Chemicals and Drugs
Adipates
Adipates
Derivatives of adipic acid. Included under this heading are a broad variety of acid forms, salts, esters, and amides that contain a 1,6-carboxy terminated aliphatic structure.

Dimethyl adipimidate: a new antisickling agent. (1/166)

A new approach to the prevention of sickling in vitro by use of the bifunctional crosslinking reagent, dimethyl adipimidate, is described. Prior treatment of sickle erythrocytes with dimethyl adipimidate will inhibit sickling in completely deoxygenated erythrocytes. Treated erythrocytes do not demonstrate the potassium loss and viscosity increase that usually accompany sickling. The oxygen affinity of hemoglobin in these cells is increased independently from changes in the concentration of 2,3-diphosphoglycerate. The hemoglobin obtained from treated erythrocytes contains a high-molecular-weight component as well as additional positively charged components. The relative degree to which chemical modification and/or crosslinking is an essential part of the antisickling properties of the material is not known.  (+info)

In vitro cytotoxicity of textile paint components linked to the "Ardystil syndrome". (2/166)

The spraying of a paint formula (Acramin F system) had led to severe pulmonary disease in textile printing sprayers in Spain and Algeria (Ardystil syndrome). In order to elucidate the underlying mechanisms of the toxicity of this paint and its main polymeric components, Acramin FWR, Acramin FWN, Acrafix FHN, and Acramoll W, we have undertaken studies using a battery of different cell-types and assessing in vitro cytotoxicity by measuring LDH leakage. This study shows that, as in in vivo studies, the three polycationic paint components, Acramin FWR (a polyurea), Acramin FWN (a polyamide-amine), and Acrafix FHN (a polyamine) exhibited considerable cytotoxicity (LC50 generally below 100 microg/ml for an incubation of 20-24 h) in vitro, while Acramoll W, which is not a polycation, was almost non-toxic (in the concentration range tested). The cytotoxicity was comparable in primary cultures of rat and human type II pneumocytes and alveolar macrophages as well as in the pulmonary cell line A549 and the hepatic cell line HepG2. In human erythrocytes, the toxicity was less pronounced. We speculate that the multiple positive charges play an important role in the toxic mechanism. It is concluded that Acramin FWR and Acramin FWN have similar intrinsic toxicity and that these polymeric compounds, which have no irritant properties or systemic toxicity when given orally, exert a high, unexpected, degree of cytotoxicity.  (+info)

Desulfovirga adipica gen. nov., sp. nov., an adipate-degrading, gram-negative, sulfate-reducing bacterium. (3/166)

A novel, mesophilic, Gram-negative bacterium was isolated from an anaerobic digestor for municipal wastewater. The bacterium degraded adipate in the presence of sulfate, sulfite, thiosulfate and elemental sulfur. (E)-2-Hexenedioate accumulated transiently in the degradation of adipate. (E)-2-Hexenedioate, (E)-3-hexenedioate, pyruvate, lactate, C1-C12 straight-chain fatty acids and C2-C10 straight-chain primary alcohols were also utilized as electron donors. 3-Phenylpropionate was oxidized to benzoate. The G + C content of the DNA was 60 mol%. 16S rDNA sequence analysis revealed that the new isolate clustered with species of the genus Syntrophobacter and Desulforhabdus amnigenus. Strain TsuAS1T resembles Desulforhabdus amnigenus DSM 10338T with respect to the ability to utilize acetate as an electron donor and the inability to utilize propionate without sulfate in co-culture with Methanospirillum hungatei DSM 864. Strains TsuAS1T and DSM 10338T form a 'non-syntrophic subcluster' within the genus Syntrophobacter. Desulfovirga adipica gen. nov., sp. nov. is proposed for the newly isolated bacterium, with strain TsuAS1T (= DSM 12016T) as the type strain.  (+info)

Characterization of a second tfd gene cluster for chlorophenol and chlorocatechol metabolism on plasmid pJP4 in Ralstonia eutropha JMP134(pJP4). (4/166)

Within the 5.9-kb DNA region between the tfdR and tfdK genes on the 2,4-dichlorophenoxyacetic acid (2,4-D) catabolic plasmid pJP4 from Ralstonia eutropha JMP134, we identified five open reading frames (ORFs) with significant homology to the genes for chlorocatechol and chlorophenol metabolism (tfdCDEF and tfdB) already present elsewhere on pJP4. The five ORFs were organized and assigned as follows: tfdD(II)C(II)E(II)F(II) and tfdB(II) (in short, the tfd(II) cluster), by analogy to tfdCDEF and tfdB (the tfd(I) cluster). Primer extension analysis of mRNA isolated from 2,4-D-grown R. eutropha JMP134 identified a single transcription start site in front of the first gene of the cluster, tfdD(II), suggesting an operon-like organization for the tfd(II) genes. By expressing each ORF in Escherichia coli, we confirmed that tfdD(II) coded for a chloromuconate cycloisomerase, tfdC(II) coded for a chlorocatechol 1, 2-dioxygenase, tfdE(II) coded for a dienelactone hydrolase, tfdF(II) coded for a maleylacetate reductase, and tfdB(II) coded for a chlorophenol hydroxylase. Dot blot hybridizations of mRNA isolated from R. eutropha JMP134 showed that both tfd(I) and tfd(II) genes are transcribed upon induction with 2,4-D. Thus, the functions encoded by the tfd(II) genes seem to be redundant with respect to those of the tfd(I) cluster. One reason why the tfd(II) genes do not disappear from plasmid pJP4 might be the necessity for keeping the regulatory genes for the 2,4-D pathway expression tfdR and tfdS.  (+info)

Genetic analysis of a gene cluster for cyclohexanol oxidation in Acinetobacter sp. Strain SE19 by in vitro transposition. (5/166)

Biological oxidation of cyclic alcohols normally results in formation of the corresponding dicarboxylic acids, which are further metabolized and enter the central carbon metabolism in the cell. We isolated an Acinetobacter sp. from an industrial wastewater bioreactor that utilized cyclohexanol as a sole carbon source. A cosmid library was constructed from Acinetobacter sp. strain SE19, and oxidation of cyclohexanol to adipic acid was demonstrated in recombinant Escherichia coli carrying a SE19 DNA segment. A region that was essential for cyclohexanol oxidation was localized to a 14-kb fragment on the cosmid DNA. Several putative open reading frames (ORFs) that were expected to encode enzymes catalyzing the conversion of cyclohexanol to adipic acid were identified. Whereas one ORF showed high homology to cyclohexanone monooxygenase from Acinetobacter sp. strain NCIB 9871, most of the ORFs showed only moderate homology to proteins in GenBank. In order to assign functions of the various ORFs, in vitro transposon mutagenesis was performed using the cosmid DNA as a target. A set of transposon mutants with a single insertion in each of the ORFs was screened for cyclohexanol oxidation in E. coli. Several of the transposon mutants accumulated a variety of cyclohexanol oxidation intermediates. The in vitro transposon mutagenesis technique was shown to be a powerful tool for rapidly assigning gene functions to all ORFs in the pathway.  (+info)

Identification in Saccharomyces cerevisiae of two isoforms of a novel mitochondrial transporter for 2-oxoadipate and 2-oxoglutarate. (6/166)

The nuclear genome of Saccharomyces cerevisiae encodes 35 members of a family of membrane proteins. Known members transport substrates and products across the inner membranes of mitochondria. We have localized two hitherto unidentified family members, Odc1p and Odc2p, to the inner membranes of mitochondria. They are isoforms with 61% sequence identity, and we have shown in reconstituted liposomes that they transport the oxodicarboxylates 2-oxoadipate and 2-oxoglutarate by a strict counter exchange mechanism. Intraliposomal adipate and glutarate and to a lesser extent malate and citrate supported [14C]oxoglutarate uptake. The expression of Odc1p, the more abundant isoform, made in the presence of nonfermentable carbon sources, is repressed by glucose. The main physiological roles of Odc1p and Odc2p are probably to supply 2-oxoadipate and 2-oxoglutarate from the mitochondrial matrix to the cytosol where they are used in the biosynthesis of lysine and glutamate, respectively, and in lysine catabolism.  (+info)

Key aromatic-ring-cleaving enzyme, protocatechuate 3,4-dioxygenase, in the ecologically important marine Roseobacter lineage. (7/166)

Aromatic compound degradation in six bacteria representing an ecologically important marine taxon of the alpha-proteobacteria was investigated. Initial screens suggested that isolates in the Roseobacter lineage can degrade aromatic compounds via the beta-ketoadipate pathway, a catabolic route that has been well characterized in soil microbes. Six Roseobacter isolates were screened for the presence of protocatechuate 3,4-dioxygenase, a key enzyme in the beta-ketoadipate pathway. All six isolates were capable of growth on at least three of the eight aromatic monomers presented (anthranilate, benzoate, p-hydroxybenzoate, salicylate, vanillate, ferulate, protocatechuate, and coumarate). Four of the Roseobacter group isolates had inducible protocatechuate 3, 4-dioxygenase activity in cell extracts when grown on p-hydroxybenzoate. The pcaGH genes encoding this ring cleavage enzyme were cloned and sequenced from two isolates, Sagittula stellata E-37 and isolate Y3F, and in both cases the genes could be expressed in Escherichia coli to yield dioxygenase activity. Additional genes involved in the protocatechuate branch of the beta-ketoadipate pathway (pcaC, pcaQ, and pobA) were found to cluster with pcaGH in these two isolates. Pairwise sequence analysis of the pca genes revealed greater similarity between the two Roseobacter group isolates than between genes from either Roseobacter strain and soil bacteria. A degenerate PCR primer set targeting a conserved region within PcaH successfully amplified a fragment of pcaH from two additional Roseobacter group isolates, and Southern hybridization indicated the presence of pcaH in the remaining two isolates. This evidence of protocatechuate 3, 4-dioxygenase and the beta-ketoadipate pathway was found in all six Roseobacter isolates, suggesting widespread abilities to degrade aromatic compounds in this marine lineage.  (+info)

Identification of the human mitochondrial oxodicarboxylate carrier. Bacterial expression, reconstitution, functional characterization, tissue distribution, and chromosomal location. (8/166)

In Saccharomyces cerevisiae, the genes ODC1 and ODC2 encode isoforms of the oxodicarboxylate carrier. They both transport C5-C7 oxodicarboxylates across the inner membranes of mitochondria and are members of the family of mitochondrial carrier proteins. Orthologs are encoded in the genomes of Caenorhabditis elegans and Drosophila melanogaster, and a human expressed sequence tag (EST) encodes part of a closely related protein. Information from the EST has been used to complete the human cDNA sequence. This sequence has been used to map the gene to chromosome 14q11.2 and to show that the gene is expressed in all tissues that were examined. The human protein was produced by overexpression in Escherichia coli, purified, and reconstituted into phospholipid vesicles. It has similar transport characteristics to the yeast oxodicarboxylate carrier proteins (ODCs). Both the human and yeast ODCs catalyzed the transport of the oxodicarboxylates 2-oxoadipate and 2-oxoglutarate by a counter-exchange mechanism. Adipate, glutarate, and to a lesser extent, pimelate, 2-oxopimelate, 2-aminoadipate, oxaloacetate, and citrate were also transported by the human ODC. The main differences between the human and yeast ODCs are that 2-aminoadipate is transported by the former but not by the latter, whereas malate is transported by the yeast ODCs but not by the human ortholog. In mammals, 2-oxoadipate is a common intermediate in the catabolism of lysine, tryptophan, and hydroxylysine. It is transported from the cytoplasm into mitochondria where it is converted into acetyl-CoA. Defects in human ODC are likely to be a cause of 2-oxoadipate acidemia, an inborn error of metabolism of lysine, tryptophan, and hydroxylysine.  (+info)

adipic acid formula structure
Adipic Acid Chemical Structure Composition. Date: 17 March 2014: Source: Own work: Author: Emeldir : SVG development : This structural formula was created with Name2Struct - CS ChemDraw Ultra. Adipic acid rarely occurs in nature. Esters of Adipic Acid, such as DOA (Di-2-Ethylhexyl Adipate) are used as plasticizers for PolyVinyl Chloride (PVC) resins. Molecular Weight. Adipic acid rarely occurs in nature. Nylon 66 (nylon 6-6, nylon 6/6 or nylon 6,6) is a type of polyamide or nylon.It, and nylon 6, are the two most common for textile and plastic industries.Nylon 66 is made of two monomers each containing 6 carbon atoms, hexamethylenediamine and adipic acid, which give nylon 66 its name. Adipic acid is the organic compound with the formula (CH2)4(COOH)2. Ethylene glycol, adipic acid, toluene diisocyanate polymer; Hexanedioic acid, 1,2-ethanediol, 1,3-diisocyanatomethylbenzene; Hexaned . A method has been reported that uses principles of green chemistry where water is the only by-product. Structure ...
https://eustore.mdisc.com/best-ikea-wbi/31ed65-adipic-acid-formula-structure
624d) Mass Balance Based Semi-Quantification of Adipic Acid Producing Enzyme Cascade | AIChE624d) Mass Balance Based Semi-Quantification of Adipic Acid Producing Enzyme Cascade | AIChE
Biological production of adipic acid is a promising alternative to the environmentally challenged petrochemical-based process currently used. Lignin is a promising feedstock for adipic acid production as it can be broken down into the aromatic intermediates that can be used to produce adipic acid. One common pathway for microbial production of adipic acid goes through a catechol intermediate to form muconic acid, which is then reduced to form adipic acid. To produce adipic acid in Escherichia coli, we utilize an enzyme cascade of catechol 1,2-dioxygenase (CatA) and enoate reductase (ER). Optimization of protein expression using synthetic biology allowed us to optimize adipic acid yield. Furthermore, we characterize our enzyme cascade by analyzing its metabolism of different substituted catechols available from lignin pyrolysis. We demonstrate production of substituted dicarboxylic acids that could be used in the production of nylon analogs with tunable properties. To quantify metabolism of ...
https://www.aiche.org/conferences/aiche-annual-meeting/2019/proceeding/paper/624d-mass-balance-based-semi-quantification-adipic-acid-producing-enzyme-cascade
Participation of the β-Ketoadipate Transport System in Chemotaxis | Microbiology SocietyParticipation of the β-Ketoadipate Transport System in Chemotaxis | Microbiology Society
SUMMARY: β-Ketoadipate serves as a chemoattractant for Pseudomonas putida. The chemotactic response is inducible, and a regulatory mutant strain that forms the β-ketoadipate transport system at high levels exhibits a heightened chemotactic response to β-ketoadipate. Adipate and succinate, compounds that interact with the transport system, inhibit chemotaxis toward β-ketoadipate. Some, but not all, mutants that fail to respond chemotactically to β-ketoadipate lack the β-ketoadipate transport system. It thus appears that the transport of β-ketoadipate is associated with its function as a chemoattractant. It is likely that the metabolite attracts fluorescent Pseudomonas species to environments in which complex aromatic polymers undergo microbial dissimilation.
https://www.microbiologyresearch.org/content/journal/micro/10.1099/00221287-124-1-25
Adipic Acid Market to Record an Exponential CAGR During 2016-2022 | Apr 24, 2017 - ReleaseWireAdipic Acid Market to Record an Exponential CAGR During 2016-2022 | Apr 24, 2017 - ReleaseWire
Press Release issued Apr 24, 2017: Adipic acid is one of the most commercially important type of aliphatic dicarboxylic acids, especially due to its significant usage as a feedstock for the production of industrial fibers. It is produced from the oxidation of a mixture of cyclohexanol and cyclohexanone with nitric acid. Alternatively, adipic acid can also be produced from butadiene carbonylation. There has been a significant demand for chemically resilient, strong and durable fibers for the manufacture of automotive parts. This has initiated a strong demand for adipic acid, since it is one of the key ingredients for the production of composite materials. The major consumption of adipic acid is as the feedstock for the production for nylon 6,6 resin and engineering fibers. The non-nylon applications of adipic acid include its usage in the manufacture of polyurethanes, plasticizers, food additives and pharmaceuticals.
http://www.sbwire.com/press-releases/adipic-acid-market-to-record-an-exponential-cagr-during-2016-2022-798633.htm
Adipic Acid Market Is Expected To Fuel The Demand For Nylon Resins And Fiber From Major End Use Industries Till 2020: Grand...
Global Adipic Acid Market is expected to reach USD 7,240.8 million by 2020, according to a new study by Grand View Research, Inc. Growing demand for nylon resins and fiber from major end use industries such as automotive and electronics mainly in BRIC nations is expected to remain a key driving factor for the market over the next six years. However, volatility in raw material prices coupled with stringent regulations in Europe and North America on account of growing environmental concerns is expected to hinder the market growth over the forecast period. Development of bio-based adipic acid emerged as a new driving force for the global Adipic Acid market. Bio-based adipic acid is an environment friendly solution, and provides cost advantage over its synthetic counterpart. Rennovia has been one of the pioneers for bio-based adipic acid development, using glucose as feedstock via its proprietary chemical catalytic process technology. Nylon 6,6 both in its fiber and resin forms emerged as the ...
http://www.atlanta-chronicle.com/story/132330/adipic-acid-market-is-expected-to-fuel-the-demand-for-nylon-resins-and-fiber-from-major-end-use-industries-till-2020-grand-view-research-inc.html
Piperazine Adipate in Rajkot,Piperazine Adipate Manufacturers and Suppliers from indiaPiperazine Adipate in Rajkot,Piperazine Adipate Manufacturers and Suppliers from india
Business Directory for Piperazine Adipate Suppliers in Rajkot - Get contact details of Piperazine Adipate Manufacturers, Wholesale Piperazine Adipate Exporters, Best Piperazine Adipate Traders & Distributors Across the Rajkot.
http://www.indianyellowpages.com/rajkot/piperazine-adipate.htm
Global Adipic Acid Market 2017 - Asahi Kasei, DuPont, LANXESS, Ascend - Important Events 24
4 Others. At last, the key constraints having an impact on market growth and reducing the popularity of specific product segments during the forecast period are also listed in this report. The potential growth opportunities and their influence on the Global Adipic Acid Market is analysed in the report.. What Information does this report contain?. , What was the historic Adipic Acid market data from 2012 to 2016?. , What is the Adipic Acid industry growth forecast from 2016 to 2022?. , Which companies lead the Adipic Acid industry, how are they positioned in the market in terms of sustainability, competency, production capacity and strategic outlook?. , What are the technology & innovation trends, how will they evolve by 2022?. , Which are the leading market products, applications & regions and how will they perform by 2022?. , A detailed analysis of regulatory trends, drivers, industry pitfalls, challenges and growth opportunities for participants. ...
http://importantevents24.com/2017/07/04/global-adipic-acid-market-2017/
Glentham Life Sciences | GM8712 - Adipic acid dihydrazide (1071-93-8)Glentham Life Sciences | GM8712 - Adipic acid dihydrazide (1071-93-8)
Glentham Life Sciences is a supplier of GM8712 - Adipic acid dihydrazide (1071-93-8). Find catalogue prices, chemical data, technical specifications and MSDS documents.
https://www.glentham.com/en/products/product/GM8712/
Bis(2-ethylhexyl) adipate, 99%, ACROS Organics™ 2.5L; Glass bottle Bis(2-ethylhexyl) adipate, 99%, ACROS Organics™ | Fisher...Bis(2-ethylhexyl) adipate, 99%, ACROS Organics™ 2.5L; Glass bottle Bis(2-ethylhexyl) adipate, 99%, ACROS Organics™ | Fisher...
Shop a large selection of Bis(2-ethylhexyl) adipate, 99%, ACROS Organics™ products and learn more about Bis(2-ethylhexyl) adipate, 99%, ACROS Organics™ 2.5L; Glass
https://www.fishersci.co.uk/shop/products/bis-2-ethylhexyl-adipate-99-acros-organics/10025353
Piperazine Adipate Oral Powder in Aalanavara, Top 10 Piperazine Adipate Oral Powder Aalanavara
Find the best piperazine adipate oral powder in Aalanavara. Justsee provide the top 10 piperazine adipate oral powder Chennai, addresses, phone numbers, contact information.
https://www.justseeyellowpages.com/piperazine-adipate-oral-powder-aalanavara
World Adipic Acid Market is Expected to Grow at a CAGR of 4.7% from 2014 to 2020: Grand View Research, Inc on Environmental XPRTWorld Adipic Acid Market is Expected to Grow at a CAGR of 4.7% from 2014 to 2020: Grand View Research, Inc on Environmental XPRT
Article World Adipic Acid Market is Expected to Grow at a CAGR of 4.7% from 2014 to 2020: Grand View Research, Inc. The global market for adipic acid is expected to reach USD 7,240.8 million by 2020, according to a new study by Grand View Research, I...
https://www.environmental-expert.com/articles/world-adipic-acid-market-is-expected-to-grow-at-a-cagr-of-4-7-from-2014-to-2020-grand-view-research--430837
Reaction mass of dimethyl adipate and dimethyl... - Registration Dossier - ECHAReaction mass of dimethyl adipate and dimethyl... - Registration Dossier - ECHA
There is one reliable key study for this endpoint. In this study (Habeck C., 2010), the vapor pressure of Reaction mass of Dimethyl adipate (CAS627-93-0), Dimethyl glutarate (CAS1119-40-0) and Dimethyl succinate (CAS106-65-0) was determined according to the EECDirective 92/69, A.4 (2008), to the OECD guideline No. 104, (2006) and to the Council Regulation EC No. 761/2009, A4 (2009) using the gas saturation method. The study was compliant with the GLP principles. The vapor pressure of Reaction mass of Dimethyl adipate (CAS627-93-0), Dimethyl glutarate (CAS1119-40-0) and Dimethyl succinate (CAS106-65-0) was measured at test temperatures of 30 °C, 40 °C and 50 °C and was determined to be ...
https://www.echa.europa.eu/web/guest/registration-dossier/-/registered-dossier/14563/4/7
2016 Bis[(3,4-Epoxycyclohexyl)Methyl]Adipate (CAS 3130-19-6) Industry Market Report : ReportsnReports
[150 Pages Report] Check for Discount on 2016 Bis[(3,4-Epoxycyclohexyl)Methyl]Adipate (CAS 3130-19-6) Industry Market Report report by Prof Research. The Global and Chinese Bis[(3,4-Epoxycyclohexyl)Methyl]Adipate...
http://www.reportsnreports.com/reports/671927-2016-bis-34-epoxycyclohexyl-methyladipate-cas-3130-19-6-industry-market-report.html
Metabolic and Structural Requirements for the Carcinogenic Potencies of Unsubstituted and Methyl-Substituted Polycyclic...Metabolic and Structural Requirements for the Carcinogenic Potencies of Unsubstituted and Methyl-Substituted Polycyclic...
Extensive metabolism studies of many non-K-region dihydro-diols of unsubstituted and methyl-substituted polycyclic aromatic hydrocarbons (PAHs) by mammalian drug-metabolizing enzymes indicate that...
https://rd.springer.com/chapter/10.1007/978-94-009-9104-0_12
Adipic acid sources, health risksAdipic acid sources, health risks
Adipic acid is a naturally-occurring dicarboxylic acid present in sugar canes and beets, though it can be commercially prepared by ...
https://naturalpedia.com/adipic-acid-sources-health-risks.html
ChemIDplus - 215395-69-0 - Fatty acids, C18-unsatd., dimers, polymers with adipic acid, 5-amino-1,3,3...
215395-69-0 - Fatty acids, C18-unsatd., dimers, polymers with adipic acid, 5-amino-1,3,3-trimethylcyclohexanemethanamine, diethylenetriamine and terephthalic acid - Searchable synonyms, formulas, resource links, and other chemical information.
https://chem.nlm.nih.gov/chemidplus/rn/215395-69-0
adipic acidadipic acid
Adipic acid definition, a white, crystalline, slightly water-soluble solid, C 6 H 10 O 4 , used chiefly in the synthesis of nylon. See more.
http://www.dictionary.com/browse/adipic-acid
Novamont launches 4th Gen bioplastic | Green Chemicals BlogNovamont launches 4th Gen bioplastic | Green Chemicals Blog
Earlier generation of Mater-Bi® are composed of starches derived from plants, mainly corn starch, and a fully biodegradable synthetic aliphatic-aromatic polyester called PBAT (polybutylene adipate co-terephthalate) trademarked under the name Origo-Bi. This biodegradable synthetic polyester technology made with combination of diacids (e.g. adipic acid and terephthalic acid) and diols (e.g. BDO), was acquired from Eastman, which was originally called Eastar-Bio, in 2004.. The blog is guessing that for the 4th generation Mater-Bi® line, instead of using petroleum-based monomers, adipic acid and BDO, adipic acid will be then be substituted by vegetable oil-based azelaic acid (the blog heard that this diacid is produced from rancidity of oleic acid) and Genomaticas biobased BDO. Substitution of the aromatic terephthalic acid with a biobased material will still take time.. In preparation for this product, Novamont has been investing around €300m ($400.8m) with two new biorefineries via ...
https://greenchemicalsblog.com/2013/06/18/novamont-launches-4th-gen-bioplastic/
China Diethyl Hydroxylamine (DEHA) - China Deha, N N-DiethylhydroxylamineChina Diethyl Hydroxylamine (DEHA) - China Deha, N N-Diethylhydroxylamine
China Diethyl Hydroxylamine (DEHA), Find details about China Deha, N N-Diethylhydroxylamine from Diethyl Hydroxylamine (DEHA) - Heze Kingvolt Chemical Co., Ltd.
http://kingvoltchem.en.made-in-china.com/product/tSExjRycgzrB/China-Diethyl-Hydroxylamine-DEHA-.html
Ethylene Carbonate Manufacturer,Dimethyl Adipate,Dibasic Ester Supplier,IndiaEthylene Carbonate Manufacturer,Dimethyl Adipate,Dibasic Ester Supplier,India
PRASOL CHEMICALS LTD. - Manufacturer, Supplier and Trader of Ethylene Carbonate, Dimethyl Adipate, Dibasic Ester, Specialty Chemical based in Mumbai, Maharashtra, India.
http://www.prasolchemicals.com
SPECTRUM Di N Alkyl Adipate,25ml - 26XD27|A1386-25ML - GraingerSPECTRUM Di N Alkyl Adipate,25ml - 26XD27|A1386-25ML - Grainger
Looking for SPECTRUM Di N Alkyl Adipate,25ml (26XD27)? Graingers got your back. Price:$37.90. Easy ordering & convenient delivery. Log-in or register for your pricing.
https://www.grainger.com/product/SPECTRUM-Di-N-Alkyl-Adipate-26XD27
Benzyl butyl adipate - Alfa ChemistryBenzyl butyl adipate - Alfa Chemistry
Benzyl butyl adipate/ACM4121135 can be provided in Alfa Chemistry. We are dedicated to provide our customers the best products and services.
http://www.alfa-chemistry.com/cas_4121-13-5.htm
Table of Contents for 2016 Dimethyl adipate (CAS 627-93-0) Industry Market Report 2016 Report at Market Research ReportsTable of Contents for 2016 Dimethyl adipate (CAS 627-93-0) Industry Market Report 2016 Report at Market Research Reports
Table of Contents for 2016 Dimethyl adipate (CAS 627-93-0) Industry Market Report by Prof Research Available at market-research-reports.com.
http://www.market-research-reports.com/toc-475038-2016-dimethyl-adipate-cas-627-93-0-industry-market-report
ChemIDplus - 19780-94-0 - NWQGXNKQFIEUPY-UHFFFAOYSA-N - Dimethyl-2-methyl adipate - Similar structures search, synonyms,...
19780-94-0 - NWQGXNKQFIEUPY-UHFFFAOYSA-N - Dimethyl-2-methyl adipate - Similar structures search, synonyms, formulas, resource links, and other chemical information.
https://chem.nlm.nih.gov/chemidplus/rn/19780-94-0
Cancer research yields unexpected new way to produce nylonCancer research yields unexpected new way to produce nylon
Reitman and colleagues had a hunch that the genetic mutation seen in cancer might trigger a similar functional change to a closely related enzyme found in yeast and bacteria (homoisocitrate dehydrogenase), which would create the elusive 2-hydroxyadipate dehydrogenase necessary for green adipic acid production.. They were right. The functional mutation observed in cancer could be constructively applied to other closely related enzymes, creating a beneficial outcome - in this case the missing link that could enable adipic acid production from cheap sugars. The next step will be to scale up the overall adipic acid production process, which remains a considerable undertaking.. Its exciting that sequencing cancer genomes can help us to discover new enzyme activities, Reitman said. Even genetic changes that occur in only a few patients could reveal useful new enzyme functions that were not obvious before.. Yan, a professor in the Department of Pathology and senior author of the study, said the ...
http://www.innovations-report.com/html/reports/life-sciences/cancer-research-yields-unexpected-produce-nylon-202765.html
Adipic dihydrazide, 98%, ACROS Organics™ | Fisher ScientificAdipic dihydrazide, 98%, ACROS Organics™ | Fisher Scientific
Shop a large selection of Adipic dihydrazide, 98%, ACROS Organics™ products and learn more about Adipic dihydrazide, 98%, ACROS Organics™ .
https://www.fishersci.ca/shop/products/adipic-dihydrazide-98-acros-organics-3/p-3777181
Solid state characterisation of novel active pharmaceutical ingredients: co-crystal of a salbutamol hemiadipate salt with...Solid state characterisation of novel active pharmaceutical ingredients: co-crystal of a salbutamol hemiadipate salt with...
The production of salt or cocrystalline forms is a common approach to alter the physicochemical properties of pharmaceutical compounds. The goal of this work was to evaluate the impact of anion choice (succinate, adipate, and sulfate) on the physicochemical characteristics of salbutamol forms. Novel crystals of salbutamol were produced by solvent evaporation: a cocrystal of salbutamol hemiadipate with adipic acid (salbutamol adipate, SA), salbutamol hemisuccinate tetramethanolate (SSU.MeOH), and its desolvated form (SSU). The crystalline materials obtained were characterized using thermal, X-ray, nuclear magnetic resonance, Fourier transform infrared spectroscopy, dynamic vapor sorption (DVS), and elemental analysis. The crystal forms of SA and SSU.MeOH were determined to be triclinic, (P?i), and monoclinic, (P21/n), respectively. DVS analysis confirmed that SSU and SA do not undergo hydration under increased relative humidity. Both thermal and elemental analyses confirmed the stoichiometry of ...
http://www.tara.tcd.ie/handle/2262/57492
Diisotridecyl adipate - Registration Dossier - ECHADiisotridecyl adipate - Registration Dossier - ECHA
In a 103-week carcinogenicity study, the read-across substance DEHA was administered to F344 rats and B6C3F1 mice in the diet at levels of 12000 or 25000 ppm, equivalent to a daily intake of 600 or 1250 mg/kg of body weight in rats and 1715 or 3570 mg/kg of body weight in mice (conversion based on data from the WHO report (2004)). No test substance related tumors were found in the rat (no increased tumour incidences). In the (female) mice an increased number of hepatocellular carcinomas was found at both doses. Hepatocellular adenomas and carcinomas occured combined in high-dose mice of both sexes and in low-dose female mice at incidences that were dose-related and significantly higher than those in control mice. The association of liver tumours in male mice with the administration of DEHA was not considered to be conclusive because the increased number of liver tumours in males reflected only an increase in adenomas in the high-dose group and because the time to observation of tumours was not ...
https://echa.europa.eu/registration-dossier/-/registered-dossier/16101/7/8
Adipic acid, diisobutyl ester - toxicity, ecological toxicity and regulatory informationAdipic acid, diisobutyl ester - toxicity, ecological toxicity and regulatory information
Data on 6,500 pesticides, insecticides and herbicides including toxicity, water pollution, ecological toxicity, uses and regulatory status.
http://pesticideinfo.org/Detail_Chemical.jsp?Rec_Id=PC34130
Adipic acid, di(3-methylpentyl) esterAdipic acid, di(3-methylpentyl) ester
The National Institute of Standards and Technology (NIST) uses its best efforts to deliver a high quality copy of the Database and to verify that the data contained therein have been selected on the basis of sound scientific judgment. However, NIST makes no warranties to that effect, and NIST shall not be liable for any damage that may result from errors or omissions in the Database ...
https://webbook.nist.gov/cgi/inchi?ID=U353706&Units=CAL
Adipic acid, ethyl 3-methylbutyl esterAdipic acid, ethyl 3-methylbutyl ester
The National Institute of Standards and Technology (NIST) uses its best efforts to deliver a high quality copy of the Database and to verify that the data contained therein have been selected on the basis of sound scientific judgment. However, NIST makes no warranties to that effect, and NIST shall not be liable for any damage that may result from errors or omissions in the Database ...
https://webbook.nist.gov/cgi/inchi/InChI%3D1S/C13H24O4/c1-4-16-12
Acid | Compliance and MethodologyAcid | Compliance and Methodology
With a network of price reporters across Asia, Europe and the US, ICIS is fully equipped to keep you updated on everything that happens in the global Adipic acid market, whether you buy or sell Adipic acid or related products. From daily and weekly reports containing price assessments obtained by our network of local reporters, […]. ...
https://www.icis.com/compliance/tag/acid/
uae adipic acid vibrating sieve typesuae adipic acid vibrating sieve types
2021-6-7 · Big bag unloading station stripping box - Standard big bag unloading. Speed: 10 to 30 big bags/h. Capacity: 2 tons/big bag. This big bag unloading standard model has been designed to ergonomically discharge the bulk bags and facilitate their handling. The structure is adjustable to easily adapt to different sizes of big bags.. The EF0 FIBC discharge equipment offers 3 types of loading …. Get Price ...
https://www.moviehd.xyz/uae-adipic-acid-vibrating-sieve-types_4589/
Microscope World Blog: TropismMicroscope World Blog: Tropism
The above tropism is a polarized light microscope image of adipic acid, (CH2)4(COOH)2. The nearly 2.5 billion kg of adipic acid produced each year is mostly used as a monomer for the production of nylon. Other major uses involve polymers. It is a monomer for production of Polyurethane and it is used in making PVC. The image above was captured using a microscope digital camera adapter and a standard digital camera ...
http://blog.microscopeworld.com/2009/11/tropism.html
Diisopropyl adipate - toxicity, ecological toxicity and regulatory informationDiisopropyl adipate - toxicity, ecological toxicity and regulatory information
Data on 6,500 pesticides, insecticides and herbicides including toxicity, water pollution, ecological toxicity, uses and regulatory status.
http://www.pesticideinfo.org/Detail_Chemical.jsp?Rec_Id=PC41581
Reaction mass of dimethyl adipate and dimethyl... - Registration Dossier - ECHAReaction mass of dimethyl adipate and dimethyl... - Registration Dossier - ECHA
Information on Registered Substances comes from registration dossiers which have been assigned a registration number. The assignment of a registration number does however not guarantee that the information in the dossier is correct or that the dossier is compliant with Regulation (EC) No 1907/2006 (the REACH Regulation). This information has not been reviewed or verified by the Agency or any other authority. The content is subject to change without prior notice ...
https://www.echa.europa.eu/web/guest/registration-dossier/-/registered-dossier/14563/7/1
EMBL: CR382138.PE60
CR382138.PE60 Location/Qualifiers FT CDS_pept 131151..135242 FT /transl_table=12 FT /locus_tag=DEHA2F01474g FT /old_locus_tag=DEHA0F01738g FT /old_locus_tag=DEHA-IPF8986 FT /old_locus_tag=DEHA-CDS0150.1 FT /product=DEHA2F01474p FT /note=some similarities with uniprot,P39521 Saccharomyces FT cerevisiae YPR104C FHL1 and similar to CA0765,IPF9040.3eoc FT Candida albicans IPF9040.3eoc FT /db_xref=EnsemblGenomes-Gn:DEHA2F01474g FT /db_xref=EnsemblGenomes-Tr:CAG88734 FT /db_xref=GOA:Q6BMZ3 FT /db_xref=InterPro:IPR000253 FT /db_xref=InterPro:IPR001766 FT /db_xref=InterPro:IPR008984 FT /db_xref=InterPro:IPR036388 FT /db_xref=InterPro:IPR036390 FT /db_xref=UniProtKB/TrEMBL:Q6BMZ3 FT /protein_id=CAG88734.2 FT /translation=MMSSLSLGDDSLTSSKKEQDSLEDKNLKGNLGKQEDNNKIGGVDI FT EREADAQSLDLDDEINSILNDNEENHKAHRKQGAETKNDEDIATQMSLPDLQDLDIGPL FT DKIQNPMNKIVLDFDDTSKTVSNSQSPNPVDEETYDRYKNSTSQVDIRRNSSLVPITSE FT AALGSSNHEDDKDSSKISAYARLDFENFTFFVQTLQVILGRKSNDELLQSSHHAVDVHL FT ...
http://pbil.univ-lyon1.fr/cgi-bin/acnuc-search-id?query=CR382138.PE60&db=EMBL&ident=ACNUC6288
Azithromycin - Answers on HealthTapAzithromycin - Answers on HealthTap
Azithromycin (zithromax, azithrocin, zmax, azin)[1] is an azalide, a subclass of macrolide antibiotics. Azithromycin is one of the worlds best-selling antibiotics.[2][not in citation given (see discussion.)] it is derived from erythromycin, with a methyl-substituted nitrogen atom incorporated into the lactone ring, thus making the lactone ring 15-membered.
https://www.healthtap.com/topics/azithromycin
Dynamic Physical HealthDynamic Physical Health
Azithromycin is among the best selling antibiotics in the world. Its made from erythrocyte, using a methyl-substituted nitrogen atom integrated in to lactones-ring, hence production 15-membered lactones. Azithromycin is used to prevent and treat a variety of bacterial infections and its use in treating sexually transmitted infections like cervicitis, non gonococcal-urethritis & Chlamydia is proven … ...
http://www.dynamicphysicalhealth.com
KEGG SSDB Paralog Search Result: dha:DEHA2G19382gKEGG SSDB Paralog Search Result: dha:DEHA2G19382g
T01026 (acav,adh,amin,apom,arn,asoc,ato,bara,bko,camg,cmb,def,fln,gli,gtm,les,mbov,mee,ntp,ntt,parb,part,pht,ppoa,ptu,rhu,sgv,smal,sscu,sya,tpaf,trl : calculation not yet completed ...
http://www.kegg.jp/ssdb-bin/ssdb_paralog?org_gene=dha:DEHA2G19382g
KEGG SSDB Best Search Result: dha:DEHA2F10450gKEGG SSDB Best Search Result: dha:DEHA2F10450g
T01026 (bbev,caer,carg,ccar,clus,cmag,cpap,csph,cuh,cwe,cyy,ddq,egz,hbe,hbr,hhh,jsv,kqv,mass,ment,mgot,mko,mlac,moc,mtw,nfu,odi,oro,pavi,pet,pgs,pib,pmac,prap,pret,psuf,ros,rrz,shyd,sob,soe,spun,stan,svu,tmu,tprf,vro,wpa,xph,zne : calculation not yet completed ...
http://www.kegg.jp/ssdb-bin/ssdb_best?org_gene=dha:DEHA2F10450g
EC 1.14.13.66EC 1.14.13.66
Accepted name: 2-hydroxycyclohexanone 2-monooxygenase. Reaction: 2-hydroxycyclohexan-1-one + NADPH + H+ + O2 = 6-hydroxyhexan-6-olide + NADP+ + H2O. Systematic name: 2-hydroxycyclohexan-1-one,NADPH:oxygen 2-oxidoreductase (1,2-lactonizing). Comment: the product decomposes spontaneously to 6-oxohexanoic acid (adipic semialdehyde).. Links to other databases: BRENDA, EXPASY, KEGG, Metacyc, CAS registry number: 62628-31-3. References. 1. Davey, J.F. and Trudgill, P.W. The metabolism of trans-cyclohexan-1,2-diol by an Acinetobacter species. Eur. J. Biochem. 74 (1977) 115-127. [PMID: 856571]. ...
http://www.sbcs.qmul.ac.uk/iubmb/enzyme/EC1/14/13/66.html
CAS No.68201-57-0,Rosin, fumarated, polymer with adipic acid and pentaerythritol SuppliersCAS No.68201-57-0,Rosin, fumarated, polymer with adipic acid and pentaerythritol Suppliers
Find quality suppliers and manufacturers of 68201-57-0(Rosin, fumarated, polymer with adipic acid and pentaerythritol) for price inquiry. where to buy 68201-57-0(Rosin, fumarated, polymer with adipic acid and pentaerythritol).Also offer free database of 68201-57-0(Rosin, fumarated, polymer with adipic acid and pentaerythritol) including MSDS sheet(poisoning, toxicity, hazards and safety),chemical properties,Formula, density and structure, solution etc.
http://www.lookchem.com/cas-682/68201-57-0.html
430. Adipic acid (WHO Food Additives Series 12)430. Adipic acid (WHO Food Additives Series 12)
INTERNATIONAL PROGRAMME ON CHEMICAL SAFETY WORLD HEALTH ORGANIZATION SUMMARY OF TOXICOLOGICAL DATA OF CERTAIN FOOD ADDITIVES WHO FOOD ADDITIVES SERIES NO. 12 The data contained in this document were examined by the Joint FAO/WHO Expert Committee on Food Additives* Geneva, 18-27 April 1977 Food and Agriculture Organization of the United Nations World Health Organization * Twenty-first Report of the Joint FAO/WHO Expert Committee on Food Additives, Geneva, 1977, WHO Technical Report Series No. 617 ADIPIC ACID Explanation This substance has been evaluated for acceptable daily intake by the Joint FAO/WHO Expert Committee on Food Additives (see Annex I, Ref. Nos. 11 and 13) in 1965. The previous monograph has been expanded and is reproduced below. EVALUATION FOR ACCEPTABLE DAILY INTAKE BIOLOGICAL DATA BIOCHEMICAL ASPECTS Four young dogs were injected subcutaneously with 0.25 g adipic acid (sodium salt), twice daily, for a period of five days. Urine was collected during this period, and for three days ...
http://inchem.org/documents/jecfa/jecmono/v12je02.htm
Spiramycin adipate (CAS 1405-20-5) Market Research Report 2018Spiramycin adipate (CAS 1405-20-5) Market Research Report 2018
Spiramycin adipate (CAS 1405-20-5) Market Research Report 2018 aims at providing comprehensive data on spiramycin adipate market globally and regionally
https://marketpublishers.com/report/industry/chemicals_petrochemicals/spiramycin_adipate_1405-20-5_market_research_report.html
Molecules | Free Full-Text | A Novel Antioxidant Isobenzofuranone Derivative from Fungus Cephalosporium sp.AL031Molecules | Free Full-Text | A Novel Antioxidant Isobenzofuranone Derivative from Fungus Cephalosporium sp.AL031
Bioassay-guided fractionation of metabolites from the fungus Cephalosporium sp.AL031 isolated from Sinarundinaria nitida led to the discovery of a new isobenzofuranone derivative, 4,6-dihydroxy-5-methoxy-7-methylphthalide (1), together with three known compounds: 4,5,6-trihydroxy-7-methyl-1,3-dihydroisobenzofuran (2), 4,6-dihydroxy-5-methoxy-7-methyl-1,3-dihydroisobenzofuran (3) and 4,5,6-trihydroxy-7-methylphthalide (4). The structure of the new compound 1 was determined based on MS, 1D and 2D NMR spectral data. Compounds 1-4 showed potent antioxidant activity with EC50 values of 10, 7, 22 and 5 μM by 1,1-diphenyl-2-picryhydrazyl (DPPH) radical-scavenging assay.
http://www.mdpi.com/1420-3049/17/4/4219
PRIME PubMed | Poly(glycerol adipate)-fatty acid esters as versatile nanocarriers: From nanocubes over ellipsoids to nanospherePRIME PubMed | Poly(glycerol adipate)-fatty acid esters as versatile nanocarriers: From nanocubes over ellipsoids to nanosphere
PubMed journal article Poly(glycerol adipate)-fatty acid esters as versatile nanocarriers: From nanocubes over ellipsoids to nanosphere were found in PRIME PubMed. Download Prime PubMed App to iPhone, iPad, or Android
https://www.unboundmedicine.com/medline/citation/21971295/Poly_glycerol_adipate__fatty_acid_esters_as_versatile_nanocarriers:_From_nanocubes_over_ellipsoids_to_nanospheres_
In vitro dermal absorption of di(2-ethylhexyl) adipate (DEHA) in a roll-on deodorant using human skin. | Sigma-AldrichIn vitro dermal absorption of di(2-ethylhexyl) adipate (DEHA) in a roll-on deodorant using human skin. | Sigma-Aldrich
Sigma-Aldrich offers abstracts and full-text articles by [Simon Ningsun Zhou, Richard P Moody, Bio Aikawa, Anna Yip, Bing Wang, Jiping Zhu].
https://www.sigmaaldrich.com/catalog/papers/23356645
2016, Thesis, Plasticizers Derived from Biorenewable Resources : 2,5-Bis(hydroxymethyl)furan and Glycerol/adipic Acid...2016, Thesis, Plasticizers Derived from Biorenewable Resources : 2,5-Bis(hydroxymethyl)furan and Glycerol/adipic Acid...
Copyright 2016 by Simone Lazar. In accordance with Title 17 of the United States Code, Copyright Law of the United States of America, this material is copyrighted, and any further reproduction or distribution is prohibited without the permission of the copyright owner ...
https://scholarly.cmich.edu/?a=d&d=CMUGR2016-92.1.122
2016, Thesis, Plasticizers Derived from Biorenewable Resources : 2,5-Bis(hydroxymethyl)furan and Glycerol/adipic Acid...2016, Thesis, Plasticizers Derived from Biorenewable Resources : 2,5-Bis(hydroxymethyl)furan and Glycerol/adipic Acid...
Copyright 2016 by Simone Lazar. In accordance with Title 17 of the United States Code, Copyright Law of the United States of America, this material is copyrighted, and any further reproduction or distribution is prohibited without the permission of the copyright owner ...
https://scholarly.cmich.edu/?a=d&d=CMUGR2016-92.1.27
Diacetone Acrylamide and Adipic Dihydrazide (CAS 2873-97-4) Market 2019-2024Diacetone Acrylamide and Adipic Dihydrazide (CAS 2873-97-4) Market 2019-2024
by Product (Diacetone Acrylamide (DAAM), Adipic Dihydrazide (ADH)), by Application (Coatings & Adhesives, Formaldehyde Absorbers, Chemical Intermediates, Curing Agents, Textile, Paper) and by Region, Trend, Forecast, Competitive Analysis, and Growth Oppor
https://www.asdreports.com/market-research-report-498400/diacetone-acrylamide-adipic-dihydrazide-cas-market
paclitaxel loaded adipic dihydrazide/octanedioic acid/branched polyethyleneimine-modified hyaluronic acid micellespaclitaxel loaded adipic dihydrazide/octanedioic acid/branched polyethyleneimine-modified hyaluronic acid micelles
Page contains details about paclitaxel loaded adipic dihydrazide/octanedioic acid/branched polyethyleneimine-modified hyaluronic acid micelles . It has composition images, properties, Characterization methods, synthesis, applications and reference articles : nano.nature.com
http://nano.nature.com/nano/GR-M6042400
Sequence Similarity - 4FPI: Crystal Structure of 5-chloromuconolactone isomerase from Rhodococcus opacus 1CP Sequence...Sequence Similarity - 4FPI: Crystal Structure of 5-chloromuconolactone isomerase from Rhodococcus opacus 1CP Sequence...
4FPI: X-ray crystallographic and molecular docking studies on a unique chloromuconolactone dehalogenase from Rhodococcus opacus 1CP.
http://www.rcsb.org/pdb/explore/sequenceCluster.do?structureId=4FPI
Synthesis, Characterization, and Immunological Properties of LPS-Based Vaccines Composed of O-Polysaccharides Conjugated with...Synthesis, Characterization, and Immunological Properties of LPS-Based Vaccines Composed of O-Polysaccharides Conjugated with...
Pseudomonas aeruginosa remains one of the major pathogens affecting immunocompromised patients. LPS-based monovalent (MV) and polyvalent (PV) conjugate vaccines were prepared from the most prevalent strains of P. aeruginosa International Antigenic Typing Scheme (IATS) 6, 10, 11 and 20 to evaluate their immunogenicity and protective capacities from infection by the pathogens. Conjugation of the O-polysaccharide (O-PS) antigens of P. aeruginosa strains to the common immunogenic recombinant Exotoxin A (rEPA) supports the multi-antigenic approach for the development of a vaccine that provides cross protection against various strains of the pathogen. The O-PSs were indirectly conjugated through adipic acid dihydrazide (ADH) to rEPA by carbodiimidemediated condensation reaction. Mice were immunized with the conjugates emulsified with monophosphoryl lipid A (MPL) or Freunds adjuvant compared with conjugates without adjuvant, unconjugated mixture of rEPA and O-PS emulsified with MPL, and sterile saline. The MV
https://m.scirp.org/papers/65647
Rhea - Annotated reactions databaseRhea - Annotated reactions database
Evidence for two uptake systems in Rhizobium leguminosarum for hydroxy-aromatic compounds metabolized by the 3-oxoadipate pathway. Wong, C.M.; Dilworth, M.J.; Glenn, A.R.; Arch. Microbiol. 156, 385-391 (1991) ...
https://www.rhea-db.org/reaction?id=10185
EMBL: CR382138.PE377
CR382138.PE377 Location/Qualifiers FT CDS complement(751782..752987) FT /transl_table=12 FT /locus_tag=DEHA2F08712g FT /old_locus_tag=DEHA0F09603g FT /old_locus_tag=DEHA-IPF8377 FT /old_locus_tag=DEHA-CDS3172.1 FT /product=DEHA2F08712p FT /note=similar to uniprot,P41338 Saccharomyces cerevisiae FT YPL028W ERG10 Acetyl-CoA C-acetyltransferase (acetoacetyl- FT CoA thiolase) cytosolic enzyme that transfers an acetyl FT group from one acetyl-CoA molecule to another forming FT acetoacetyl-CoA FT /db_xref=EnsemblGenomes-Gn:DEHA2F08712g FT /db_xref=EnsemblGenomes-Tr:CAG89081 FT /db_xref=GOA:Q6BM30 FT /db_xref=InterPro:IPR002155 FT /db_xref=InterPro:IPR016039 FT /db_xref=InterPro:IPR020610 FT /db_xref=InterPro:IPR020613 FT /db_xref=InterPro:IPR020615 FT /db_xref=InterPro:IPR020616 FT /db_xref=InterPro:IPR020617 FT /db_xref=UniProtKB/TrEMBL:Q6BM30 FT /protein_id=CAG89081.1 FT /translation=MSSVYIVSTARTPIGAFQGGLSSLTYSDLGSHAVHAALKKVPQIK FT ...
http://pbil.univ-lyon1.fr/cgi-bin/acnuc-search-pe?query=CR382138.PE377&db=EMBL&ident=ACNUC6288
DEHA2D16280g - DEHA2D16280p - Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) -...DEHA2D16280g - DEHA2D16280p - Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) -...
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class=publication>Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href=http://www.nrbook.com/b/bookcpdf.php>Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
http://www.uniprot.org/uniprot/Q6BRH7
Pamatolol
Ban, T; Sada, S; Takahashi, Y; Sada, H; Fujita, T (1985). Effects of para-substituted beta-adrenoceptor blocking agents and methyl-substituted phenoxypropanolamine derivatives on maximum upstroke velocity of action potential in guinea-pig papillary muscles. Naunyn-Schmiedebergs Archives of Pharmacology. 329 (1): 77-85. doi:10.1007/bf00695196. PMID 2582279 ...
https://readtiger.com/wkp/en/Pamatolol
Calcium D-Glucarate Cellular DetoxifierCalcium D-Glucarate Cellular Detoxifier
Find Calcium D-Glucarate. Calcium D-Glucarate includes the patented compound glucarate which has been shown to enhance the major detoxification pathways in the body.
https://www.evenbetternow.com/proddetail.php?prod=Calcium-D-Glucarate&cat=191
Cation resin with oxidation resistant<...Cation resin with oxidation resistant<...
Macroporous Strong acid Cation resin with oxidation resistant, such as nitric acid,recovery metal in a strong oxidation media.recovery Cu,V from adipic acid
https://www.iex-resin.com/ion-exchange-resin/special-ion-exchange-resin/cation-resin-with-oxidation-resistant/
CiNii Articles - YAMAMOTO Hiroko
Relationship between twisting phenomenon and structural discontinuity of stacked lamellae in the spherulite of poly(ethylene adipate) as studied by the synchrotron X-ray microbeam technique (Special issue : Cutting Edge of Scattering from Softmaterials) （2019 ...
https://ci.nii.ac.jp/author?q=YAMAMOTO+Hiroko
Buy #1 Calcium D-Glucarate Capsules from Absorb HealthBuy #1 Calcium D-Glucarate Capsules from Absorb Health
Buy Calcium D-Glucarate Capsules from Absorb Health to Detoxify and Reduce Excess Estrogen! We are Proud to Offer Ours for the Affordable Price of Only...
https://www.absorbyourhealth.com/product/calciumdglucarate/
2-Oxo-2,3-dihydrofuran-5-acetate2-Oxo-2,3-dihydrofuran-5-acetate
2-Oxo-2,3-dihydrofuran-5-acetate; 3-Oxoadipate enol-lactone; 4,5-Dihydro-5-oxofuran-2-acetate; 5-Oxo-4,5-dihydrofuran-2-acetate; C03586 ...
http://equilibrator.weizmann.ac.il/compound?compoundId=C03586
JUN 17-18 PCAC RW - SAC TrackerJUN 17-18 PCAC RW - SAC Tracker
Revisions to the drugs that may not be compounded and allowed bulk drug substances. Discussion about the identification of a substance as demonstrably difficult to compound
http://www.sac-tracker.com/blog/2015/5/28/jun-17-18-pcac-rw
DHTKD1 Antibody 27493-1-AP | ProteintechDHTKD1 Antibody 27493-1-AP | Proteintech
DHTKD1 Antibody 27493-1-AP has been identified with WB, ELISA. 27493-1-AP detected 103 kDa band in HepG2 cells with 1:500-1:1000 dilution...
https://www.ptglab.com/Products/DHTKD1-Antibody-27493-1-AP.htm
AdipamideAdipamide
"Dimethyl Adipate". chemicalland21.com. v t e (Chemical articles with multiple compound IDs, Multiple chemicals in an infobox ... Adipamide is formed by treating dimethyl adipate with concentrated ammonia. MSDS at Oxford University Musser, M. T. (2005). " ...
https://en.wikipedia.org/wiki/Adipamide
2-Octanol2-Octanol
... adipate, maleate, stearate, myristate, etc.), Plasticizers (acrylates, maleates, etc.), Pesticides: Dinocap Lubricants: Zinc ...
https://en.wikipedia.org/wiki/2-Octanol
Plastic wrapPlastic wrap
One case is in regard to diethylhexyl adipate (DEHA). DEHA is a plasticizer, a substance added to some plastics in order to ...
https://en.wikipedia.org/wiki/Plastic_wrap
Biodegradable plasticBiodegradable plastic
Polybutylene adipate terephthalate (PBAT) is a biodegradable random copolymer. No international standard has been established ... Biodegradable starch blends include starch/polylactic acid, starch/polycaprolactone, and starch/polybutylene-adipate-co- ...
https://en.wikipedia.org/wiki/Biodegradable_plastic
Johannes WislicenusJohannes Wislicenus
Wislicenus prepared cyclopentane from cyclopentanone ("Ketopentamethen"), which is prepared by heating calcium adipate. ...
https://en.wikipedia.org/wiki/Johannes_Wislicenus
CyclopentaneCyclopentane
Wislicenus prepared cyclopentane from cyclopentanone ("Ketopentamethen"), which is prepared by heating calcium adipate. Tatlow ...
https://en.wikipedia.org/wiki/Cyclopentane
Pyrotechnic compositionPyrotechnic composition
For composite rocket propellants, dioctyl adipate, isodecyl pelargonate, and dioctyl phthalate are often used. Plasticizers can ...
https://en.wikipedia.org/wiki/Pyrotechnic_composition
Nylon-eating bacteriaNylon-eating bacteria
KI72: identification of the enzymes responsible for the conversion of 6-aminohexanoate to adipate". Applied Microbiology and ...
https://en.wikipedia.org/wiki/Nylon-eating_bacteria
Methylene diphenyl diisocyanateMethylene diphenyl diisocyanate
Typical polyols used are polyethylene adipate (a polyester) and poly(tetramethylene ether) glycol (a polyether). 4,4′-MDI is ...
https://en.wikipedia.org/wiki/Methylene_diphenyl_diisocyanate
AmphetamineAmphetamine
"Determination That Delcobese (Amphetamine Adipate, Amphetamine Sulfate, Dextroamphetamine Adipate, Dextroamphetamine Sulfate) ... Frequently prepared solid salts of amphetamine include amphetamine adipate, aspartate, hydrochloride, phosphate, saccharate, ...
https://en.wikipedia.org/wiki/Amphetamine
Polyvinyl chloridePolyvinyl chloride
A wide variety of substances can be used as plasticizers including phthalates, adipates, trimellitates, polymeric plasticizers ... These are for example the antioxidant bisphenol A, the biocide benzisothiazolinone, propylene glycol/adipate polyester and ...
https://en.wikipedia.org/wiki/Polyvinyl_chloride
John KopchickJohn Kopchick
The title of his M.S. thesis was 'Catabolism of alpha-amino adipate by Pseudomonas putida p2'.[self-published source?] He went ...
https://en.wikipedia.org/wiki/John_Kopchick
PolyesterPolyester
... s can also be telechelic oligomers like the polycaprolactone diol (PCL) and the polyethylene adipate diol (PEA). They ...
https://en.wikipedia.org/wiki/Polyester
Dibasic esterDibasic ester
... s of phthalates, adipates, and azelates with C8 - C10 alcohols have found commercial use as lubricants, spin ...
https://en.wikipedia.org/wiki/Dibasic_ester
Acidity regulatorAcidity regulator
Adipate List of food additives Sodium bicarbonate "What are acidity regulators and why are they added to food". www.eufic.org. ...
https://en.wikipedia.org/wiki/Acidity_regulator
1,6-Hexanediol1,6-Hexanediol
Laboratory preparation could be achieved by reduction of adipates with lithium aluminium hydride, although this method is ...
https://en.wikipedia.org/wiki/1,6-Hexanediol
PlasticizerPlasticizer
An example is: Bis(2-ethylhexyl)adipate (DEHA, dioctyl adipate plasticizer) Sebacate- based plasticizers provide excellent ... The wide variety of ester chemistries that are in production include sebacates, adipates, terephthalates, dibenzoates, ... Adipate-based plasticizers are used for low-temperature or resistance to ultraviolet light. ...
https://en.wikipedia.org/wiki/Plasticizer
BioplasticBioplastic
... polybutylene adipate-co-terephthalate produced by BASF) blends. These blends are used for industrial applications and are also ... such as succinates and adipates, have obtained these certificates. Additive-based bioplastics sold as photodegradable or Oxo ...
https://en.wikipedia.org/wiki/Bioplastic
ObesogenObesogen
... adipate". Reprod. Toxicol. 19 (4): 505-515. doi:10.1016/j.reprotox.2004.11.005. PMID 15749265. Braga-Basaria M, Dobs AS, Muller ...
https://en.wikipedia.org/wiki/Obesogen
Diesel exhaustDiesel exhaust
... adipate". Reproductive Toxicology (Elmsford, N.Y.). 19 (4): 505-515. doi:10.1016/j.reprotox.2004.11.005. ISSN 0890-6238. PMID ...
https://en.wikipedia.org/wiki/Diesel_exhaust
Electrolytic capacitorElectrolytic capacitor
Effect of Heat-Treatment on Characteristics of Anodized Aluminum Oxide Formed in Ammonium Adipate Solution [1] DOI: 10.1149/ ...
https://en.wikipedia.org/wiki/Electrolytic_capacitor
Ham sausageHam sausage
"GC/MS Method for the Determination of Adipate Plasticizers in Ham Sausage and Its Application to Kinetic and Penetration ...
https://en.wikipedia.org/wiki/Ham_sausage
PiperazinePiperazine
... hydrate, piperazine adipate and piperazine citrate (used to treat ascariasis and enterobiasis) are the most common ... and the adipate, C4H10N2.C6H10O4 (containing 1 molecule each of piperazine and adipic acid). Piperazine is formed as a co- ...
https://en.wikipedia.org/wiki/Piperazine
MoesziomycesMoesziomyces
2018). Enzymatic degradation of poly-butylene succinate-co-adipate film in rice husks by yeast Pseudozyma antarctica in indoor ...
https://en.wikipedia.org/wiki/Moesziomyces
Aluminum electrolytic capacitorAluminum electrolytic capacitor
Effect of Heat-Treatment on Characteristics of Anodized Aluminum Oxide Formed in Ammonium Adipate Solution [1] DOI: 10.1149/ ...
https://en.wikipedia.org/wiki/Aluminum_electrolytic_capacitor
Polymer capacitorPolymer capacitor
Effect of Heat-Treatment on Characteristics of Anodized Aluminum Oxide Formed in Ammonium Adipate Solution [2] doi:10.1149/ ...
https://en.wikipedia.org/wiki/Polymer_capacitor
Polyvinyl nitratePolyvinyl nitrate
... the binder needs a plasticizer like dioctyl adipate (DOP) or 2-nitro-diphenylamine (2-NDPA) to make the explosive more flexible ...
https://en.wikipedia.org/wiki/Polyvinyl_nitrate
Polybutylene succinatePolybutylene succinate
... butylene succinate-co-adipate)and poly(butylene terephthalate-co-adipate) as drug encapsulation systems". Colloids and Surfaces ...
https://en.wikipedia.org/wiki/Polybutylene_succinate
LysineLysine
"A prokaryotic gene cluster involved in synthesis of lysine through the amino adipate pathway: a key to the evolution of amino ...
https://en.wikipedia.org/wiki/Lysine
PlasticPlastic
Bis(2-ethylhexyl) adipate, present in plastic wrap based on PVC, is also of concern, as are the volatile organic compounds ... For example, plasticizers like adipates and phthalates are often added to brittle plastics like PVC to make them pliable enough ...
https://en.wikipedia.org/wiki/Plastic
di-(2-Methoxybutyl)adipatedi-(2-Methoxybutyl)adipate
The National Institute of Standards and Technology (NIST) uses its best efforts to deliver a high quality copy of the Database and to verify that the data contained therein have been selected on the basis of sound scientific judgment. However, NIST makes no warranties to that effect, and NIST shall not be liable for any damage that may result from errors or omissions in the Database ...
https://webbook.nist.gov/cgi/inchi?ID=R542119&Units=CAL
EWG Tap Water Database | Marion Oaks Subdivision | Di(2-ethylhexyl) adipateEWG Tap Water Database | Marion Oaks Subdivision | Di(2-ethylhexyl) adipate
... adipate. Find out what is in your tap water ... adipate results for Marion Oaks Subdivision , Di(2-ethylhexyl) ... Di(2-ethylhexyl) adipate. Marion Oaks Subdivision. Di(2-ethylhexyl) adipate is used in PVC plastic, plastic wrap and other ... The EWG Health Guideline of 200 ppb for di(2-ethylhexyl) adipate was defined by the California Office of Environmental Health ... The legal limit for di(2-ethylhexyl) adipate, established in 1992, was based on a toxicity study in laboratory animals ...
https://www.ewg.org/tapwater/system-contaminant.php?contamcode=2035&pws=FL6421144?contamcode=2035&pws=FL6421144
China Diisopropyl adipate 6938-94-9 Supplier, Jiangsu Blossom Bio-chemical Co., Ltd - ChemNet
Jiangsu Blossom Bio-chemical Co., Ltd is China manufacturers & exporters of Diisopropyl adipate 6938-94-9.
https://chemnet.com/ChinaSuppliers/53423/selling-leads--5.html
BIS(2-ETHYLHEXYL)ADIPATE (ADIPATE-13C6) SOLUTION 100UG/ML IN N-NONANE 1.2ML CAS#BIS(2-ETHYLHEXYL)ADIPATE (ADIPATE-13C6) SOLUTION 100UG/ML IN N-NONANE 1.2ML CAS#
ADIPATE (ADIPATE-13C6) SOLUTION 100UG/ML IN N-NONANE 1.2ML Boiling point Melting point,BIS(2-ETHYLHEXYL)ADIPATE (ADIPATE-13C6) ... SOLUTION 100UG/ML IN N-NONANE 1.2ML Density MSDS Formula Use,If You also need to BIS(2-ETHYLHEXYL)ADIPATE (ADIPATE-13C6) ... BIS(2-ETHYLHEXYL)ADIPATE (ADIPATE-13C6) SOLUTION 100UG/ML IN N-NONANE 1.2ML Preparation Products And Raw materials. ... BIS(2-ETHYLHEXYL)ADIPATE (ADIPATE-13C6) SOLUTION 100UG/ML IN N-NONANE 1.2ML Suppliers list ...
https://www.chemicalbook.com/ProductChemicalPropertiesCB3582125_EN.htm
en en
Dimethyl Adipate has a number of cosmetic applications in emollients and skin conditioning. ... Di-Isopropyl Adipate # Cosmetics / Specialties WHAT IS DIISOPROPYL ADIPATE? Diisopropyl Adipate (AKA DIPA) is one of SEQENS ... Dimethyl Adipate Dimethyl Adipate, also known as DMA, is one of the chemical products on offer here at SEQENS Custom ... WHAT IS DIMETHYL ADIPATE?. Dimethyl Adipate is a low toxicity, low odour, non VOC, readily biodegradable solvent that can be ...
https://www.seqens.com/en/products/dimethyl-adipate/
UK, France, Germany Dibutyl Adipate Market Trends Evolving Technology and Growth Outlook 2021 to 2026UK, France, Germany Dibutyl Adipate Market Trends Evolving Technology and Growth Outlook 2021 to 2026
Dibutyl Adipate Market Size, Analysis By Application, Regional Analysis(Europe, Asia Pacific, America, Middle East And Africa ... Figure Dibutyl Adipate Industry Chain Structure. 1.1.1 Overview. 1.1.2 Development of Dibutyl Adipate. 1.2 Market Segment. 1.2. ... Figure Dibutyl Adipate Demand in Resins, 2016-2020, in Volume. 6.1.2 Demand in Coatings. Figure Dibutyl Adipate Demand in ... Figure Dibutyl Adipate Demand in Coatings, 2016-2020, in Volume. 6.1.3 Demand in Cosmetics. Figure Dibutyl Adipate Demand in ...
https://www.marketresearchupdate.com/industry-growth/dibutyl-adipate-industry-174371
Registration Dossier - ECHARegistration Dossier - ECHA
Information on Registered Substances comes from registration dossiers which have been assigned a registration number. The assignment of a registration number does however not guarantee that the information in the dossier is correct or that the dossier is compliant with Regulation (EC) No 1907/2006 (the REACH Regulation). This information has not been reviewed or verified by the Agency or any other authority. The content is subject to change without prior notice ...
https://echa.europa.eu/registration-dossier/-/registered-dossier/10353/7/6/4
Diethyl adipate analytical standard 141-28-6Diethyl adipate analytical standard 141-28-6
Diethyl adipate analytical standard; CAS Number: 141-28-6; EC Number: 205-477-0; Synonyms: Hexanedioic acid 1,6-diethyl ester, ...
https://www.sigmaaldrich.cn/CN/en/product/sial/42697
Dioctyl Adipate, (DOA)
Dioctyl adipate is also used in paints as a way to disperse pigments. For applications involving food, dioctyl adipate can be ... Dioctyl adipate (DOA) is a PVC plasticizer that is also commonly used with primary plasticizers, like DOP, to create lubricant ...
https://beredchem.com/dioctyl-adipate-doa/
Diethyl Adipate - CRM LABSTANDARDDiethyl Adipate - CRM LABSTANDARD
CAS Number: 141-28-6 MW (g/mol): 202.25 Beilstein: 1780035 CE Number: 205-477-0 MDL Number: MFCD00009215 ID PubChem: 8844 IUPAC Name diethyl hexanedioate Li
https://www.crmlabstandard.com/en/shop/labstandard/single-component/rm-en/141-28-6-diethyl-adipate-rm/
Chem Di Isopropyl Adipate | CheminformaticsChem Di Isopropyl Adipate | Cheminformatics
1 - Di IsoPropyl Adipate 2 - Di IsoPropyl Adipate ,spacefillAdipate. Molweight. 230.303. Monoisotopic Mass. 230.15181. Clogp. 2.6292. Clogs. -2.626. H Acceptors. 4. Total ... Chemical Name - Di IsoPropyl Adipate. Mol Weight - 230.303. Smiles - CC(C)OC(CCCCC(OC(C)C)=O)=O ...
https://www.chemryt.com/chem-di-isopropyl-adipate.php
Dioctyl Adipate - Chemical and Filtration Products of TexasDioctyl Adipate - Chemical and Filtration Products of Texas
Dioctyl Adipate (DOA) is a typical, cold-resistant plasticize for polyvinyl chloride, chloroethylene co-polymer, polystyrene, ... Dioctyl Adipate Dioctyl Adipate (DOA) is a typical, cold-resistant plasticize for polyvinyl chloride, chloroethylene co-polymer ...
https://texas-chem.com/dioctyl-adipate
Registration Dossier - ECHARegistration Dossier - ECHA
... adipate CAS 103-23-1 and Bis(tridecyl) adipate CAS 16958-92-2) to "water soluble" members (i.e. Dibutyl adipate CAS 105-99-7). ... Dibutyl adipate and CAS 6938-94-9, Diisopropyl adipate) to aquatic organisms. Nevertheless, the absence of chronic or long-term ... adipate; CAS 33703-08-1 Diisononyl adipate and CAS 103-24-2 Bis(2-ethylhexyl) azelate). These substances exhibit log Kow values ...
https://echa.europa.eu/registration-dossier/-/registered-dossier/5376/6/4/1
Jual Agro kimia - Dioktyl Adipate Tangerang | Mitra Tsalasa JayaJual Agro kimia - Dioktyl Adipate Tangerang | Mitra Tsalasa Jaya
Dioktyl Adipate dengan harga Rp 49300,00 dari Mitra Tsalasa Jaya ... Kami Menjual Dioctyl Adipate untuk Wilayah Medan, Bali, Bandung ...
http://www.jualbahankimia.net/product/dioktyl-adipate-p251745.aspx
Di-n-octyl adipate | C22H42O4 | 685594 | 123-79-5Di-n-octyl adipate | C22H42O4 | 685594 | 123-79-5
Di-n-octyl adipate , Buy from the Brand Leader in Analytical Reference Standards! Made in Germany! Contact: +49 (0) 34291 ...
https://www.hpc-standards.com/shop/ReferenceMaterials/PolymerAdditives/1574758589_Dinoctyladipate.htm
Tongxiang Chemical Co.,Ltd.--Di-2-ethylhexyl adipate (DOA)
main products: Epoxidized soybean oil (ESO);Butyl ester of epoxy fatty acids(EBST);Di-2-ethylhexyl adipate (DOA);Di-2- ... Di-2-ethylhexyl adipate (DOA). Scientific Name: bis-(2-ethylhexyl)hexanedioate. Molecular formula: C22H42O4. Molecular weight: ...
http://www.halogrowbox.com/pro_detail_en/id/3.html
Registration Dossier - ECHARegistration Dossier - ECHA
Information on Registered Substances comes from registration dossiers which have been assigned a registration number. The assignment of a registration number does however not guarantee that the information in the dossier is correct or that the dossier is compliant with Regulation (EC) No 1907/2006 (the REACH Regulation). This information has not been reviewed or verified by the Agency or any other authority. The content is subject to change without prior notice ...
https://www.echa.europa.eu/web/guest/registration-dossier/-/registered-dossier/16083/5/2/3
IMSEAR at SEARO: Piperazine adipate in tropical eosinophilia--a preliminary study.
Piperazine adipate in tropical eosinophilia--a preliminary study.. Authors: Vaidya, A B. Ambani, L M. Karandikar, P V. Sheth, U ... Piperazine adipate in tropical eosinophilia--a preliminary study. Indian Journal of Medical Sciences. 1971 Oct; 25(10): 684-9. ...
https://imsear.searo.who.int/handle/123456789/69470
AIR WICK® Scented Oil - Ocean Breeze (Discontinued)AIR WICK® Scented Oil - Ocean Breeze (Discontinued)
Dimethyl Adipate Fragrance Component: A component of a fragrance oil.. CAS #: 627-93-0. ...
http://rbnainfo.com/product.php?productLineId=2310
Category:Adipic acid - Wikimedia CommonsCategory:Adipic acid - Wikimedia Commons
Adipate; E 356; E 357; Kaliumadipat; Adipato; ادیپیک اسید; ヘキサン二酸; Asam heksanadioat; kwas heksanodiowy; kwas 1,6-heksanodiowy ...
https://commons.wikimedia.org/wiki/Category:Adipic_acid
List of countries for products that contain the ingredient fr:diisopropyl-adipate - WorldList of countries for products that contain the ingredient fr:diisopropyl-adipate - World
IRS issues Superfund chemical excise tax rates | Internal Revenue ServiceIRS issues Superfund chemical excise tax rates | Internal Revenue Service
di-n-hexyl adipate. $ 8.23. diphenyl oxide. $ 13.73. diphenylamine. $ 10.28. epichlorohydrin. $ 12.89. ...
https://www.irs.gov/newsroom/irs-issues-superfund-chemical-excise-tax-rates
food grade plastic plasticizer dioctyl adipate doa in myanmars
... dioctyl adipate is a primary plasticizer resulting from the esterification of 2-Ethyl Hexanol with Adipic Acid, it is the most ... important in the adipate group, it offers a high efficiency, better flexibility properties at low temperatures and resistance ... food grade plastic plasticizer dioctyl adipate doa in myanmar, (PLASTICIZERS) Plasticizers - DOA,DOA, ... Dioctyl adipate with Fast Delivery. Dioctyl adipate (DOA) is an organic compound with the formula (CH 2 CH 2 CO 2 C 8 H 17) 2. ...
http://www.modst.nl/cvghf/21/food-grade-plastic-plasticizer-dioctyl-adipate-doa-in-myanmars/
DailyMed - PASSION AND BEYOND VERBENA ANTI-PERSPIRANT ROLL-ON DEODORANT- aluminum chlorohydrate gelDailyMed - PASSION AND BEYOND VERBENA ANTI-PERSPIRANT ROLL-ON DEODORANT- aluminum chlorohydrate gel
WATER, STEARETH-2, PPG-15 STEARYL ETHER, DICAPRYL ADIPATE, STEARETH-20, FRAGRANCE, ISOPROPYL PALMITATE ...
https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=c95ef967-be0f-3f8c-e053-2995a90ab851
Dimethyl adipate (DMA)|Diethyl adipate (DEA)|Diisopropyl Adipate (DIPA)|Di-n-hexyl adipate(DHA)--Weifang Bincheng Chemical Co.,...
Diethyl adipate (DEA),Diisopropyl Adipate (DIPA),Di-n-hexyl adipate(DHA)--Weifang Bincheng Chemical Co., Ltd. ...
http://www.wamtg.com/product_detail_en/id/15.html
Substance Priority List | ATSDRSubstance Priority List | ATSDR
BIS(2-ETHYLHEXYL)ADIPATE. 544. 103-23-1. 275. CARBAZOLE. 544. 86-74-8. ...
https://www.atsdr.cdc.gov/spl/index.html
Di methyl adipate (DMA)|Diethyl adipate (DEA)|Di isopropyl Adipate (DIPA)|Di-n-hexyl adipate(DHA)--Weifang Bincheng Chemical Co...
Diethyl adipate (DEA),Di isopropyl Adipate (DIPA),Di-n-hexyl adipate(DHA) ...
http://www.jingyuapp.com/cgi/search-en.cgi?f=enquiry_en+company_en_1_+contact_en&t=enquiry_en
Di methyl adipate (DMA)|Diethyl adipate (DEA)|Di isopropyl Adipate (DIPA)|Di-n-hexyl adipate(DHA)--Weifang Bincheng Chemical Co...
Diethyl adipate (DEA),Di isopropyl Adipate (DIPA),Di-n-hexyl adipate(DHA) ... We are the largest domestic manufacturer and seller of dimethyl adipate, with an annual sales volume of dimethyl adipate ... We also produce and sell diethyl adipate, diisopropyl adipate, diethyl sebacate. We can develop various new products all by ...
http://m.kabulexpresshalal.com/cgi/search-en.cgi?f=introduction_en_1_+company_en_1_&t=introduction_en_1_
Antifungal films from trans-cinnamaldehyde incorporated poly(lactic acid) and poly(butylene adipate-co-terephthalate) for bread...Antifungal films from trans-cinnamaldehyde incorporated poly(lactic acid) and poly(butylene adipate-co-terephthalate) for bread...
Antifungal films from trans-cinnamaldehyde incorporated poly(lactic acid) and poly(butylene adipate-co-terephthalate) for bread ... Antifungal bioplastic films were developed based on poly(lactic acid) (PLA) and poly(butylene adipate-co-terephthalate) (PBAT) ... Antifungal films from trans-cinnamaldehyde incorporated poly(lactic acid) and poly(butylene adipate-co-terephthalate) for bread ...
http://olmdiagnostics.com/2020/07/20/antifungal-films-from-trans-cinnamaldehyde-incorporated-polylactic-acid-and-polybutylene-adipate-co-terephthalate-for-bread-packaging/
PlasticizerDioctylDibutylDiethyl AdipateTerephthalatePolyChemicalHydrogenProductsIngredientsToxicityApplicationsAssessmentAcidStudyAnnualSalesGiveDiisopropylPlasticizersPhthalatePolybutylene adipate terephthalateCOPOLYMERFragranceGlutaratePiperazine AdipateTEREPHTHALATEDioctyl sebacateDiethylhexylPBATDibutyl adipate marketPhthalatesAquaEsterLight coloredAdipicSuppliersGlycolACID
Plasticizer8
  • In Cosmetics, Dimethyl Adipate can be used as an emollient to give a soft feel to the skin, a solvent to dissolve other ingredients, or as a plasticizer to help disperse other ingredients. (seqens.com)
  • Dioctyl adipate (DOA) is a PVC plasticizer that is also commonly used with primary plasticizers, like DOP, to create lubricant basetocks. (beredchem.com)
  • For applications involving food, dioctyl adipate can be used as a plasticizer in food contact polymers and rubbers. (beredchem.com)
  • DOA, dioctyl adipate is a primary plasticizer resulting from the esterification of 2-Ethyl Hexanol with Adipic Acid, it is the most important in the adipate group, it offers a high efficiency, better flexibility properties at low temperatures and resistance to the loss of color by exposure to heat and ultraviolet light. (modst.nl)
  • Diocty Adipate (DOA) is an excellent cold-resistant plasticizer,it has plasticized high efficiency,low volatility,When using as paste it has low initial viscosity,good viscosity stability, many countries allow this plasticizer to be used as food packing material such as USA, France, Italy ,Japan,Holland etc. (modst.nl)
  • DOA Plasticizer - Kosher DOA plasticizer (Bis (2-Ethylhexyl) Adipate), Kosher is a light colored, oily liquid generally used as a plasticizer for PVC. (modst.nl)
  • DOA, dioctyl adipate is a primary plasticizer resulting from the esterification of 2- Ethyl Hexanol with Adipic Acid, it is the most important in the adipate group. (modst.nl)
  • Di(2-ethylhexyl)adipate is a plasticizer used to give flexibility to vinyl plastics. (nih.gov)
Dioctyl5
  • Dioctyl adipate is also used in paints as a way to disperse pigments. (beredchem.com)
  • Dioctyl Adipate (DOA) is a typical, cold-resistant plasticize for polyvinyl chloride, chloroethylene co-polymer, polystyrene, nitrocellulose, ethyl cellulose and synthetic rubber. (texas-chem.com)
  • Offering you a complete choice of products which include basf hexamoll dinch plasticizers, dioctyl phthalate dop, dibutyl phthalate, dioctyl adipate, chlorinated paraffin wax and epoxidized soybean oil. (modst.nl)
  • Dioctyl adipate (DOA) is an organic compound with the formula (CH 2 CH 2 CO 2 C 8 H 17) 2.It is a colorless oily liquid. (modst.nl)
  • Dioctyl Adipate: Results of Fall 1982 Sampling with Cover Letter dated 10-22-1984. (epa.gov)
Dibutyl12
  • Dibutyl Adipate Market Size, Analysis By Application, Regional Analysis(Europe, Asia Pacific, America, Middle East And Africa), And Forecasts 2021-2026 (Special Offer 30% Discount! (marketresearchupdate.com)
  • A new research report on the Global Dibutyl Adipate Market titled has recently published by Market Research Update to its humongous database which helps to shape the future of the businesses by making well-informed business decisions. (marketresearchupdate.com)
  • The forecast period 2021-2026 is expected to be great for the Dibutyl Adipate market which will be the face changer for the Chemical & Material industry. (marketresearchupdate.com)
  • The report moreover comprises of the market drivers and limitations which may be gotten from a SWOT assessment of the Dibutyl Adipate market. (marketresearchupdate.com)
  • Top players and types are taking actions alongside inclinations, stock dispatches, acquisitions, consolidations, joint endeavors, and forceful research inside the Dibutyl Adipate market. (marketresearchupdate.com)
  • The cost investigation of the Dibutyl Adipate Market has been performed while keeping in view work cost, producing costs, and crude materials and their market fixation rate, providers, and value pattern. (marketresearchupdate.com)
  • The report conveys the entirety of current realities about market definition, orders, applications, and commitment for the Dibutyl Adipate market that are basic to be victorious inside the market. (marketresearchupdate.com)
  • The principle motivation behind this report is to give a development map with respect to the activities taken by central participants of the Dibutyl Adipate market like item dispatches, joint endeavors, propensities, consolidations, and acquisitions which is influencing the Dibutyl Adipate market and Chemical & Material undertaking in general and furthermore influencing the business, import, fare, income and CAGR values. (marketresearchupdate.com)
  • What are the major challenges in front of the global Dibutyl Adipate market? (marketresearchupdate.com)
  • Who are the key vendors of the global Dibutyl Adipate market? (marketresearchupdate.com)
  • What are the leading key industries of the global Dibutyl Adipate market? (marketresearchupdate.com)
  • Which factors are responsible for driving the global Dibutyl Adipate market? (marketresearchupdate.com)
Diethyl Adipate1
Terephthalate10
  • Antifungal films from trans-cinnamaldehyde incorporated poly(lactic acid) and poly(butylene adipate-co-terephthalate) for bread packaging. (olmdiagnostics.com)
  • Antifungal bioplastic films were developed based on poly(lactic acid) (PLA) and poly(butylene adipate-co-terephthalate) (PBAT) blends as PLA60/PBAT40 (PLA/PBAT) and PBAT60/PLA40 (PBAT/PLA) with incorporated trans-cinnamaldehyde using cast-extrusion. (olmdiagnostics.com)
  • Polylactide/poly(butylene adipate terephthalate) blends 20. (bokkilden.no)
  • This research report is a meticulous assessment of the poly (butylene adipate-co-terephthalate) industry, which contains a complete overview. (marketresearchstore.com)
  • With respect to distinct regions and leading countries, this research clarifies products and applications of poly (butylene adipate-co-terephthalate) in various market verticals. (marketresearchstore.com)
  • Furthermore, the study assesses and compares all of the top players in the global poly (butylene adipate-co-terephthalate) market based on several parameters such as market revenue, yearly sales volume, historical growth rate, and company strategies. (marketresearchstore.com)
  • The global poly (butylene adipate-co-terephthalate) industry study report presents a strategic plan to enhance market circumstances for existing industry participants based on all of these conclusions. (marketresearchstore.com)
  • This poly (butylene adipate-co-terephthalate) evaluation assists users in analyzing the market using a variety of metrics, including switching costs, economies of scale, current sales network, brand loyalty, capital investment, product rights and patents, regulatory legislation, promotional effects, and customers. (marketresearchstore.com)
  • On the basis of Products, the global Poly (Butylene Adipate-Co-Terephthalate) market is segmented into Industrial Grade, Food Grade. (marketresearchstore.com)
  • Mulches evaluated were black, 20-40 µm thick, suitable for annual vegetable production, and included three BDMs: two polybutylene adipate terephthalate (PBAT)-enriched mulches that are commercially available in North America, an experimental polylactic acid (PLA) and polyhydroxyalkanote-based film, and a conventional polyethylene mulch as a control. (ashs.org)
Poly1
  • Polylactide/poly[(butylene succinate)-co-adipate] blends 18. (bokkilden.no)
Chemical3
  • Dimethyl Adipate, also known as DMA, is one of the chemical products on offer here at SEQENS Custom Specialties. (seqens.com)
  • Di(2-ethylhexyl) adipate DOA of Mitsubishi Chemical Corporation.Mitsubishi Chemical Corporation was established by integrating former Mitsubishi Chemical, Mitsubishi Plastics and Mitsubishi Rayon. (modst.nl)
  • Di-n-hexyl adipate(DHA)--Weifang Bincheng Chemical Co., Ltd. (wamtg.com)
Hydrogen1
  • The main degradation products produced during the heat cutting and heat sealing included di-2-ethyl-hexyl- adipate (103231), diisooctyl-adipate (1330865), and hydrogen - chloride (7647010) (HCl). (cdc.gov)
Products2
  • Di(2-ethylhexyl) adipate is used in PVC plastic, plastic wrap and other consumer products. (ewg.org)
  • Dimethyl Adipate is a colourless liquid used in a lot of cosmetic products. (seqens.com)
Ingredients1
  • Dimethyl adipate is used in agrochemicals as a raw material in the manufacture of several active ingredients such as Lenacil, Metconazole, Ipconazole. (seqens.com)
Toxicity2
  • The legal limit for di(2-ethylhexyl) adipate, established in 1992, was based on a toxicity study in laboratory animals conducted in the 1980s. (ewg.org)
  • Dimethyl Adipate is a low toxicity, low odour, non VOC, readily biodegradable solvent that can be used in a variety of applications including agrochemicals, polymer intermediates, screening creams and lotions. (seqens.com)
Applications1
  • 13] K. Arshak, E.G. Moore, and C. Cunniffe, "Surfactant treated drop-coated polyethylene adipate carbon black nanocomposite sensor for alcohol vapour detection," Proceedings of the 2006 IEEE on Sensors Applications Symposium, 2006. (ijettjournal.org)
Assessment1
  • The EWG Health Guideline of 200 ppb for di(2-ethylhexyl) adipate was defined by the California Office of Environmental Health Hazard Assessment as a public health goal, the level of a drinking water contaminant that does not pose a significant health risk. (ewg.org)
Acid1
  • Acetylated distarch adipate -E1422-, is a starch that is treated with acetic anhydride and adipic acid anhydride to resist high temperatures. (openfoodfacts.org)
Study1
  • IMSEAR at SEARO: Piperazine adipate in tropical eosinophilia--a preliminary study. (who.int)
Annual1
  • We are the largest domestic manufacturer and seller of dimethyl adipate, with an annual sales volume of dimethyl adipate reaching 2,500 tons. (kabulexpresshalal.com)
Sales1
  • Bajo este epígrafe se incluye una amplia variedad de ácidos, sales, ésteres y amidas que contienen una estructura alifática con grupos carboxilo terminales en 1,6. (bvsalud.org)
Give1
  • Solcremen har et højt indhold af økologiske ingredienser, såsom agurkekstrakt, rapsolie, kamille og aloe vera, der bidrager til at give en lindrende, beroligende og kølende effekt samt beroliger og plejer huden. (webapoteket.dk)
Diisopropyl1
  • It was used in the polymerization of 1,1′-(1,3-phenylene) diethanol (1,3-diol) and diisopropyl adipate. (sigmaaldrich.com)
Plasticizers3
  • Jayflex™ adipate plasticizers can be used as a primary plasticizer but, more typically, are used in blends with general-purpose phthalates to improve low-temperature properties. (modst.nl)
  • As part of its global production network, BASF offers a broad portfolio of plasticizers, including general-purpose plasticizers, and specialty plasticizers, such as adipates, polymerics, and trimellitates. (webwire.com)
  • PLASTICIZERS: DOA DOA, dioctyl adipate is a primary plasticizer resulting from the esterification of 2-Ethyl Hexanol with Adipic Acid, it is the most important in the adipate group, it offers a high efficiency, better flexibility properties at low temperatures and resistance to the loss of color by exposure to heat and ultraviolet light. (nijmegen-nieuws.nl)
Phthalate3
  • DOA - Dioctyl Adipate plasticizer for PVC reveals favourable lubricating action when processed and is often added with phthalate to make cold resistance agricultural film, cable clad, artificial leather, outdoor water tube, packaging film for frozen food and so on. (modst.nl)
  • For TRI96, EPA has delisted two chemicals, diethyl phthalate and bis(2-ethylhexyl) adipate, also known as di-(2-ethylhexyl) adipate. (nih.gov)
  • 2002) ethyl paraben agent butyl paraben bis(2-ethylhexyl) adipate bis(2-ethyhexyl) phthalate benzylbutyl phthalate endocrine disruption (Hannas et al. (cdc.gov)
Polybutylene adipate terephthalate3
  • Now a study from ETH Zürich, Switzerland, has shown for the first time that soil microbes can use films made from the plastic polybutylene adipate terephthalate (PBAT) as food. (basf.com)
  • Here, we propose a design strategy to fabricate compatible nano-blends by manipulating the reactions between two biodegradable polymers, e.g. polybutylene succinate (PBS) and polybutylene adipate terephthalate (PBAT), with extremely low free radical contents through reactive extrusion processing. (rsc.org)
  • BioLogiQ, Inc., says that recent test results show its NuPlastiQ MB BioPolymer, produced by blending NuPlastiQ GP with PBAT (polybutylene adipate terephthalate), is marine biodegradable. (flexpackmag.com)
COPOLYMER1
  • Dioctyl adipate (DOA) is a typical cold resisting plasticizer for vinyl chloride polymer and its copolymer, polystyrene,cellulosic resins and synthetic rubbers. (mindfulbewust.be)
Fragrance1
Glutarate1
  • DuPont] A brand name for a mixture of dimethyl glutarate, dimethyl succinate, and dimethyl adipate. (mfa.org)
Piperazine Adipate2
  • Our offered Piperazine Adipate Powder is tested on various quality parameters and can be availed at highly competitive price by us. (adanipharmachem.com)
  • 250 mg." and "Fort Dodge Piperate Piperazine Adipate Active ingredient: Piperazine Adipate, 100? (nih.gov)
TEREPHTHALATE1
  • Poly(butylene adipate-co-terephthalate) (PBAT)/HPDA with well dispersed HPDA nanoparticles were prepared through solution coagulation. (polymer.cn)
Dioctyl sebacate2
  • United States military Composition C-4 explosive contains 91% cyclotrimethylene trinitramine (RDX), 5.3% dioctyl sebacate or adipate (DOS or DOA), 2.1% polyisobutylene (PIB), and 1.6% oil. (astm.org)
  • The most commonly used varieties are dioctyl adipate and dioctyl sebacate. (dierzoektmaatje.nl)
Diethylhexyl1
  • The Chemical Company's (TCC) ChemFlexx DOA (Diethylhexyl adipate or DOA) is a plasticizer with a wide range of applications. (mindfulbewust.be)
PBAT1
  • ecovio ® M 2351 from BASF is a certified (EN 17033) soil-biodegradable plastic for mulch films, consisting of the biodegradable copolyester ecoflex ® (PBAT) and other biodegradable polymers made from renewable raw materials. (basf.com)
Dibutyl adipate market4
  • The Dibutyl Adipate Market 2021 research report gives emerging industry data, global segments and regional outlook. (articlepedia.xyz)
  • The entire dibutyl adipate market has been sub-categorized into type and application. (articlepedia.xyz)
  • This section covers regional segmentation which accentuates on current and future demand for dibutyl adipate market across North America, Europe, Asia-Pacific, Latin America, and Middle East & Africa. (articlepedia.xyz)
  • The Dibutyl Adipate Market Report offers a complete picture of industry trends and factors along with quantitative information dependent on historical data and from various sources. (thewyco.com)
Phthalates2
  • According to the anonymous insider, EMSD is also looking into harmful substances called phthalates and adipates that are found in LPG. (chinadaily.com.cn)
  • 9. Determination of phthalates and adipate in bottled water by headspace solid-phase microextraction and gas chromatography/mass spectrometry. (nih.gov)
Aqua1
  • DYE CREAM INGREDIENTS: Aqua, Cetearyl Alcohol, 2-Chloro-p-Phenylenediamine, Bis-Diglyceryl-Polyacyl-Adipate-2, PEG-40 Hydrogenated Castor Oil, Sodium Cetearyl Sulfate, Sodium Laureth Sulfate. (superdrug.com)
Ester2
  • Admex™ 6995 is a medium molecular weight, light colored, polymeric adipate with a mild ester odor. (eastman.com)
  • Dioctyl adipate (DOA) is an ester of 2-ethylhexanol and adipic acid with the formula C22H42O4 which is a plasticizer used in polyvinyl chloride. (gec.com.tr)
Light colored2
  • Dioctyl Adipate Also known as DOA, is a light colored, oily liquid. (modst.nl)
  • DOA (Bis(2-Ethylhexyl) Adipate) is a light colored, oily liquid generally used as a plasticizer for PVC. (modst.nl)
Adipic1
  • Dioctyl adipate (DOA) DOA is a diester of adipic acid and two equivalents of n-octanol. (modst.nl)
Suppliers5
  • We're well-known as one of the leading Dioctyl Adipate DOA Plasticizer manufacturers and suppliers in China for our quality products and good service. (modst.nl)
  • Di-Octyl Adipate Ask Price We have been able to mark its strong presence in the market as one of the most renowned manufacturers and suppliers of Di-Octyl Adipate. (modst.nl)
  • Get here the database of dioctyl adipate (cas no 123-79-5), dioctyl adipate manufacturers, dioctyl adipate suppliers and exporters. (modst.nl)
  • Qingdao Hisea Chem Co., Ltd. is Certified Dioctyl Adipate manufacturers and suppliers in China who can wholesale Certified Dioctyl Adipate . (hiseachem.com)
  • Get reasonable Dimethyl Adipate price from TNJ Chemical, top China Dimethyl Adipate price suppliers, factory & manufacturers. (tnjchem.com)
Glycol1
  • Many adipate glycol polyesters are FDA-compliant, which makes them a good option for urethane articles safe to use in food contact applications. (gantrade.com)
ACID1
  • Generation of acid, as measured by the acid number, demonstrates the significantly greater resistance to hydrolysis of MPO and NPG based adipate polyester polyols. (gantrade.com)
EWG rating for Sun Bum Sunscreen Lip Balm, Watermelon, SPF 30; | EWG's Guide to Sunscreens
EWG rating for Sun Bum Sunscreen Lip Balm, Watermelon, SPF 30; | EWG's Guide to Sunscreens (ewg.org)
AIR WICK® Scented Oil - Ocean Breeze (Discontinued)
AIR WICK® Scented Oil - Ocean Breeze (Discontinued) (rbnainfo.com)
Category:Adipic acid - Wikimedia Commons
Category:Adipic acid - Wikimedia Commons (commons.wikimedia.org)
Composition DUCRAY Melascreen UV - Crème légère - Toucher sec - SPF 50+ - UFC-Que Choisir
Composition DUCRAY Melascreen UV - Crème légère - Toucher sec - SPF 50+ - UFC-Que Choisir (quechoisir.org)
DailyMed - NATURALS VANILLA ANTI-PERSPIRANT DEODORANT- aluminum chlorohydrate gel
DailyMed - NATURALS VANILLA ANTI-PERSPIRANT DEODORANT- aluminum chlorohydrate gel (dailymed.nlm.nih.gov)
EWG Skin Deep® | Banila Co Clean It Zero Cleansing Balm, Purifying Rating
EWG Skin Deep® | Banila Co Clean It Zero Cleansing Balm, Purifying Rating (ewg.org)
Composition NIVEA Sun - UV visage Anti-brillance 30 haute - UFC-Que Choisir
Composition NIVEA Sun - UV visage Anti-brillance 30 haute - UFC-Que Choisir (quechoisir.org)
Composition NIVEA Sun protect et refresh fps 50 - Spray protecteur - UFC-Que Choisir
Composition NIVEA Sun protect et refresh fps 50 - Spray protecteur - UFC-Que Choisir (quechoisir.org)
Composition EUCERIN UreaRepair plus - Crème mains réparatrice 5% urea - UFC-Que Choisir
Composition EUCERIN UreaRepair plus - Crème mains réparatrice 5% urea - UFC-Que Choisir (quechoisir.org)
Composition NIVEA Nivea sun - Sensitive protection immédiate+ 50+ Très haute - UFC-Que Choisir
Composition NIVEA Nivea sun - Sensitive protection immédiate+ 50+ Très haute - UFC-Que Choisir (quechoisir.org)
Anti-Infectives - Rat Guide
Anti-Infectives - Rat Guide (ratguide.com)
Polymers | Free Full-Text | Plastic Degradation and Its Environmental Implications with Special Reference to Poly(ethylene...
Polymers | Free Full-Text | Plastic Degradation and Its Environmental Implications with Special Reference to Poly(ethylene... (mdpi.com)
5-Carboxypentanoate | C6H9O4 | ChemSpider
5-Carboxypentanoate | C6H9O4 | ChemSpider (chemspider.com)
Begriffe mit K | Medizin-Lexikon | gesundheit.de
Begriffe mit K | Medizin-Lexikon | gesundheit.de (gesundheit.de)
Plasticizers Market Size 2022 And Growth Analysis
Plasticizers Market Size 2022 And Growth Analysis (thebusinessresearchcompany.com)
Roche-posay Anthelios Invisible Spr.lsf 50+ Family 300 ml
Roche-posay Anthelios Invisible Spr.lsf 50+ Family 300 ml (apotheke.de)
Information on Organism Bos taurus - BRENDA Enzyme Database
Information on Organism Bos taurus - BRENDA Enzyme Database (brenda-enzymes.org)
Begriffe mit M | Medizin-Lexikon | gesundheit.de
Begriffe mit M | Medizin-Lexikon | gesundheit.de (gesundheit.de)
AUGEN- UND LIPPENPFLEGE ROUGE COCO BAUME Der getönte und feuchtigkeitsspendende Balsam, dessen Farbintensität sich ganz...
AUGEN- UND LIPPENPFLEGE ROUGE COCO BAUME Der getönte und feuchtigkeitsspendende Balsam, dessen Farbintensität sich ganz... (parfumdreams.de)
SC Johnson
SC Johnson (whatsinsidescjohnson.com)
Bräunungsspray Brume Lactée SPF 30 - 100 ml - PAYOT - PAYOT
Bräunungsspray Brume Lactée SPF 30 - 100 ml - PAYOT - PAYOT (payot.com)
CREME SOLAIRE SPF50 Clarins Men - Protection solaire homme
CREME SOLAIRE SPF50 Clarins Men - Protection solaire homme (comptoirdelhomme.com)
BIS(2-ETHYLHEXYL)ADIPATE (ADIPATE-13C6) SOLUTION 100UG/ML IN N-NONANE 1.2ML CAS#
BIS(2-ETHYLHEXYL)ADIPATE (ADIPATE-13C6) SOLUTION 100UG/ML IN N-NONANE 1.2ML CAS# (chemicalbook.com)
ÖKO-TEST Kompakt Sex - ÖKO-TEST
ÖKO-TEST Kompakt Sex - ÖKO-TEST (oekotest.de)
Nasza paleta : SC Johnson
Nasza paleta : SC Johnson (whatsinsidescjohnson.com)
Nuestra paleta : SC Johnson
Nuestra paleta : SC Johnson (whatsinsidescjohnson.com)