (i.e. myocytes versus vascular endothelial cells), this peptide may play a differential role in regulating cardiac and vascular functions during sepsis as an autocrine and/or paracrine mediator.  (+info)

Proadrenomedullin N-terminal 20 peptide hyperpolarizes the membrane by activating an inwardly rectifying K+ current in differentiated PC12 cells. (3/693)

The mechanism of proadrenomedullin N-terminal 20 peptide (PAMP)-induced inhibition of catecholamine release from adrenergic nerve was investigated in nerve growth factor-treated PC12 cells that have differentiated characteristics somewhat similar to noradrenergic neurons. The effect of PAMP on the excitability of these cells was investigated with the use of perforated whole-cell clamp. PAMP hyperpolarized the membrane by increasing a K+ conductance in a dose-dependent manner. The current-voltage relationship (I-V) relationship of the PAMP-induced K+ conductance exhibited inward-going rectification. The activation was abolished by microinjecting GDPbetaS into the cells or pretreating the cells with pertussis toxin. These results indicate that a pertussis toxin-sensitive G protein is involved in the signal transduction. The PAMP-induced activation of the K+ conductance was attenuated by microinjecting antibody against the carboxyl terminus of Galphai3, but it was not influenced by microinjecting antibody against the common carboxyl termini of Galphai1 and Galphai2, which indicated that the G protein coupling the PAMP receptor to the inwardly rectifying K+ current is Galphai3. The PAMP-induced hyperpolarization may inhibit the catecholamine release from the neurons by attenuating the action potential frequency.  (+info)

Coronary sinus adrenomedullin rises in response to myocardial injury. (4/693)

Human adrenomedullin (ADM), a peptide comprising 52 amino acids, is a circulating hormone with vasodilator properties. We have evaluated its release by the heart following ischaemic myocardial damage, as indicated by elevated levels of the cardiospecific protein troponin-T (Tn-T) during cardiopulmonary bypass. ADM (pg/ml) and Tn-T (ng/ml) were measured in coronary sinus blood before and after aortic cross-clamp and in venous blood 6 h after surgery in 22 coronary-bypass patients. Based on the pre- and post-clamp Tn-T levels in the coronary sinus, the patients were divided into group I (no change; n=10) and group II (two times increase; n=12). Baseline ADM (362.7+/-106.2 and 303+/-58.7 pg/ml in groups I and II respectively; means+/-S.D.) and Tn-T (0.66+/-0.14 and 0.57+/-0.13 ng/ml respectively) levels were similar in both groups. In group I, the post-clamp ADM (317.6+/-80.8 pg/ml) and Tn-T (0.68+/-0.15 ng/ml) levels did not change significantly. In group II, the post-clamp ADM levels rose significantly above the baseline, mimicking the change in Tn-T (ADM, 541.4+/-89.4 pg/ml; Tn-T, 1.37+/-0.31 ng/ml; P=0.009). After 6 h, the systemic Tn-T levels were similar in both groups (2. 09+/-0.44 and 1.95+/-0.52 ng/ml in groups I and II respectively). We suggest that: (1) minor degrees of myocardial ischaemic damage result in release of ADM by the heart, and (2) ADM may play a protective role in the myocardium during an ischaemic insult. This suggests a possible therapeutic role for ADM in the management of intra-operative myocardial ischaemia.  (+info)

Effects of adrenomedullin and PAMP on adrenal catecholamine release in dogs. (5/693)

We examined the effects of proadrenomedullin-derived peptides on the release of adrenal catecholamines in response to cholinergic stimuli in pentobarbital sodium-anesthetized dogs. Drugs were administered into the adrenal gland through the phrenicoabdominal artery. Splanchnic nerve stimulation (1, 2, and 3 Hz) and ACh injection (0.75, 1.5, and 3 microgram) produced frequency- or dose-dependent increases in adrenal catecholamine output. These responses were unaffected by infusion of adrenomedullin (1, 3, and 10 ng. kg-1. min-1) or its selective antagonist adrenomedullin-(22-52) (5, 15, and 50 ng. kg-1. min-1). Proadrenomedullin NH2-terminal 20 peptide (PAMP; 5, 15, and 50 ng. kg-1. min-1) suppressed both the splanchnic nerve stimulation- and ACh-induced increases in catecholamine output in a dose-dependent manner. PAMP also suppressed the catecholamine release responses to the nicotinic agonist 1, 1-dimethyl-4-phenylpiperazinium (0.5, 1, and 2 microgram) and to muscarine (0.5, 1, and 2 microgram), although the muscarine-induced response was relatively resistant to PAMP. These results suggest that PAMP, but not adrenomedullin, can act as an inhibitory regulator of adrenal catecholamine release in vivo.  (+info)

Hypoxia-induced adrenomedullin production in the kidney. (6/693)

BACKGROUND: Adrenomedullin (AM) is a newly discovered peptide that has a potent vasorelaxant activity. To investigate its potential roles in hypoxia-induced renal injury, we examined whether AM production in the kidney increased under hypoxic conditions. METHODS: The AM transcript levels in Madin-Darby canine kidney (MDCK) cells, rat vascular smooth muscle cells (VSMCs), and rat mesangial cells were assessed by Northern blot analyses under normoxic and hypoxic conditions. The AM peptide in culture media was measured by radioimmunoassay. The effects of hypoxia on accumulation of cAMP in VSMCs were also examined. The stability of AM transcripts under normoxic and hypoxic conditions was compared in the presence of actinomycin D. The effects of hypoxia on AM promoter activity was assessed by transient transfection assays using the AM promoter subcloned upstream of luciferase gene. RESULTS: The expression of AM transcripts increased significantly in MDCK cells, rat VSMCs, and rat mesangial cells under hypoxic conditions without changes in the stability of AM transcripts; however, the AM promoter activity under hypoxic was not elevated significantly. The accumulation of AM peptide in culture media also increased significantly under hypoxic conditions in MDCK cells (2.2 +/- 0.1 fmol/10(5) cells in normoxia vs. 3.5 +/- 0.3 fmol/10(5) cells in hypoxia, 6 hr after hypoxia induction, P < 0.001), and in rat VSMCs (5.5 +/- 0.3 fmol/10(5) cells in normoxia vs. 7.8 +/- 0.4 fmol/10(5) cells in hypoxia, 8 hr after hypoxia induction, P < 0.01). Under hypoxic conditions, cAMP levels in rat VSMCs increased significantly compared with those under normoxic conditions (13.3 +/- 1.4 pmol/well vs. 4.6 +/- 0.4 pmol/well, P < 0.01). CONCLUSIONS: Renal parenchymal cells as well as renal vessels may produce AM under hypoxic conditions.  (+info)

Characterization of receptors for calcitonin gene-related peptide and adrenomedullin on the guinea-pig vas deferens. (7/693)

1. The receptors which mediate the effects of calcitonin gene-related peptide (CGRP), amylin and adrenomedullin on the guinea-pig vas deferens have been investigated. 2. All three peptides cause concentration dependant inhibitions of the electrically stimulated twitch response (pD2s for CGRP, amylin and adrenomedullin of 7.90+/-0.11, 7.70+/-0.19 and 7.25+/-0.10 respectively). 3. CGRP8-37 (1 microM) and AC187 (10 microM) showed little antagonist activity against adrenomedullin. 4. Adrenomedullin22-52 by itself inhibited the electrically stimulated contractions of the vas deferens and also antagonized the responses to CGRP, amylin and adrenomedullin. 5. [125I]-adrenomedullin labelled a single population of binding sites in vas deferens membranes with a pIC50 of 8.91 and a capacity of 643 fmol mg(-1). Its selectivity profile was adrenomedullin> AC187>CGRP=amylin. It was clearly distinct from a site labelled by [125I]-CGRP (pIC50=8.73, capacity=114 fmol mg(-1), selectivity CGRP>amylin=AC187>adrenomedullin). [125I]-amylin bound to two sites with a total capacity of 882 fmol mg(-1). 6. Although CGRP has been shown to act at a CGRP2 receptor on the vas deferens with low sensitivity to CGRP8-37, this antagonist displaced [125I]-CGRP with high affinity from vas deferens membranes. This affinity was unaltered by increasing the temperature from 4 degrees C to 25 degrees C, suggesting the anomalous behaviour of CGRP8-37 is not due to temperature differences between binding and functional assays.  (+info)

Central adrenomedullin augments the baroreceptor reflex in conscious rabbits. (8/693)

We examined the roles of central adrenomedullin, proadrenomedullin N-terminal 20 peptide (PAMP), and calcitonin gene-related peptide (CGRP) on the baroreceptor reflex in conscious rabbits. Intracerebroventricular injection of adrenomedullin (0.2 and 1 nmol/80 microL) elicited dose-related increases in arterial pressure and renal sympathetic nerve activity. On the other hand, a subpressor dose of intracerebroventricular infusion of adrenomedullin (1 nmol/300 microL per hour) caused significant increases in baroreflex sensitivities assessed by renal sympathetic nerve activity and heart rate compared with vehicle infusion (Gmax; -14.9+/-1.7 versus -8.0+/-0.7%/mm Hg, P<0.01, and -8.1+/-0.8 versus -5.1+/-0.5 bpm/mm Hg, P<0.01, respectively). Intracerebroventricular infusion of CGRP (1 nmol/300 microL per hour), which is structurally homologous to adrenomedullin, also enhanced the baroreflex controls of renal sympathetic nerve activity and heart rate. However, the intracerebroventricular infusion of PAMP (30 nmol/300 microL per hour) failed to alter the baseline levels of arterial pressure and baroreflex sensitivities. These results suggest that central adrenomedullin and CGRP, but not PAMP, participate in cardiovascular regulation to augment the baroreflex controls of renal sympathetic nerve activity and heart rate in conscious rabbits.  (+info)

We showed that plasma adrenomedullin concentrations on day 2 were markedly increased in patients with heart failure (Killip class II or more) after myocardial infarction and were negatively correlated with left ventricular ejection fraction; that among the non-invasive variables, only plasma adrenomedullin was an independent predictor of mortality by multivariate analysis; and that, using Kaplan-Meier survival curves, patients with plasma adrenomedullin values above the median had a significantly greater mortality than those with values below the median.. Earlier studies have shown that adrenomedullin is produced mainly by endothelial cells and by vascular smooth muscle cells regulating vascular tone.1 4 18-20 More recently, the failing ventricle has also been shown to secrete adrenomedullin into plasma.11 12 Adrenomedullin synthesis is promoted in vitro by a variety of cytokines, such as interleukin-1β and tumour necrosis factor α,18 19 both of which increase in parallel with myocardial ...
How is proadrenomedullin N-terminal 20 peptide abbreviated? PAMP stands for proadrenomedullin N-terminal 20 peptide. PAMP is defined as proadrenomedullin N-terminal 20 peptide rarely.
The aim of the study was to find out whether prolonged exercise influences plasma adrenomedullin (ADM) concentration and whether it is related to the hormonal, metabolic and cardiovascular changes. Eighteen healthy subjects (age 25+/-1 yrs) were subm
4. The production of interleukin-6 is mediated by p38-mitogen-activated protein kinase (MAPK), p42/44-MAPK, protein kinase C, and protein kinase K, whereas that of interleukin-10 is mediated by p38-MAPK and protein kinase K ...
There were three main findings in our study. First, plasma MR-proADM concentration was elevated in type 2 diabetic subjects with preserved renal function. This was further accentuated in the presence of established diabetic nephropathy. Second, metabolic and inflammatory factors, namely insulin resistance, LDL cholesterol, adiponectin, and hsCRP, appeared to be significant determinants of plasma MR-proADM concentrations. Third, MR-proADM was well correlated with measurement of resting, unprovoked microcirculatory blood flow, suggesting that it may be one of the determinants of basal vascular perfusion in subjects with type 2 diabetes.. The first finding was interesting because it clarified the relationship between plasma adrenomedullin concentrations and type 2 diabetes. Our data suggested that MR-proADM was mildly elevated in subjects with uncomplicated type 2 diabetes (Fig. 1). However, in the presence of diabetic nephropathy, plasma MR-proADM became markedly deranged (consistent with ...
Plasma Concentrations of the Vasoactive Peptide Fragments Mid-Regional Pro-Adrenomedullin, C-Terminal Pro-Endothelin 1 and Copeptin in Hemodialysis Patients: Associated Factors and Prediction of ...
Mid-regional pro-adrenomedullin and copeptin to predict short-term prognosis of COPD exacerbations: a multicenter prospective blinded study Martin Dres,1,2 Pierre Hausfater,3,4 Frantz Foissac,5,6 Maguy Bernard,7 Luc-Marie Joly,8 Mustapha Sebbane,9 Anne-Laure Philippon,3,4 Cédric Gil-Jardiné,10 Jeannot Schmidt,11 Maxime Maignan,12 Jean-Marc Treluyer,13 Nicolas Roche14,15 On behalf of the UTAPE Study Investigators and Scientific Committee 1Pulmonary and Critical Care Department, Pitié-Salpêtrière Hospital, AP-HP, 2UMRS1158: Clinical and Experimental Respiratory Neurophysiology, Paris 6 University, 3Emergency Department, Hôpital Pitié-Salpêtrière, AP-HP, 4Sorbonne Universités UPMC Univ-Paris06, GRC-14 BIOSFAST, 5Clinical Research Department, Necker Cochin Hospital, AP-HP, 6EA 7323, Sorbonne Paris-Cité, 7Biochemistry Department, Pitié-Salpêtrière Hospital, AP-HP, Paris, 8Emergency Department, Charles Nicolle
Aims The haemodynamic effects of adrenomedullin and calcitonin gene-related peptide (CGRP) were studied in resistance and capacitance vessels of healthy volunteers.. Methods Adrenomedullin and CGRP were infused into the brachial artery of eight healthy subjects on two separate occasions at doses between 0.3-30 pmol min−1. Forearm blood flow was measured using venous occlusion plethysmography. Venodilatation to adrenomedullin and CGRP was assessed in a further eight subjects by infusing the peptides at doses between 0.3-10 pmol min−1 into a dorsal hand vein preconstricted with noradrenaline. Venodilator responses were measured as percentage reduction in noradrenaline preconstriction.. Results Adrenomedullin and CGRP at a dose of 30 pmol min−1, produced an increase in forearm blood flow of 288±42% and 252±30% respectively (mean±s.e. mean, P,0.001). At doses between 3 and 10 pmol min−1 adrenomedullin was significantly more potent than CGRP. The vasodilatation to both peptides was of ...
I have read with great interest the article by Harmancey et al. (1) on inhibition of adipogenesis by adrenomedullin. Previous studies, including ours (2-4), have shown that adrenomedullin is produced and secreted by adipocytes and adipose tissues, whereas the reported effects of adrenomedullin on lipolysis are conflicting (5,6). Harmancey et al. (1) have clearly shown inhibition of adipogenesis by adrenomedullin using small interfering RNA technology. However, I have several concerns regarding this article. First, the concentration of exogenously added adrenomedullin (100 nmol/l) was very high in the experiment on the inhibitory effects on adipogenesis (Fig. 1 in article). The adrenomedullin concentrations in the medium of cultured adipocytes rarely exceed 1 nmol/l (2,4). Second, the authors used 3T3-F442A preadipocytes but not adipocytes in the transfection study (Fig. 6 in article). There is a considerable difference in the adrenomedullin promoter activity between preadipocytes and adipocytes, ...
We read with interest the paper presented by Saeed et al [1], The early identification of disease progression in patients with suspected infection presenting to the emergency department: a multi-centre derivation and validation study. We retrospectively applied the cut-offs for mid-regional pro-adrenomedullin (MR-proADM) and C-reactive protein (CRP) derived in this study to the cohort used in our paper, Can mid-regional pro-adrenomedullin (MR-proADM) increase the prognostic accuracy of NEWS in predicting deterioration in patients admitted to hospital with mild to moderately severe illness? A prospective single-centre observational study [2] to see if we could replicate the sensitivity and specificity obtained for predicting avoidance of hospitalisation, defined as a discharge to community care within 24 h of presentation. ...
Using AM knockout mice, we have been able to make 3 key observations: (1) that reduced expression of endogenous AM exacerbates the cardiac hypertrophy and fibrosis caused by pressure overload (aortic constriction) or Ang II infusion, leading to diminished cardiac function; (2) that reduced AM expression exacerbates the renal damage caused by Ang II infusion; and (3) that AM suppresses development of cardiac hypertrophy via suppression of ERK activation.. In the present study, we found that although the respective heart, kidney, and body weights were similar in AM+/− and wild-type mice, cardiac and renal expression of AM in AM+/− mice was only approximately half that seen in wild-type mice. Moreover, AM+/− mice exhibited wider left ventricular diastolic diameter than wild-type mice, even under basal conditions, which suggests that AM is necessary for proper development of the heart.. The differences between AM+/− and wild-type mice became much more apparent when stress was applied to the ...
Adrenomedullin promotes formation of xenografted endometrial tumors by stimulation of autocrine growth and angiogenesis.: The angiogenic peptide adrenomedullin
A hypotensive vasodilator peptide (ADM, 52 aa) found in blood in significant amounts. It has diuretic and natriuretic effects on the kidney where it inhibits aldosterone secretion and in the pituitary it inhibits basal ACTH secretion. Together with adrenomedullin-binding protein-1 (AMBP-1) it has been shown to reduce tissue damage in inflammation and appears to protect cells against oxidative stress. Adrenomedullin-2 (intermedin, 148 aa) may regulate gastrointestinal and cardiovascular activities through a cAMP-dependent pathway. The receptor is G-protein coupled. See proadrenomedullin. ...
aorta tissues and then cultured. In vitro cultured VSMCs were stimulated with Ang II (10†8 mol/l) followed by various doses of PAMP or ADM (10†9, 10†8, or 10†7 mol/l). Cell proliferation as assessed by 3H†TdR incorporation. Protein kinase C (PKC) activity was measured by counting γ†32P radioactivity with liquid scintillation. In a separate cohort, in vitro cultured rat aortic vessels were treated with different doses of Ang II or PAMP (10†9, 10†8, or 10†7 mol/l). Cellular and secreted levels of PAMP, ADM and Ang II were measured using radioimmunoassay in the tissues and intubation mediums, respectively.. Ang II (10†8 mol/l) treatment significantly increased both 3H†TdR incorporation and PKC activity in VSMCs (by 2.68 and 1.02†fold, respectively; both P,0.01 vs. the control). However, Ang II†induced elevation of 3H†TdR incorporation, and PKC activity was significantly inhibited by various doses of ADM and PAMP (all P,0.01 ...
Monitoring of sST2 values through serial measurements appears to be particularly useful, increasing the prognostic power of this biomarker.39 Bayes-Genis et al.40 studied a small group of patients with acute HF and measured their sST2 values at discharge and two weeks later. Patients with a greater decrease in sST2 two weeks after discharge had a better prognosis.40 Another study measured sST2 at admission in the ED and 48 hours later, concluding that sST2 levels clearly separated those who survived from those who did not.40 Likewise, the percentage of sST2 decrease predicted long term mortality.41. It can be concluded that sST2 is a good prognostic marker, both short- and long-term, in patients hospitalized for acute HF. Also, the addition of sST2 to natriuretic peptides is superior to the use of natriuretic peptides alone. It is important to emphasize that repeated monitoring of sST2 levels is more useful than a single measurement, and its low biological variability increases its potential for ...
Infobox_gene}} Adrenomedullin (ADM or AM) is a [[vasodilator]] [[peptide hormone]] of uncertain significance in human health and disease. It was initially isolated in 1993 from a [[pheochromyctoma,pheochromocytoma]], a tumor of the [[adrenal medulla]]: hence the name.,ref name="Kitamura_1998">{{cite journal , vauthors = Kitamura K, Kato J, Kawamoto M, Tanaka M, Chino N, Kangawa K, Eto T , title = The intermediate form of glycine-extended adrenomedullin is the major circulating molecular form in human plasma , journal = Biochem. Biophys. Res. Commun. , volume = 244 , issue = 2 , pages = 551-5 ,date=March 1998 , pmid = 9514956 , doi = 10.1006/bbrc.1998.8310 }},/ref> In humans ADM is encoded by the ADM [[gene]]. ADM is a peptide expressed by all tissues, and found in the circulation. A similar peptide named adreomedullin2 was reported in rats in 2004 which exhibits a similar function.,ref name="pmid15321737">{{cite journal , vauthors = Fujisawa Y, Nagai Y, Miyatake A, Takei Y, ...
Recent studies have demonstrated elevated plasma levels of ADM in vertebrates with a systemic inflammatory response.15-19⇓⇓⇓⇓ However, the role of ADM in the complex and dynamic disease process of sepsis is still largely undefined. On the one hand, the high ADM plasma levels observed in septic humans may contribute to hypotension and hyperdynamic circulatory response in sepsis, thereby contributing to disease progress.18 On the other hand, transgenic mice overexpressing ADM in their vasculature turned out to be resistant against lipopolysaccharide-induced shock, suggesting a rather beneficial effect of elevated ADM levels in sepsis.26. Considering that endothelial hyperpermeability is the hallmark of an inflammatory reaction1,2⇓ and that mice lacking a functional ADM gene displayed an extreme hydrops fetalis,27 we tested the hypothesis that elevated ADM levels stabilized endothelial barrier function, thereby acting as a "protective" peptide in the systemic inflammatory response. Our ...
BACKGROUND: Biomarkers reflecting diverse pathophysiological pathways may play an important role in the pathogenesis of abdominal aortic aneurysm (aortic diameter ≥30 mm, AAA), levels of many biomarkers are elevated and correlated to aortic diameter among 65-year-old men undergoing ultrasound (US) screening for AAA.. PROBANDS AND METHODS: To evaluate potential relationships between biomarkers and aortic dilatation after long-term follow-up, levels of C-reactive protein (CRP), proneurotensin (PNT), copeptin (CPT), lipoprotein-associated phospholipase 2 (Lp-PLA2), cystatin C (Cyst C), midregional proatrial natriuretic peptide (MR-proANP), and midregional proadrenomedullin (MR-proADM) were measured in 117 subjects (114 [97 %] men) aged 47-49 in a prospective population-based cohort study, and related to aortic diameter at US examination of the aorta after 14-19 years of follow-up.. RESULTS: Biomarker levels at baseline did not correlate with aortic diameter after 14-19 years of follow up (CRP [r ...
CONTEXT: Prior studies have demonstrated conflicting results regarding how much information novel biomarkers add to cardiovascular risk assessment. OBJECTIVE: To evaluate the utility of contemporary biomarkers for predicting cardiovascular risk when added to conventional risk factors. DESIGN, SETTING, AND PARTICIPANTS: Cohort study of 5067 participants (mean age, 58 years; 60% women) without cardiovascular disease from Malmö, Sweden, who attended a baseline examination between 1991 and 1994. Participants underwent measurement of C-reactive protein (CRP), cystatin C, lipoprotein-associated phospholipase 2, midregional proadrenomedullin (MR-proADM), midregional proatrial natriuretic peptide, and N-terminal pro-B-type natriuretic peptide (N-BNP) and underwent follow-up until 2006 using the Swedish national hospital discharge and cause-of-death registers and the Stroke in Malmö register for first cardiovascular events (myocardial infarction, stroke, coronary death). MAIN OUTCOME MEASURES: ...
The IUPHAR/BPS Guide to Pharmacology. adrenomedullin 2/intermedin ligand page. Quantitative data and detailed annnotation of the targets of licensed and experimental drugs.
The IUPHAR/BPS Guide to Pharmacology. adrenomedullin 2/intermedin ligand page. Quantitative data and detailed annnotation of the targets of licensed and experimental drugs.
Principal Investigator:IMANISHI Sunao, Project Period (FY):1997 - 1998, Research Category:Grant-in-Aid for Scientific Research (C), Section:一般, Research Field:Circulatory organs internal medicine
Principal Investigator:HOSOKAWA Ikuko, Project Period (FY):2013-08-30 - 2015-03-31, Research Category:Grant-in-Aid for Research Activity start-up, Research Field:Periodontology
Adrenomedullin is a member of the calcitonin family of peptides and functions as a vasodilator. Adrenomedullin may also function in
INTRODUCTION: The aim of our study was to analyse the role of adrenomedullin (AM) and endothelin-1 (ET-1) in the adaptation of the maternal vascular system in normotensive pregnancy. METHODS: Twenty-eight pregnant women, who were normotensive through
Serum Pro-ADM and IL-1β levels may offer additional risk/severity stratification in children with CAP. In addition, they may be helpful in predicting the development of complications, requirements for ntensive care unit admission, and intervention procedures.
Antioxidative effects of adrenomedullin and vascular endothelial growth factor on lung injury induced by skeletal muscle ischemia-reperfusion.: These findings i
Adrenomedullin in synovial fluids from patients with rheumatoid arthritis inhibits interleukin 6 production from synoviocytes ...
Adrenomedullin兔多克隆抗体(ab125409)可与人样本反应并经WB实验严格验证。中国75%以上现货,所有产品均提供质保服务,可通过电话、电邮或微信获得本地专属技术支持。
Acute dyspnea is a common chief complaint among patients who visit an emergency room and presents diagnostic challenges for clinicians in both identifying the etiology and determining the clinical severity. The study of biomarkers in the prognostication and risk stratification of these patients has been increasing, including the investigation of the prognostic value for mid-regional pro-adrenomedullin (MR-proADM). Areas Covered: In this review, the authors cover what is known about MR-proADM testing in patients presenting with acute dyspnea and the supporting evidence of its prognostic value in common conditions in medical patients with acute dyspnea, including acute heart failure, community acquired pneumonia, acute exacerbation of chronic obstructive pulmonary disease, and acute pulmonary embolism ...
The Particulars: Shortness of breath is a common patient symptom that presents in the ED but may be due to several causes, including asthma, respiratory infections, and congestive heart failure. The BACH Multinational Trial assessed Mid-Regional pro Adrenomedullin MR-proADM, a new blood test recently approved for use in Europe. It indirectly measures adrenomedullin, a hormone that affects blood vessel dilation and is associated with cardiac and infectious disease.. Data Breakdown: The trial was a prospective, 15-center, international multiple serum biomarker study of 1,641 patients presenting to the ED with shortness of breath. It compared the B-Natriuretic peptide (BNP) and N-terminal pro-B-type natriuretic peptide (NTproBNP) tests to MR-proADM. Researchers found that 34.6% of patients had a diagnosis of heart failure, of which 11.4% died within 90 days. For all 1,641 enrolled patients, the prognostic accuracy of MRproADM was 73.1% compared with a 60.6% rate for BNP and a 63.0% rate for ...
Fungi are of increasing importance in sepsis. However, culture-based diagnostic procedures are associated with relevant weaknesses. Therefore, culture- and next-generation sequencing (NGS)-based fungal findings as well as corresponding plasma levels of β-d-glucan, interferon gamma (INF-γ), tumor necrosis factor alpha (TNF-α), interleukin (IL)-2, -4, -6, -10, -17A, and mid-regional proadrenomedullin (MR-proADM) were evaluated in 50 septic patients at six consecutive time points within 28 days after sepsis onset. Furthermore, immune-response patterns during infections with Candida spp. were studied in a reconstituted human epithelium model. In total, 22% (n = 11) of patients suffered from a fungal infection. An NGS-based diagnostic approach appeared to be suitable for the identification of fungal pathogens in patients suffering from fungemia as well as in patients with negative blood cultures. Moreover, MR-proADM and IL-17A in plasma proved suitable for the identification of patients with a fungal
Patient subgroups with high MR-proADM concentrations (≥ 1.54 nmol/L) and low biomarker (PCT , 0.25 ng/mL, lactate , 2.0 mmol/L or CRP , 67 mg/L) or clinical score (SOFA , 2 points, qSOFA , 2 points, NEWS , 4 points or CRB-65 , 2 points) values were characterized by a significantly longer length of hospitalization (p , 0.001), rate of ICU admission (p , 0.001), elevated mortality risk (e.g. SOFA, qSOFA and NEWS HR [95%CI], 45.5 [10.0-207.6], 23.4 [11.1-49.3] and 32.6 [9.4-113.6], respectively) and a greater number of disease progression events (p , 0.001), compared to similar subgroups with low MR-proADM concentrations (, 1.54 nmol/L ...
Sigma-Aldrich offers abstracts and full-text articles by [C Letizia, G Tamburrano, P Alo, A Paoloni, C Caliumi, E Marinoni, R di Iorio, E dErasmo].
Complete information for ADM5 gene (Protein Coding), Adrenomedullin 5 (Putative), including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
GPR182 (ili G protein spregnuti receptor 182) je ljudski gen (i asocirani protein) koji je orfan GPCR.[1] Kad je ovaj gen bio kloniran prvi put, pretpostavljeno je da kodira adrenomedulin receptor.[2] Međutim kad je korespondirajući protein izražen, utvrđeno je da ne proizvodi respons na adrenomedulin (ADM).[3] Naknadno je bilo pokazano da jedan drugi GPCR receptor, CALCRL u kompleksu sa RAMP2 može da funkcioniše kao ADM receptor.[4] ...
ADM is a global supplier of ingredients derived from agricultural sources and its portfolio includes both commodity-style basics as well as more highly
Visit ChemicalBook To find more 2,5-Dichloronicotinic acid(59782-85-3) information like chemical properties,Structure,melting point,boiling point,density,molecular formula,molecular weight, physical properties,toxicity information,customs codes. You can also browse global suppliers,vendor,prices,Price,manufacturers of 2,5-Dichloronicotinic acid(59782-85-3). At last,2,5-Dichloronicotinic acid(59782-85-3) safety, risk, hazard and MSDS, CAS,cas number,Use,cas no may also be you need.
Endothelin-1 (ET-1) and adrenomedullin (ADM) are circulating vasoactive peptides involved in vascular homeostasis and endothelial function. Elevated levels of plasma ET-1 and ADM, and their biologically stable surrogates, C-terminal-pro-endothelin-1 (CT-pro-ET-1) and midregional proadrenomedullin (MR-pro-ADM), are predictors of cardiac death and heart failure. We studied the association of common genetic variation with MR-pro-ADM and CT-pro-ET-1 by genome-wide association analyses in 3444 participants of European ancestry. We performed follow-up genotyping of single nucleotide polymorphisms (SNPs) that showed suggestive or significant association in the discovery stage in additional 3230 participants. The minor variants in KLKB1 (rs4253238) and F12 (rs2731672), both part of the kallikrein-kinin system, were associated with higher MR-pro-ADM (P=4.46E-52 and P=5.90E-24, respectively) and higher CT-pro-ET-1 levels (P=1.23E-122 and P=1.26E-67, respectively). Epistasis analyses showed a significant ...
Bronchopulmonary dysplasia (BPD) is the most common chronic lung disease (CLD) in premature infants. This study was designed to elucidate the regulation of miRNA-547-3p on adrenomedullin (ADM) during the pathogenesis of BPD. We used Agilent Human 4x44K Gene Expression Microarrays v2 and miRCURY LNA™ microRNA Array to identify the differently expressed miRNA and its potential target genes, and certified them again by luciferase reporter gene analysis. We only retained target genes that met the following two conditions: first, coexisting in two databases, and second, expressing differences, and then identifying target genes by luciferase reporter gene analysis. Thus, we selected miRNA-574-3p and its target gene ADM for further research. We used real-time q-PCR to determine the expression of miRNA-574-3p and its target gene ADM in premature infants with BPD. We used microarray expression to analyze BPD samples and non-BPD samples and found that there were 516 differently expressed probes between ...
p,Objectives,/p, ,p,Increasing studies have indicated the association between adipokines and multiple autoimmune diseases. This study aimed to evaluate the mRNA expression levels of vaspin, adiponectin and adrenomedullin in peripheral blood mononuclear cells (PBMCs) of patients with systemic lupus erythematosus (SLE), as well as their clinical associations. ,/p, ,p,Methods,/p, ,p,A total of 46 SLE patients and 51 normal controls were recruited. The three adipokines expression levels in PBMCs from SLE patients were measured by qRT-PCR, and their associations with major clinical and laboratory parameters of SLE patients were also analyzed. ,/p, ,p,Results,/p, ,p,Compared with normal controls, vaspin expression level in PBMCs was significantly decreased (P , 0.001), whereas adiponectin expression level was significantly higher in SLE patients (P , 0.001). There was no significant difference in adrenomedullin expression level between SLE patients and normal controls. Vaspin and adrenomedullin ...
SEA635Mu, CF-H; FH; FHL1; ARMD4; ARMS1; CFHL3; HF1; HF2; HUS; H Factor 2; Age-Related Maculopathy Susceptibility 1; Adrenomedullin binding protein | Products for research use only!
PubMedID: 23242529 | Adrenomedullin enhances invasion of human extravillous cytotrophoblast-derived cell lines by regulation of urokinase plasminogen activator expression and s-nitrosylation. | Biology of reproduction | 2/1/2013
From Miller "Cardiac hormones are polypeptides secreted by cardiac tissues into the circulation in the normal heart. Natriuretic peptides, aldosterone, and adrenomedullin are hormones secreted by cardiomyocytes. Angiotensin II, the effector hormone in the renin-angiotensin system, is also produced by cardiomyocytes. The renin-angiotensin system is one of the most important regulators of cardiovascular physiology. It is a key modulator of cardiac growth and function. Angiotensin II stimulates two separate receptor subtypes, AT1 and AT2, both of which are present in the heart. AT1 receptors are the predominant subtype expressed in the normal adult human heart. Stimulation of AT1 receptors induces a positive chronotropic and inotropic effect. Angiotensin II also mediates cell growth and proliferation in cardiomyocytes and fibroblasts and induces release of the growth factors aldosterone and catecholamines through stimulation of AT1 receptors. Activation of AT1 receptors is directly involved in the ...
These biomarkers were also used to predict late cardiovascular events at day 30 of community-acquired pneumonia (CAP) in patients who did not have a history of cardiovascular disease, according to Rosario Menéndez, MD, from the Hospital Universitario y Politécnico La Fe and Instituto de Investigación Sanitaria La Fe in Valencia, Spain, and colleagues.. "Some patients have still high levels of inflammatory and cardiac biomarkers at 30 days, when they are usually referred to primary care without receiving any specific additional recommendations," Dr. Menéndez and colleagues wrote in CHEST. "Our results suggest that a change in usual practice is needed to reduce current and further cardiovascular CAP complications.". Dr. Menéndez and colleagues prospectively followed 730 patients for 1 year who were hospitalized for CAP, measuring the cardiac biomarkers proadrenomedullin (proADM), pro b-type natriuretic peptide (proBNP), proendothelin-1, and troponin T, and the inflammatory biomarkers ...
Thank you for your interest in spreading the word about Biochemical Society Transactions.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
Both bio-ADM and lactate were higher in 90-day non-survivors compared to survivors at all time points (P , 0.05 for all). Lactate showed good prognostic value during the initial 24 h (AUC 0.78 at admission and 0.76 at 24 h). Subsequently, lactate returned normal (≤2 mmol/L) in most patients regardless of later outcome with lower prognostic value. By contrast, bio-ADM showed increasing prognostic value from 48 h and beyond (AUC 0.71 at 48 h and 0.80 at 5-10 days). Serial measurements of either bio-ADM or lactate were independent of and provided added value to CardShock risk score (P , 0.001 for both). Ninety-day mortality was more than double higher in patients with high levels of bio-ADM (,55.7 pg/mL) at 48 h compared to those with low bio-ADM levels (49.1 vs. 22.6%, P = 0.001). High levels of bio-ADM were associated with impaired cardiac index, mean arterial pressure, central venous pressure, and systolic pulmonary artery pressure during the study period. Furthermore, high levels of bio-ADM ...
Adrenomedullin (ADM) is a natural occurring 52 amino acid peptide which is mainly expressed in endothelial and smooth muscle cells. ADM plasma levels are increased in patients with sepsis and related with severity of disease. ADM is a key regulator of vasotonus and of endothelial integrity in sepsis. Adrecizumab is an antibody against the N-terminus of ADM which only partially inhibits the bioactivity of ADM. Several septic animal studies have shown that administration of Adrecizumab leads to stabilization of hemodynamics in mice and pigs, improved renal function, reduced catecholamine demand, improved fluid balance and improved survival. The administration of Adrecizumab to rodents, non-human primates and recently humans, has been tolerated very well.. The experimental human endotoxemia model, in which healthy male volunteers receive a low dose of lipopolysaccharide (LPS) derived from Escherichia coli, is widely used to study the effects of systemic inflammation in humans in vivo and is ...
We read the insightful article by Cherney and Sochett (1) with interest. The authors carefully compared changes in kidney hemodynamic function and arterial stiffness in young subjects with type 1 diabetes with and without renal hyperfiltration. During the transition from adolescence to early adulthood, hyperfiltration was not sustained, whereas glomerular filtration rate remained stable in normofiltering subjects. In contrast, arterial stiffness decreased in all patients regardless of filtration status, suggesting that age-related increases in arterial stiffness occur at older ages. It was also mentioned that a variety of factors influence hyperfiltration including the renin-angiotensin system (measured in the study by Cherney and Sochett), cyclo-oxygenase 2, reduced bioavailability of nitric oxide, etc. However, it was unclear why only a subgroup of type 1 diabetes attained hyperfiltration.. We would like to highlight another hormonal system, adrenomedullin (ADM), a powerful endothelial-derived ...
Diabetes may be a consequence of pancreatic cancer, preceding cancer diagnosis. The underlying mechanism is the release exosomes delivering adrenomedullin to β-cells, inducing endoplasmic reticulum stress and perturbations in the unfolded protein response, leading to β-cell dysfunction and death. This knowledge could lead to improved diagnostic strategies for pancreatic cancer. ...
"Entrez Gene: ADM2 adrenomedullin 2". Human ADM2 genome location and ADM2 gene details page in the UCSC Genome Browser. Kawai M ... 2006). "Immunocytochemical localization of adrenomedullin 2/intermedin-like immunoreactivity in human hypothalamus, heart and ... "Identification of novel adrenomedullin in mammals: a potent cardiovascular and renal regulator". FEBS Lett. 556 (1-3): 53-8. ...
In the presence of this (RAMP2) protein, CRLR functions as an adrenomedullin receptor. The RAMP2 protein is involved in core ... Fritz-Six KL, Dunworth WP, Li M, Caron KM (January 2008). "Adrenomedullin signaling is necessary for murine lymphatic vascular ... Kuwasako K, Kitamura K, Nagoshi Y, Eto T (2003). "Novel calcitonin-(8-32)-sensitive adrenomedullin receptors derived from co- ... 2008). "Lack of linkage and association of adrenomedullin and its receptor genes in French Caucasian rheumatoid arthritis trio ...
"Possible role of nitric oxide and adrenomedullin in bipolar affective disorder". Neuropsychobiology. 45 (2): 57-61. doi:10.1159 ...
The mammalian calcitonin gene-related peptides, adrenomedullin, amylin, and calcitonin receptors". Pharmacol Rev. 54 (2): 233- ...
Kuwasako K, Kitamura K, Nagoshi Y, Eto T (2003). "Novel calcitonin-(8-32)-sensitive adrenomedullin receptors derived from co- ... In the presence of this (RAMP3) protein, CRLR functions as an adrenomedullin receptor. GRCh38: Ensembl release 89: ... 2005). "Receptor activity-modifying protein (RAMP) isoform-specific regulation of adrenomedullin receptor trafficking by NHERF- ... receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. ...
Li Z, Takeuchi S, Ohara N, Maruo T (2003). "Paradoxically abundant expression of Bcl-2 and adrenomedullin in invasive cervical ...
"High plasma levels of human chromogranin A and adrenomedullin in patients with pheochromocytoma". Tumori. 91 (1): 53-8. PMID ...
1998). "Expression of the rat adrenomedullin receptor or a putative human adrenomedullin receptor does not correlate with ... 2004). "[Study of the expression and role of adrenomedullin and adrenomedullin receptor in patients with chronic obstructive ... of the rat adrenomedullin receptor or a putative human adrenomedullin receptor does not correlate with adrenomedullin binding ... 1997). "Expression of adrenomedullin and its receptor in normal and malignant human skin: a potential pluripotent role in the ...
2000). "CGRP-RCP, a novel protein required for signal transduction at calcitonin gene-related peptide and adrenomedullin ... in adrenomedullin receptor signal transduction". Peptides. 22 (11): 1773-81. doi:10.1016/S0196-9781(01)00517-4. PMID 11754963. ...
Li H, Dakour J, Kaufman S, Guilbert LJ, Winkler-Lowen B, Morrish DW (November 2003). "Adrenomedullin is decreased in ... The placenta produces the potent vasodilator adrenomedullin: it is reduced in pre-eclampsia and eclampsia. Other vasodilators ...
Kuwasako K, Kitamura K, Nagoshi Y, Eto T (2003). "Novel calcitonin-(8-32)-sensitive adrenomedullin receptors derived from co- ... 2004). "Tumor necrosis factor-alpha downregulates adrenomedullin receptors in human coronary artery smooth muscle cells". ... receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. In combination with the ... adrenomedullin, and amylin receptor function". Mol. Pharmacol. 74 (4): 1059-71. doi:10.1124/mol.108.047142. PMID 18593822. " ...
Stress can cause high levels of the following hormones: norepinephrine, leptin, NPY, nitrite, ACTH and adrenomedullin. Elevated ...
Born W, Muff R, Fischer JA (2002). "Functional interaction of G protein-coupled receptors of the adrenomedullin peptide family ... 1999). "The RAMP2/CRLR complex is a functional adrenomedullin receptor in human endothelial and vascular smooth muscle cells". ... 2000). "CGRP-RCP, a novel protein required for signal transduction at calcitonin gene-related peptide and adrenomedullin ... Hill H, Pioszak A (2013). "Bacterial expression and purification of a heterodimeric adrenomedullin receptor extracellular ...
The likelihood is that the phenotype of RAMP2 KO mice is more connected with the abolition of most adrenomedullin (AM) ... "The RAMP2/CRLR complex is a functional adrenomedullin receptor in human endothelial and vascular smooth muscle cells". FEBS ...
... and physiological actions of factor H as an adrenomedullin binding protein present in human plasma". Microscopy Research and ...
... and adrenomedullin. Thus, sacubitril increases the levels of these peptides, causing blood vessel dilation and reduction of ECF ...
2002). "Effects of endothelin-1 on release of adrenomedullin and C-type natriuretic peptide from individual human vascular ...
"CL/RAMP2 and CL/RAMP3 produce pharmacologically distinct adrenomedullin receptors: a comparison of effects of adrenomedullin22- ...
... and adrenomedullin. Neutral endopeptidase (NEP) also known as neprilysin is the enzyme that metabolizes natriuretic peptides. ...
Additional growth factors: Adrenomedullin. *Colony-stimulating factors (see here instead). *Connective tissue growth factor ( ...
Additional growth factors: Adrenomedullin. *Colony-stimulating factors (see here instead). *Connective tissue growth factor ( ...
... is a potent endothelium-dependent vasodilator, leading to a drop in blood pressure. It also causes contraction of non-vascular smooth muscle in the bronchus and gut, increases vascular permeability and is also involved in the mechanism of pain.[4] Bradykinin also causes natriuresis, contributing to the drop in blood pressure. Bradykinin raises internal calcium levels in neocortical astrocytes causing them to release glutamate, though this finding has only been confirmed in-vitro.[5] Bradykinin is also thought to be the cause of the dry cough in some patients on widely prescribed angiotensin-converting enzyme (ACE) inhibitor drugs. It is thought that bradykinin is converted to inactive metabolites by ACE, therefore inhibition of this enzyme leads to increased levels of bradykinin, which causes a dry cough via bronchoconstriction. In severe cases, the elevation of bradykinin may result in angioedema, a medical emergency.[6] People of African descent have up to 5x increased risk of ACE ...
... is an aminonucleoside antibiotic, derived from the Streptomyces alboniger bacterium,[1] that causes premature chain termination during translation taking place in the ribosome. Part of the molecule resembles the 3' end of the aminoacylated tRNA. It enters the A site and transfers to the growing chain, causing the formation of a puromycylated nascent chain and premature chain release.[2] The exact mechanism of action is unknown at this time but the 3' position contains an amide linkage instead of the normal ester linkage of tRNA. That makes the molecule much more resistant to hydrolysis and stops the ribosome. Puromycin is selective for either prokaryotes or eukaryotes. Also of note, puromycin is critical in mRNA display. In this reaction, a puromycin molecule is chemically attached to the end of an mRNA template, which is then translated into protein. The puromycin can then form a covalent link to the growing peptide chain allowing the mRNA to be physically linked to its translational ...
Additional growth factors: Adrenomedullin. *Colony-stimulating factors (see here instead). *Connective tissue growth factor ( ...
... (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. ...
Immunoreactive adrenomedullin has been detected in human plasma, and human adrenomedullin messenger RNA has been reported to be ... PLASMA ADRENOMEDULLIN AND CLINICAL, HAEMODYNAMIC, AND CARDIAC FUNCTION VARIABLES. Plasma adrenomedullin on day 2 was ... In the present study, we examined the prognostic value of plasma adrenomedullin on day 2, because plasma adrenomedullin ... Plasma adrenomedullin in non-survivors was markedly increased compared with survivors (fig 1). Plasma adrenomedullin correlated ...
The aim of the study was to find out whether prolonged exercise influences plasma adrenomedullin (ADM) concentration and ... Adrenomedullin / blood*. Adult. Blood Pressure / physiology. Exercise / physiology*. Exercise Test. Heart Rate / physiology. ... The aim of the study was to find out whether prolonged exercise influences plasma adrenomedullin (ADM) concentration and ...
Adrenomedullin (AM) is a multifunctional peptide that is highly expressed in several tumors and plays an important role in ... Functional Analysis of the Adrenomedullin Pathway in Malignant Pleural Mesothelioma. http://api.archives-ouvertes.fr/search/?fq ...
Adrenomedullin, a potent vasodilative peptide, and its receptor, calcitonin receptor-like receptor (CRLR), play an important ... Conclusions: CRLR is expressed in vascular tumours and, with adrenomedullin, may have a role in neoplastic vascular growth. ...
Uzan B, Ea HK, Launay JM, Garel JM, Champy R, Cressent M, Liote F. A critical role for adrenomedullin-calcitonin receptor-like ...
Adrenomedullin (ADM or AM) is a vasodilator peptide hormone of uncertain significance in human health and disease. It was ... The adrenomedullin knockout is an embryonic lethal phenotype and dies mid gestation from a condition known as hydrops fetalis. ... Adrenomedullin at the US National Library of Medicine Medical Subject Headings (MeSH) Human ADM genome location and ADM gene ... "Entrez Gene: Adrenomedullin". Meeran K, OShea D, Upton PD, Small CJ, Ghatei MA, Byfield PH, Bloom SR (January 1997). " ...
These data suggest that adrenomedullin is a new hormone participating in blood pressure control. Occurrence of adrenomedullin ... Adrenomedullin: a novel hypotensive peptide isolated from human pheochromocytoma.. Kitamura K1, Kangawa K, Kawamoto M, Ichiki Y ... "adrenomedullin". The peptide, consisting of 52 amino acids, has one intramolecular disulfide bond and shows slight homology ...
Adrenomedullin in heart failure: potential therapeutic implications.. Charles CJ1, Rademaker MT, Nicholls MG, Richards AM. ... Adrenomedullin (AM) may play a role in the pathophysiology of heart failure. Plasma levels of AM are raised in cardiovascular ...
These data suggest that adrenomedullin is a new hormone participating in blood pressure control. Occurrence of adrenomedullin ... Adrenomedullin: a novel hypotensive peptide isolated from human pheochromocytoma Biochem Biophys Res Commun. 1993 Apr 30;192(2 ... "adrenomedullin". The peptide, consisting of 52 amino acids, has one intramolecular disulfide bond and shows slight homology ...
Hennigsdorf/Berlin - Diagnostics company sphingotec GmbH reports novel applications of bio-ADM® (bio-active adrenomedullin), ... Sphingotec reveals novel results on bioactive adrenomedullin at the 39th ISICEM. sphingotec GmbH ...
... plasma adrenomedullin decreased from 6.3 +/- 2.9 fmol/ml to 3.0 +/- 1.6 fmol/ml. Immunoreactive adrenomedullin was localized ... Adrenomedullin, a new peptide, in patients with insulinoma.. [C Letizia, G Tamburrano, P Alo, A Paoloni, C Caliumi, E Marinoni ... To investigate whether adrenomedullin secretion is modified in patients with insulin-secreting islet cell tumours. The study ... Circulating adrenomedullin was assayed using a specific radioimmunoassay and its localization and distribution in the tumour ...
Adrenomedullin (AM) may intervene the activation of hepatic stellate cells by inhibiting TGF-beta1 production and TGF-beta1- ... Home Uncategorized Adrenomedullin modulates TGF-beta1 and beta1-induced MMP-2 in HSCs ... Adrenomedullin modulates TGF-beta1 and beta1-induced MMP-2 in HSCs. July 23, 2006. ...
... and adrenomedullin-2 on phosphorylation of eNOS in endothelial cells and found that only adrenomedullin and adrenomedullin-2, ... Role of adrenomedullin in flow-induced eNOS regulation. (A) BAECs were treated with adrenomedullin (ADM, 10 nM, 5 minutes), ... Cells were treated with adrenomedullin (ADM, 10 nM, 5 minutes [B] or 30 minutes [D]) or adrenomedullin-2 (ADM2, 1 nM, 3 minutes ... Adrenomedullin then induces the activation of the Gs-coupled endothelial adrenomedullin receptor to increase intracellular cAMP ...
Results Adrenomedullin dramatically reduced lung permeability in VILI in mice, leading to improved oxygenation. Adrenomedullin ... Adrenomedullin reduces vascular hyperpermeability and improves survival in rat septic shock. Intensive Care Med 2007;33:703-10. ... Mice were ventilated with a tidal volume (VT) of 12 ml/kg for 6 h (6 h vent). Adrenomedullin was infused for 4 h starting 2 h ... Adrenomedullin ameliorates lipopolysaccharide-induced acute lung injury in rats. Am J Physiol Lung Cell Mol Physiol 2007;293: ...
Adrenomedullin attenuates ventilator-induced lung injury in mice Message subject: (Your Name) has forwarded a page to you from ...
Adrenomedullin (AM) is a 52 amino acid peptide that has shown predominant anti-inflammatory activities. In the present study, ... Anti-Inflammatory Effects of Adrenomedullin on Acute Lung Injury Induced by Carrageenan in Mice. Talero Elena,1 Di Paola ...
Adrenomedullin (AM) plays an important role in the regulation of inflammatory processes; however, the role and expression of AM ... S. Yang, M. Zhou, D. E. Fowler, and P. Wang, "Mechanisms of the beneficial effect of adrenomedullin and adrenomedullin-binding ... a) IL-1β, (b) adrenomedullin (AM), (c) receptor activity-modifying protein 2 (RAMP2), and (d) RAMP3 gene expression in ST ... a) IL-1β, (b) adrenomedullin (AM), (c) receptor activity-modifying protein 2 (RAMP2), and (d) RAMP3 gene expression in ST ...
a leading provider for Adrenomedullin Peptides, Chemotactic Peptides, Melanotan Peptides, Ova Peptides, Obesity Peptides, ...
Hinson JP, Kapas S, Smith DM (2000) Adrenomedullin, a multifunctional regulatory peptide. Endocr Rev 21:138-167PubMedGoogle ... Adrenomedullin wurde im Jahr 1993 erstmalig aus einem Phäochromozytom im Nebenierenmark extrahiert. Nach der „adrenal medulla" ... Adrenomedullin ist ein Peptid aus 52 Aminosäuren mit zahlreichen Wirkungen auf Herz-Kreislauf-System, Hormonsysteme, Atmung, ... Hubl W. (2019) Adrenomedullin. In: Gressner A.M., Arndt T. (eds) Lexikon der Medizinischen Laboratoriumsdiagnostik. Springer ...
Adrenomedullin receptor}} Adrenomedullin (AM) exerts its actions through combinations of the calcitonin receptor like receptor ... The adrenomedullin knockout is an embryonic lethal phenotype and dies mid gestation from a condition known as hydrops fetalis. ... Peptide == Adrenomedullin consists of 52 amino acids, has 1 intramolecular disulfide bond, and shows a slight homology with the ... By RNA-blot analysis, human adrenomedullin mRNA was found to be expressed in all tissues, and most highly expressed in the ...
Mice with endothelium-specific deficiency of adrenomedullin, the adrenomedullin receptor, or Gαs showed reduced flow-induced ... Our data identify fluid shear stress-induced PIEZO1 activation as a central regulator of endothelial adrenomedullin release and ... Shear stress-induced endothelial adrenomedullin signaling regulates vascular tone and blood pressure. ... Shear stress-induced endothelial adrenomedullin signaling regulates vascular tone and blood pressure. ...
Adrenomedullin has attracted considerable interest among cardiologists due ... Adrenomedullin was discovered in 1993 in an extract of human pheochromocytoma while monitoring cAMP levels in rat platelets. ... Adrenomedullin in Cardiovascular Disease is an up-to-date review of the most relevant aspects of adrenomedullin. It encompasses ... Pleiotropic Effect of Adrenomedullin: Lessons from Pure Adrenomedullin Knockout Mouse Tatsuo Shimosawa, Katsuyuki Ando, Toshiro ...
Adrenomedullin expression in human tumor cell lines: its potential role as an autocrine growth factor. J Biol Chem. 1996; 271: ... Effects of adrenomedullin on cultured rat cardiac myocytes and fibroblasts. Eur J Pharmacol. 1999; 382: 1-9. ... Adrenomedullin (AM) is a vasodilator peptide originally isolated from the extract of human pheochromocytoma.1 It has also been ... Adrenomedullin: a possible autocrine or paracrine inhibitor of hypertrophy of cardiomyocytes. Hypertension. 1998; 31: 505-510. ...
Adrenomedullin Reduces Endothelial Hyperpermeability. Stefan Hippenstiel, Martin Witzenrath, Bernd Schmeck, Andreas Hocke, ... Adrenomedullin acts via stimulation of cyclic AMP and not via calcium signalling in vascular cells in culture. J Hum Hypertens ... Adrenomedullin and the control of fluid and electrolyte homeostasis. Annu Rev Physiol. 1999; 61: 363-389. ... Vijay P. Adrenomedullin in the treatment of pulmonary hypertension. Heart. 2000; 84: 575-576. ...
To determine the role of adrenomedullin (AM), a multifunctional peptide, in lipid metabolism in GDM. ...
  • Our findings indicate that circulating adrenomedullin is increased in insulinoma and that this increase is related to the neoplastic phenotype. (sigmaaldrich.com)
  • Immunoreactive adrenomedullin has been detected in human plasma, and human adrenomedullin messenger RNA has been reported to be highly expressed not only in the phaeochromocytoma, but also in the adrenal medulla, kidney, lung, peripheral vascular bed, and the cardiac ventricles. (bmj.com)
  • 9 10 Both the failing ventricle and the disordered peripheral vascular bed have been shown to be responsible for the high plasma adrenomedullin in patients with heart failure. (bmj.com)
  • Among these factors, adrenomedullin, a 52-amino acid peptide, has been intensively investigated due to its vascular protective properties (e.g., vasodilatory and antiproliferative) and promising potential as a therapeutic target ( 4 ). (diabetesjournals.org)
  • Adrenomedullin has also been shown to have important effects in vascular cell biology in which it regulates vascular tone and permeability and promotes vasodilation ( 12 - 16 ). (aacrjournals.org)
  • Adrenomedullin in vascular diseases. (nii.ac.jp)
  • Endogenous adrenomedullin Protects against vascular response to injury in mice. (nii.ac.jp)
  • Adrenomedullin can protect against pulmonary vascular remodeling induced by hypoxia'Circulation. (nii.ac.jp)
  • Publications] Matsui H, Shimosawa T, Itakura K, Xing G, Ando K, Fujita T: 'Adrenomedullin can protect against pulmonary vascular remodeling induced by hypoxia'Circulation. (nii.ac.jp)
  • Wang L, Li C, Chen Y, Dong S, Chen X, Zhou Y. Poly(lactic-co-glycolic) Acid/Nanohydroxyapatite Scaffold Containing Chitosan Microspheres with Adrenomedullin Delivery for Modulation Activity of Osteoblasts and Vascular Endothelial Cells. (phoenixbiotech.net)
  • Levels of plasma total adrenomedullin are related with two acute phase inflammatory reactants (fibrinogen and sialic acid) but not with markers of endothelial dysfunction in Type 1 diabetes Adrenomedullin and vascular risk factors in Type 1 DM. (phoenixpeptide.com)
  • Adrenomedullin (ADM) is a circulating peptide known to regulate vasodilation and vascular integrity. (aaccjnls.org)
  • Although a few studies have investigated the relationship between adrenomedullin and type 1 diabetes ( 6 ), as far as we know, the relationship between adrenomedullin and type 2 diabetes has not been well elucidated. (diabetesjournals.org)
  • We previously observed protection against VILI by Adrenomedullin (AM). Here we analyzed impact VILI on lung injury, pulmonary and systemic inflammation, bacterial burden and end-organ injury in established pneumonia. (ersjournals.com)
  • Accumulating evidence suggests the possible involvement of adrenomedullin in the physiology of the pulmonary circulation and the pathophysiology of hypoxaemia. (portlandpress.com)
  • The portion of the adrenomedullin molecule possessing these pulmonary active profiles was also examined, using two truncated adrenomedullin molecules: adrenomedullin (1-25) and adrenomedullin (22-52). (ersjournals.com)
  • Inhaled adrenomedullin (100 microg.mL(-1), 1 min) also significantly inhibited pulmonary changes induced by ovalbumin inhalation (3 mg x mL (-1) , 3 min). (ersjournals.com)
  • These pulmonary profiles of adrenomedullin were enhanced by inhibiting the active production of endogenous nitric oxide. (ersjournals.com)
  • Intrinsically increased adrenomedullin levels may function as a compensatory mechanism for hypoxaemia in congenital cyanotic heart disease. (portlandpress.com)
  • Adrenomedullin wird aus Präproadrenomedullin (185 Aminosäuren) über Proadrenomedullin (164 Aminosäuren) durch enzymatische Abspaltung von Aminosäuren gebildet. (springer.com)
  • Adrenomedullin in heart failure: potential therapeutic implications. (nih.gov)
  • Hennigsdorf/Berlin - Diagnostics company sphingotec GmbH reports novel applications of bio-ADM® (bio-active adrenomedullin), the very first biomarker capable to diagnose the onset of septic shock, allowing physicians earliest life-saving therapeutic interventions in sepsis critical care. (eurekalert.org)
  • These data indicate that adrenomedullin acting via ADMR increases the aggressiveness of pancreatic cancer cells and suggests that these molecules may be useful therapeutic targets. (aacrjournals.org)
  • The purpose of the present study was to evaluate the therapeutic effects of adrenomedullin in rabbits with antigen-induced arthritis, an experimental model of rheumatoid arthritis. (biomedcentral.com)
  • In this regard, three novel biomarkers have been described that may have contributory and/or predictive roles in the development of circulatory failure - mid-regional pro-adrenomedullin (MR-proADM), C-terminal pro-endothelin-1 (CT-proET-1), and high-sensitivity troponin T (hsTNT). (biomedcentral.com)
  • Results Adrenomedullin dramatically reduced lung permeability in VILI in mice, leading to improved oxygenation. (bmj.com)
  • In the current study, we investigated whether mid-regional pro-adrenomedullin (MR-proADM) and copeptin, in addition to clinical evaluation, could predict short-term outcomes. (dovepress.com)
  • MBS2600200 is a ready-to-use microwell, strip plate ELISA (enzyme-linked immunosorbent assay) Kit for analyzing the presence of the mid regional pro adrenomedullin MR (ProADM) ELISA Kit target analytes in biological samples. (mybiosource.com)
  • We investigated the relationship between mid-regional pro-adrenomedullin (MR-proADM), C-terminal pro-endothelin-1 (CT-proET-1), and myocardial injury, measured using transthoracic echocardiography and hsTNT in septic shock patients. (biomedcentral.com)
  • To circumvent the reported problems associated with the measurement of ADM, midregional pro-adrenomedullin (MR-proADM) has been introduced as an alternative surrogate marker ( 22 , 23 ). (aaccjnls.org)
  • INTRODUCTION: Pro-adrenomedullin (proADM) is helpful for individual risk assessment and outcome prediction in sepsis. (unibas.ch)
  • This review focuses on mid-regional pro-adrenomedullin (MR-proADM) and ST2. (elsevier.pt)
  • Complement factor H is a serum-binding protein for adrenomedullin, and the resulting complex modulates the bioactivities of both partners. (phoenixbiotech.net)
  • Methods In untreated mice (female C57/Bl6 mice, 11-15 weeks old) and animals treated with adrenomedullin, lung permeability, local and systemic inflammation and markers of distal organ function were assessed following 2 or 6 h of mechanical ventilation with 100% oxygen and protective or moderately injurious ventilator settings, respectively. (bmj.com)
  • Adrenomedullin treatment reduced myosin light chain phosphorylation, attenuated the accumulation of leucocytes in the lung and prevented the increase in lactate and creatinine levels in mice ventilated with high tidal volumes. (bmj.com)
  • Based on genomic screening and studies of COCs cultured in vitro , we showed that intermedin (IMD)/adrenomedullin 2 (ADM2) is a novel oocyte-derived ligand important for the regulation of cell interactions in COCs that functions, in part, by suppressing cumulus cell apoptosis. (pubmedcentralcanada.ca)
  • By RNA-blot analysis, human adrenomedullin mRNA was found to be expressed in all tissues, and most highly expressed in the placenta, fat cells, lung, pancreatic islets, smooth muscle, and skin. (wikipedia.org)
  • Adrenomedullin was discovered in 1993 in an extract of human pheochromocytoma while monitoring cAMP levels in rat platelets. (springer.com)
  • Li Y, Zhang Y, Shibahara S, Takahashi K: Adrenomedullin in adipocyte differentiation of human mesenchymal stem cells. (diabetesjournals.org)
  • Adrenomedullin (ADM) is a mitogen for human retinal pigment epithelial cells (hRPE) and stimulates cAMP in rat2 fibroblasts. (arvojournals.org)
  • Adrenomedullin was localized in the neoplastic epithelium of 90% (43 of 48) of human pancreatic adenocarcinomas analyzed by immunohistochemistry and was expressed by 100% (8 of 8) of pancreatic cancer cell lines analyzed by reverse transcription-PCR. (aacrjournals.org)
  • Cockcroft, J.R. , Noon, J.P. , Gardner-Medwin, J. and Bennett, T. (1997) Haemodynamic effects of adrenomedullin in human resistance and capacitance vessels. (gla.ac.uk)
  • Adrenomedullin is a cross-talk molecule that regulates tumor and mast cell function during human carcinogenesis. (phoenixbiotech.net)
  • Regulation of adrenomedullin secretion in cultured human skin and oral keratinocytes. (phoenixbiotech.net)
  • The N-terminal fragment of Human Adrenomedullin, AM (1-25) shows intensive vasopressor activities. (peptanova.de)