Derivatives of adipic acid. Included under this heading are a broad variety of acid forms, salts, esters, and amides that contain a 1,6-carboxy terminated aliphatic structure.
The collective designation of three organizations with common membership: the European Economic Community (Common Market), the European Coal and Steel Community, and the European Atomic Energy Community (Euratom). It was known as the European Community until 1994. It is primarily an economic union with the principal objectives of free movement of goods, capital, and labor. Professional services, social, medical and paramedical, are subsumed under labor. The constituent countries are Austria, Belgium, Denmark, Finland, France, Germany, Greece, Ireland, Italy, Luxembourg, Netherlands, Portugal, Spain, Sweden, and the United Kingdom. (The World Almanac and Book of Facts 1997, p842)
Any enterprise centered on the processing, assembly, production, or marketing of a line of products, services, commodities, or merchandise, in a particular field often named after its principal product. Examples include the automobile, fishing, music, publishing, insurance, and textile industries.
Customer satisfaction or dissatisfaction with a benefit or service received.
A group of compounds that has the general structure of a dicarboxylic acid-substituted benzene ring. The ortho-isomer is used in dye manufacture. (Dorland, 28th ed)
Materials incorporated mechanically in plastics (usually PVC) to increase flexibility, workability or distensibility; due to the non-chemical inclusion, plasticizers leach out from the plastic and are found in body fluids and the general environment.
An enzyme that catalyzes the oxidation of XANTHINE in the presence of NAD+ to form URIC ACID and NADH. It acts also on a variety of other purines and aldehydes.
An iron-molybdenum flavoprotein containing FLAVIN-ADENINE DINUCLEOTIDE that oxidizes hypoxanthine, some other purines and pterins, and aldehydes. Deficiency of the enzyme, an autosomal recessive trait, causes xanthinuria.
A method for diagnosing a disease in one organism by inoculating the putative causative organism in a second animal of a different species. It has been used for the detection of parasites (Trypanosoma cruzi and Trichinella spiralis) when peripheral blood smears are negative. (Segen, Current Med Talk, 1995)
A macrolide antibiotic produced by Streptomyces ambofaciens. The drug is effective against gram-positive aerobic pathogens, N. gonorrhoeae, and staphylococci. It is used to treat infections caused by bacteria and Toxoplasma gondii.
Activity involved in transfer of goods from producer to consumer or in the exchange of services.
Detailed account or statement or formal record of data resulting from empirical inquiry.
Organizations established by endowments with provision for future maintenance.
The application of nutritional principles to regulation of the diet and feeding persons or groups of persons.
An antibiotic complex produced by Streptomyces kitasatoensis. The complex consists of a mixture of at least eight biologically active components, A1 and A3 to A9. Leucomycins have both antibacterial and antimycoplasmal activities.
All-purpose surfactant, wetting agent, and solubilizer used in the drug, cosmetics, and food industries. It has also been used in laxatives and as cerumenolytics. It is usually administered as either the calcium, potassium, or sodium salt.
Contamination of bodies of water (such as LAKES; RIVERS; SEAS; and GROUNDWATER.)
Pesticides used to destroy unwanted vegetation, especially various types of weeds, grasses (POACEAE), and woody plants. Some plants develop HERBICIDE RESISTANCE.
Chemicals used to destroy pests of any sort. The concept includes fungicides (FUNGICIDES, INDUSTRIAL); INSECTICIDES; RODENTICIDES; etc.
Pesticides designed to control insects that are harmful to man. The insects may be directly harmful, as those acting as disease vectors, or indirectly harmful, as destroyers of crops, food products, or textile fabrics.
A plant genus of the family RANUNCULACEAE.
A di-isopropyl-fluorophosphate which is an irreversible cholinesterase inhibitor used to investigate the NERVOUS SYSTEM.
Adverse effect upon bodies of water (LAKES; RIVERS; seas; groundwater etc.) caused by CHEMICAL WATER POLLUTANTS.
Spherical particles of nanometer dimensions.
Organic, monobasic acids derived from hydrocarbons by the equivalent of oxidation of a methyl group to an alcohol, aldehyde, and then acid. Fatty acids are saturated and unsaturated (FATTY ACIDS, UNSATURATED). (Grant & Hackh's Chemical Dictionary, 5th ed)
A bibliographic database that includes MEDLINE as its primary subset. It is produced by the National Center for Biotechnology Information (NCBI), part of the NATIONAL LIBRARY OF MEDICINE. PubMed, which is searchable through NLM's Web site, also includes access to additional citations to selected life sciences journals not in MEDLINE, and links to other resources such as the full-text of articles at participating publishers' Web sites, NCBI's molecular biology databases, and PubMed Central.
A trihydroxy sugar alcohol that is an intermediate in carbohydrate and lipid metabolism. It is used as a solvent, emollient, pharmaceutical agent, and sweetening agent.
The functions, behavior, and activities of bacteria.
Lists of persons or organizations, systematically arranged, usually in alphabetic or classed order, giving address, affiliations, etc., for individuals, and giving address, officers, functions, and similar data for organizations. (ALA Glossary of Library and Information Science, 1983)
Agents that remove, correct, repress, or mask undesirable ODORS. In personal hygiene, deodorants often contain astringent preparations that reduce SWEATING, referred to as ANTIPERSPIRANTS. (From Grant & Hackh's Chemical Dictionary, 5th ed)
An ester of phthalic acid. It appears as a light-colored, odorless liquid and is used as a plasticizer for many resins and elastomers.
Uptake of substances through the SKIN.
Time period from 1901 through 2000 of the common era.
The aggregate business enterprise of agriculture, manufacture, and distribution related to tobacco and tobacco-derived products.

Dimethyl adipimidate: a new antisickling agent. (1/166)

A new approach to the prevention of sickling in vitro by use of the bifunctional crosslinking reagent, dimethyl adipimidate, is described. Prior treatment of sickle erythrocytes with dimethyl adipimidate will inhibit sickling in completely deoxygenated erythrocytes. Treated erythrocytes do not demonstrate the potassium loss and viscosity increase that usually accompany sickling. The oxygen affinity of hemoglobin in these cells is increased independently from changes in the concentration of 2,3-diphosphoglycerate. The hemoglobin obtained from treated erythrocytes contains a high-molecular-weight component as well as additional positively charged components. The relative degree to which chemical modification and/or crosslinking is an essential part of the antisickling properties of the material is not known.  (+info)

In vitro cytotoxicity of textile paint components linked to the "Ardystil syndrome". (2/166)

The spraying of a paint formula (Acramin F system) had led to severe pulmonary disease in textile printing sprayers in Spain and Algeria (Ardystil syndrome). In order to elucidate the underlying mechanisms of the toxicity of this paint and its main polymeric components, Acramin FWR, Acramin FWN, Acrafix FHN, and Acramoll W, we have undertaken studies using a battery of different cell-types and assessing in vitro cytotoxicity by measuring LDH leakage. This study shows that, as in in vivo studies, the three polycationic paint components, Acramin FWR (a polyurea), Acramin FWN (a polyamide-amine), and Acrafix FHN (a polyamine) exhibited considerable cytotoxicity (LC50 generally below 100 microg/ml for an incubation of 20-24 h) in vitro, while Acramoll W, which is not a polycation, was almost non-toxic (in the concentration range tested). The cytotoxicity was comparable in primary cultures of rat and human type II pneumocytes and alveolar macrophages as well as in the pulmonary cell line A549 and the hepatic cell line HepG2. In human erythrocytes, the toxicity was less pronounced. We speculate that the multiple positive charges play an important role in the toxic mechanism. It is concluded that Acramin FWR and Acramin FWN have similar intrinsic toxicity and that these polymeric compounds, which have no irritant properties or systemic toxicity when given orally, exert a high, unexpected, degree of cytotoxicity.  (+info)

Desulfovirga adipica gen. nov., sp. nov., an adipate-degrading, gram-negative, sulfate-reducing bacterium. (3/166)

A novel, mesophilic, Gram-negative bacterium was isolated from an anaerobic digestor for municipal wastewater. The bacterium degraded adipate in the presence of sulfate, sulfite, thiosulfate and elemental sulfur. (E)-2-Hexenedioate accumulated transiently in the degradation of adipate. (E)-2-Hexenedioate, (E)-3-hexenedioate, pyruvate, lactate, C1-C12 straight-chain fatty acids and C2-C10 straight-chain primary alcohols were also utilized as electron donors. 3-Phenylpropionate was oxidized to benzoate. The G + C content of the DNA was 60 mol%. 16S rDNA sequence analysis revealed that the new isolate clustered with species of the genus Syntrophobacter and Desulforhabdus amnigenus. Strain TsuAS1T resembles Desulforhabdus amnigenus DSM 10338T with respect to the ability to utilize acetate as an electron donor and the inability to utilize propionate without sulfate in co-culture with Methanospirillum hungatei DSM 864. Strains TsuAS1T and DSM 10338T form a 'non-syntrophic subcluster' within the genus Syntrophobacter. Desulfovirga adipica gen. nov., sp. nov. is proposed for the newly isolated bacterium, with strain TsuAS1T (= DSM 12016T) as the type strain.  (+info)

Characterization of a second tfd gene cluster for chlorophenol and chlorocatechol metabolism on plasmid pJP4 in Ralstonia eutropha JMP134(pJP4). (4/166)

Within the 5.9-kb DNA region between the tfdR and tfdK genes on the 2,4-dichlorophenoxyacetic acid (2,4-D) catabolic plasmid pJP4 from Ralstonia eutropha JMP134, we identified five open reading frames (ORFs) with significant homology to the genes for chlorocatechol and chlorophenol metabolism (tfdCDEF and tfdB) already present elsewhere on pJP4. The five ORFs were organized and assigned as follows: tfdD(II)C(II)E(II)F(II) and tfdB(II) (in short, the tfd(II) cluster), by analogy to tfdCDEF and tfdB (the tfd(I) cluster). Primer extension analysis of mRNA isolated from 2,4-D-grown R. eutropha JMP134 identified a single transcription start site in front of the first gene of the cluster, tfdD(II), suggesting an operon-like organization for the tfd(II) genes. By expressing each ORF in Escherichia coli, we confirmed that tfdD(II) coded for a chloromuconate cycloisomerase, tfdC(II) coded for a chlorocatechol 1, 2-dioxygenase, tfdE(II) coded for a dienelactone hydrolase, tfdF(II) coded for a maleylacetate reductase, and tfdB(II) coded for a chlorophenol hydroxylase. Dot blot hybridizations of mRNA isolated from R. eutropha JMP134 showed that both tfd(I) and tfd(II) genes are transcribed upon induction with 2,4-D. Thus, the functions encoded by the tfd(II) genes seem to be redundant with respect to those of the tfd(I) cluster. One reason why the tfd(II) genes do not disappear from plasmid pJP4 might be the necessity for keeping the regulatory genes for the 2,4-D pathway expression tfdR and tfdS.  (+info)

Genetic analysis of a gene cluster for cyclohexanol oxidation in Acinetobacter sp. Strain SE19 by in vitro transposition. (5/166)

Biological oxidation of cyclic alcohols normally results in formation of the corresponding dicarboxylic acids, which are further metabolized and enter the central carbon metabolism in the cell. We isolated an Acinetobacter sp. from an industrial wastewater bioreactor that utilized cyclohexanol as a sole carbon source. A cosmid library was constructed from Acinetobacter sp. strain SE19, and oxidation of cyclohexanol to adipic acid was demonstrated in recombinant Escherichia coli carrying a SE19 DNA segment. A region that was essential for cyclohexanol oxidation was localized to a 14-kb fragment on the cosmid DNA. Several putative open reading frames (ORFs) that were expected to encode enzymes catalyzing the conversion of cyclohexanol to adipic acid were identified. Whereas one ORF showed high homology to cyclohexanone monooxygenase from Acinetobacter sp. strain NCIB 9871, most of the ORFs showed only moderate homology to proteins in GenBank. In order to assign functions of the various ORFs, in vitro transposon mutagenesis was performed using the cosmid DNA as a target. A set of transposon mutants with a single insertion in each of the ORFs was screened for cyclohexanol oxidation in E. coli. Several of the transposon mutants accumulated a variety of cyclohexanol oxidation intermediates. The in vitro transposon mutagenesis technique was shown to be a powerful tool for rapidly assigning gene functions to all ORFs in the pathway.  (+info)

Identification in Saccharomyces cerevisiae of two isoforms of a novel mitochondrial transporter for 2-oxoadipate and 2-oxoglutarate. (6/166)

The nuclear genome of Saccharomyces cerevisiae encodes 35 members of a family of membrane proteins. Known members transport substrates and products across the inner membranes of mitochondria. We have localized two hitherto unidentified family members, Odc1p and Odc2p, to the inner membranes of mitochondria. They are isoforms with 61% sequence identity, and we have shown in reconstituted liposomes that they transport the oxodicarboxylates 2-oxoadipate and 2-oxoglutarate by a strict counter exchange mechanism. Intraliposomal adipate and glutarate and to a lesser extent malate and citrate supported [14C]oxoglutarate uptake. The expression of Odc1p, the more abundant isoform, made in the presence of nonfermentable carbon sources, is repressed by glucose. The main physiological roles of Odc1p and Odc2p are probably to supply 2-oxoadipate and 2-oxoglutarate from the mitochondrial matrix to the cytosol where they are used in the biosynthesis of lysine and glutamate, respectively, and in lysine catabolism.  (+info)

Key aromatic-ring-cleaving enzyme, protocatechuate 3,4-dioxygenase, in the ecologically important marine Roseobacter lineage. (7/166)

Aromatic compound degradation in six bacteria representing an ecologically important marine taxon of the alpha-proteobacteria was investigated. Initial screens suggested that isolates in the Roseobacter lineage can degrade aromatic compounds via the beta-ketoadipate pathway, a catabolic route that has been well characterized in soil microbes. Six Roseobacter isolates were screened for the presence of protocatechuate 3,4-dioxygenase, a key enzyme in the beta-ketoadipate pathway. All six isolates were capable of growth on at least three of the eight aromatic monomers presented (anthranilate, benzoate, p-hydroxybenzoate, salicylate, vanillate, ferulate, protocatechuate, and coumarate). Four of the Roseobacter group isolates had inducible protocatechuate 3, 4-dioxygenase activity in cell extracts when grown on p-hydroxybenzoate. The pcaGH genes encoding this ring cleavage enzyme were cloned and sequenced from two isolates, Sagittula stellata E-37 and isolate Y3F, and in both cases the genes could be expressed in Escherichia coli to yield dioxygenase activity. Additional genes involved in the protocatechuate branch of the beta-ketoadipate pathway (pcaC, pcaQ, and pobA) were found to cluster with pcaGH in these two isolates. Pairwise sequence analysis of the pca genes revealed greater similarity between the two Roseobacter group isolates than between genes from either Roseobacter strain and soil bacteria. A degenerate PCR primer set targeting a conserved region within PcaH successfully amplified a fragment of pcaH from two additional Roseobacter group isolates, and Southern hybridization indicated the presence of pcaH in the remaining two isolates. This evidence of protocatechuate 3, 4-dioxygenase and the beta-ketoadipate pathway was found in all six Roseobacter isolates, suggesting widespread abilities to degrade aromatic compounds in this marine lineage.  (+info)

Identification of the human mitochondrial oxodicarboxylate carrier. Bacterial expression, reconstitution, functional characterization, tissue distribution, and chromosomal location. (8/166)

In Saccharomyces cerevisiae, the genes ODC1 and ODC2 encode isoforms of the oxodicarboxylate carrier. They both transport C5-C7 oxodicarboxylates across the inner membranes of mitochondria and are members of the family of mitochondrial carrier proteins. Orthologs are encoded in the genomes of Caenorhabditis elegans and Drosophila melanogaster, and a human expressed sequence tag (EST) encodes part of a closely related protein. Information from the EST has been used to complete the human cDNA sequence. This sequence has been used to map the gene to chromosome 14q11.2 and to show that the gene is expressed in all tissues that were examined. The human protein was produced by overexpression in Escherichia coli, purified, and reconstituted into phospholipid vesicles. It has similar transport characteristics to the yeast oxodicarboxylate carrier proteins (ODCs). Both the human and yeast ODCs catalyzed the transport of the oxodicarboxylates 2-oxoadipate and 2-oxoglutarate by a counter-exchange mechanism. Adipate, glutarate, and to a lesser extent, pimelate, 2-oxopimelate, 2-aminoadipate, oxaloacetate, and citrate were also transported by the human ODC. The main differences between the human and yeast ODCs are that 2-aminoadipate is transported by the former but not by the latter, whereas malate is transported by the yeast ODCs but not by the human ortholog. In mammals, 2-oxoadipate is a common intermediate in the catabolism of lysine, tryptophan, and hydroxylysine. It is transported from the cytoplasm into mitochondria where it is converted into acetyl-CoA. Defects in human ODC are likely to be a cause of 2-oxoadipate acidemia, an inborn error of metabolism of lysine, tryptophan, and hydroxylysine.  (+info)

Adipic Acid Chemical Structure Composition. Date: 17 March 2014: Source: Own work: Author: Emeldir : SVG development : This structural formula was created with Name2Struct - CS ChemDraw Ultra. Adipic acid rarely occurs in nature. Esters of Adipic Acid, such as DOA (Di-2-Ethylhexyl Adipate) are used as plasticizers for PolyVinyl Chloride (PVC) resins. Molecular Weight. Adipic acid rarely occurs in nature. Nylon 66 (nylon 6-6, nylon 6/6 or nylon 6,6) is a type of polyamide or nylon.It, and nylon 6, are the two most common for textile and plastic industries.Nylon 66 is made of two monomers each containing 6 carbon atoms, hexamethylenediamine and adipic acid, which give nylon 66 its name. Adipic acid is the organic compound with the formula (CH2)4(COOH)2. Ethylene glycol, adipic acid, toluene diisocyanate polymer; Hexanedioic acid, 1,2-ethanediol, 1,3-diisocyanatomethylbenzene; Hexaned . A method has been reported that uses principles of green chemistry where water is the only by-product. Structure ...
Biological production of adipic acid is a promising alternative to the environmentally challenged petrochemical-based process currently used. Lignin is a promising feedstock for adipic acid production as it can be broken down into the aromatic intermediates that can be used to produce adipic acid. One common pathway for microbial production of adipic acid goes through a catechol intermediate to form muconic acid, which is then reduced to form adipic acid. To produce adipic acid in Escherichia coli, we utilize an enzyme cascade of catechol 1,2-dioxygenase (CatA) and enoate reductase (ER). Optimization of protein expression using synthetic biology allowed us to optimize adipic acid yield. Furthermore, we characterize our enzyme cascade by analyzing its metabolism of different substituted catechols available from lignin pyrolysis. We demonstrate production of substituted dicarboxylic acids that could be used in the production of nylon analogs with tunable properties. To quantify metabolism of ...
SUMMARY: β-Ketoadipate serves as a chemoattractant for Pseudomonas putida. The chemotactic response is inducible, and a regulatory mutant strain that forms the β-ketoadipate transport system at high levels exhibits a heightened chemotactic response to β-ketoadipate. Adipate and succinate, compounds that interact with the transport system, inhibit chemotaxis toward β-ketoadipate. Some, but not all, mutants that fail to respond chemotactically to β-ketoadipate lack the β-ketoadipate transport system. It thus appears that the transport of β-ketoadipate is associated with its function as a chemoattractant. It is likely that the metabolite attracts fluorescent Pseudomonas species to environments in which complex aromatic polymers undergo microbial dissimilation.
Press Release issued Apr 24, 2017: Adipic acid is one of the most commercially important type of aliphatic dicarboxylic acids, especially due to its significant usage as a feedstock for the production of industrial fibers. It is produced from the oxidation of a mixture of cyclohexanol and cyclohexanone with nitric acid. Alternatively, adipic acid can also be produced from butadiene carbonylation. There has been a significant demand for chemically resilient, strong and durable fibers for the manufacture of automotive parts. This has initiated a strong demand for adipic acid, since it is one of the key ingredients for the production of composite materials. The major consumption of adipic acid is as the feedstock for the production for nylon 6,6 resin and engineering fibers. The non-nylon applications of adipic acid include its usage in the manufacture of polyurethanes, plasticizers, food additives and pharmaceuticals.
Global Adipic Acid Market is expected to reach USD 7,240.8 million by 2020, according to a new study by Grand View Research, Inc. Growing demand for nylon resins and fiber from major end use industries such as automotive and electronics mainly in BRIC nations is expected to remain a key driving factor for the market over the next six years. However, volatility in raw material prices coupled with stringent regulations in Europe and North America on account of growing environmental concerns is expected to hinder the market growth over the forecast period. Development of bio-based adipic acid emerged as a new driving force for the global Adipic Acid market. Bio-based adipic acid is an environment friendly solution, and provides cost advantage over its synthetic counterpart. Rennovia has been one of the pioneers for bio-based adipic acid development, using glucose as feedstock via its proprietary chemical catalytic process technology. Nylon 6,6 both in its fiber and resin forms emerged as the ...
Business Directory for Piperazine Adipate Suppliers in Rajkot - Get contact details of Piperazine Adipate Manufacturers, Wholesale Piperazine Adipate Exporters, Best Piperazine Adipate Traders & Distributors Across the Rajkot.
4 Others. At last, the key constraints having an impact on market growth and reducing the popularity of specific product segments during the forecast period are also listed in this report. The potential growth opportunities and their influence on the Global Adipic Acid Market is analysed in the report.. What Information does this report contain?. , What was the historic Adipic Acid market data from 2012 to 2016?. , What is the Adipic Acid industry growth forecast from 2016 to 2022?. , Which companies lead the Adipic Acid industry, how are they positioned in the market in terms of sustainability, competency, production capacity and strategic outlook?. , What are the technology & innovation trends, how will they evolve by 2022?. , Which are the leading market products, applications & regions and how will they perform by 2022?. , A detailed analysis of regulatory trends, drivers, industry pitfalls, challenges and growth opportunities for participants. ...
Glentham Life Sciences is a supplier of GM8712 - Adipic acid dihydrazide (1071-93-8). Find catalogue prices, chemical data, technical specifications and MSDS documents.
Shop a large selection of Bis(2-ethylhexyl) adipate, 99%, ACROS Organics™ products and learn more about Bis(2-ethylhexyl) adipate, 99%, ACROS Organics™ 2.5L; Glass
Find the best piperazine adipate oral powder in Aalanavara. Justsee provide the top 10 piperazine adipate oral powder Chennai, addresses, phone numbers, contact information.
Article World Adipic Acid Market is Expected to Grow at a CAGR of 4.7% from 2014 to 2020: Grand View Research, Inc. The global market for adipic acid is expected to reach USD 7,240.8 million by 2020, according to a new study by Grand View Research, I...
There is one reliable key study for this endpoint. In this study (Habeck C., 2010), the vapor pressure of Reaction mass of Dimethyl adipate (CAS627-93-0), Dimethyl glutarate (CAS1119-40-0) and Dimethyl succinate (CAS106-65-0) was determined according to the EECDirective 92/69, A.4 (2008), to the OECD guideline No. 104, (2006) and to the Council Regulation EC No. 761/2009, A4 (2009) using the gas saturation method. The study was compliant with the GLP principles. The vapor pressure of Reaction mass of Dimethyl adipate (CAS627-93-0), Dimethyl glutarate (CAS1119-40-0) and Dimethyl succinate (CAS106-65-0) was measured at test temperatures of 30 °C, 40 °C and 50 °C and was determined to be ...
[150 Pages Report] Check for Discount on 2016 Bis[(3,4-Epoxycyclohexyl)Methyl]Adipate (CAS 3130-19-6) Industry Market Report report by Prof Research. The Global and Chinese Bis[(3,4-Epoxycyclohexyl)Methyl]Adipate...
Extensive metabolism studies of many non-K-region dihydro-diols of unsubstituted and methyl-substituted polycyclic aromatic hydrocarbons (PAHs) by mammalian drug-metabolizing enzymes indicate that...
Adipic acid is a naturally-occurring dicarboxylic acid present in sugar canes and beets, though it can be commercially prepared by ...
215395-69-0 - Fatty acids, C18-unsatd., dimers, polymers with adipic acid, 5-amino-1,3,3-trimethylcyclohexanemethanamine, diethylenetriamine and terephthalic acid - Searchable synonyms, formulas, resource links, and other chemical information.
Adipic acid definition, a white, crystalline, slightly water-soluble solid, C 6 H 10 O 4 , used chiefly in the synthesis of nylon. See more.
Earlier generation of Mater-Bi® are composed of starches derived from plants, mainly corn starch, and a fully biodegradable synthetic aliphatic-aromatic polyester called PBAT (polybutylene adipate co-terephthalate) trademarked under the name Origo-Bi. This biodegradable synthetic polyester technology made with combination of diacids (e.g. adipic acid and terephthalic acid) and diols (e.g. BDO), was acquired from Eastman, which was originally called Eastar-Bio, in 2004.. The blog is guessing that for the 4th generation Mater-Bi® line, instead of using petroleum-based monomers, adipic acid and BDO, adipic acid will be then be substituted by vegetable oil-based azelaic acid (the blog heard that this diacid is produced from rancidity of oleic acid) and Genomaticas biobased BDO. Substitution of the aromatic terephthalic acid with a biobased material will still take time.. In preparation for this product, Novamont has been investing around €300m ($400.8m) with two new biorefineries via ...
China Diethyl Hydroxylamine (DEHA), Find details about China Deha, N N-Diethylhydroxylamine from Diethyl Hydroxylamine (DEHA) - Heze Kingvolt Chemical Co., Ltd.
PRASOL CHEMICALS LTD. - Manufacturer, Supplier and Trader of Ethylene Carbonate, Dimethyl Adipate, Dibasic Ester, Specialty Chemical based in Mumbai, Maharashtra, India.
Looking for SPECTRUM Di N Alkyl Adipate,25ml (26XD27)? Graingers got your back. Price:$37.90. Easy ordering & convenient delivery. Log-in or register for your pricing.
Benzyl butyl adipate/ACM4121135 can be provided in Alfa Chemistry. We are dedicated to provide our customers the best products and services.
Table of Contents for 2016 Dimethyl adipate (CAS 627-93-0) Industry Market Report by Prof Research Available at market-research-reports.com.
5423-61-0 - ZWPKWMGPJWNIKP-UHFFFAOYSA-N - 1,4-Bis(3-aminopropyl)piperazine adipate (1:1) - Similar structures search, synonyms, formulas, resource links, and other chemical information.
Reitman and colleagues had a hunch that the genetic mutation seen in cancer might trigger a similar functional change to a closely related enzyme found in yeast and bacteria (homoisocitrate dehydrogenase), which would create the elusive 2-hydroxyadipate dehydrogenase necessary for green adipic acid production.. They were right. The functional mutation observed in cancer could be constructively applied to other closely related enzymes, creating a beneficial outcome - in this case the missing link that could enable adipic acid production from cheap sugars. The next step will be to scale up the overall adipic acid production process, which remains a considerable undertaking.. Its exciting that sequencing cancer genomes can help us to discover new enzyme activities, Reitman said. Even genetic changes that occur in only a few patients could reveal useful new enzyme functions that were not obvious before.. Yan, a professor in the Department of Pathology and senior author of the study, said the ...
Shop a large selection of Adipic dihydrazide, 98%, ACROS Organics™ products and learn more about Adipic dihydrazide, 98%, ACROS Organics™ .
The production of salt or cocrystalline forms is a common approach to alter the physicochemical properties of pharmaceutical compounds. The goal of this work was to evaluate the impact of anion choice (succinate, adipate, and sulfate) on the physicochemical characteristics of salbutamol forms. Novel crystals of salbutamol were produced by solvent evaporation: a cocrystal of salbutamol hemiadipate with adipic acid (salbutamol adipate, SA), salbutamol hemisuccinate tetramethanolate (SSU.MeOH), and its desolvated form (SSU). The crystalline materials obtained were characterized using thermal, X-ray, nuclear magnetic resonance, Fourier transform infrared spectroscopy, dynamic vapor sorption (DVS), and elemental analysis. The crystal forms of SA and SSU.MeOH were determined to be triclinic, (P?i), and monoclinic, (P21/n), respectively. DVS analysis confirmed that SSU and SA do not undergo hydration under increased relative humidity. Both thermal and elemental analyses confirmed the stoichiometry of ...
In a 103-week carcinogenicity study, the read-across substance DEHA was administered to F344 rats and B6C3F1 mice in the diet at levels of 12000 or 25000 ppm, equivalent to a daily intake of 600 or 1250 mg/kg of body weight in rats and 1715 or 3570 mg/kg of body weight in mice (conversion based on data from the WHO report (2004)). No test substance related tumors were found in the rat (no increased tumour incidences). In the (female) mice an increased number of hepatocellular carcinomas was found at both doses. Hepatocellular adenomas and carcinomas occured combined in high-dose mice of both sexes and in low-dose female mice at incidences that were dose-related and significantly higher than those in control mice. The association of liver tumours in male mice with the administration of DEHA was not considered to be conclusive because the increased number of liver tumours in males reflected only an increase in adenomas in the high-dose group and because the time to observation of tumours was not ...
Data on 6,500 pesticides, insecticides and herbicides including toxicity, water pollution, ecological toxicity, uses and regulatory status.
The National Institute of Standards and Technology (NIST) uses its best efforts to deliver a high quality copy of the Database and to verify that the data contained therein have been selected on the basis of sound scientific judgment. However, NIST makes no warranties to that effect, and NIST shall not be liable for any damage that may result from errors or omissions in the Database ...
The National Institute of Standards and Technology (NIST) uses its best efforts to deliver a high quality copy of the Database and to verify that the data contained therein have been selected on the basis of sound scientific judgment. However, NIST makes no warranties to that effect, and NIST shall not be liable for any damage that may result from errors or omissions in the Database ...
With a network of price reporters across Asia, Europe and the US, ICIS is fully equipped to keep you updated on everything that happens in the global Adipic acid market, whether you buy or sell Adipic acid or related products. From daily and weekly reports containing price assessments obtained by our network of local reporters, […]. ...
2021-6-7 · Big bag unloading station stripping box - Standard big bag unloading. Speed: 10 to 30 big bags/h. Capacity: 2 tons/big bag. This big bag unloading standard model has been designed to ergonomically discharge the bulk bags and facilitate their handling. The structure is adjustable to easily adapt to different sizes of big bags.. The EF0 FIBC discharge equipment offers 3 types of loading …. Get Price ...
The above tropism is a polarized light microscope image of adipic acid, (CH2)4(COOH)2. The nearly 2.5 billion kg of adipic acid produced each year is mostly used as a monomer for the production of nylon. Other major uses involve polymers. It is a monomer for production of Polyurethane and it is used in making PVC. The image above was captured using a microscope digital camera adapter and a standard digital camera ...
Data on 6,500 pesticides, insecticides and herbicides including toxicity, water pollution, ecological toxicity, uses and regulatory status.
Information on Registered Substances comes from registration dossiers which have been assigned a registration number. The assignment of a registration number does however not guarantee that the information in the dossier is correct or that the dossier is compliant with Regulation (EC) No 1907/2006 (the REACH Regulation). This information has not been reviewed or verified by the Agency or any other authority. The content is subject to change without prior notice ...
CR382138.PE60 Location/Qualifiers FT CDS_pept 131151..135242 FT /transl_table=12 FT /locus_tag=DEHA2F01474g FT /old_locus_tag=DEHA0F01738g FT /old_locus_tag=DEHA-IPF8986 FT /old_locus_tag=DEHA-CDS0150.1 FT /product=DEHA2F01474p FT /note=some similarities with uniprot,P39521 Saccharomyces FT cerevisiae YPR104C FHL1 and similar to CA0765,IPF9040.3eoc FT Candida albicans IPF9040.3eoc FT /db_xref=EnsemblGenomes-Gn:DEHA2F01474g FT /db_xref=EnsemblGenomes-Tr:CAG88734 FT /db_xref=GOA:Q6BMZ3 FT /db_xref=InterPro:IPR000253 FT /db_xref=InterPro:IPR001766 FT /db_xref=InterPro:IPR008984 FT /db_xref=InterPro:IPR036388 FT /db_xref=InterPro:IPR036390 FT /db_xref=UniProtKB/TrEMBL:Q6BMZ3 FT /protein_id=CAG88734.2 FT /translation=MMSSLSLGDDSLTSSKKEQDSLEDKNLKGNLGKQEDNNKIGGVDI FT EREADAQSLDLDDEINSILNDNEENHKAHRKQGAETKNDEDIATQMSLPDLQDLDIGPL FT DKIQNPMNKIVLDFDDTSKTVSNSQSPNPVDEETYDRYKNSTSQVDIRRNSSLVPITSE FT AALGSSNHEDDKDSSKISAYARLDFENFTFFVQTLQVILGRKSNDELLQSSHHAVDVHL FT ...
Azithromycin (zithromax, azithrocin, zmax, azin)[1] is an azalide, a subclass of macrolide antibiotics. Azithromycin is one of the worlds best-selling antibiotics.[2][not in citation given (see discussion.)] it is derived from erythromycin, with a methyl-substituted nitrogen atom incorporated into the lactone ring, thus making the lactone ring 15-membered.
Azithromycin is among the best selling antibiotics in the world. Its made from erythrocyte, using a methyl-substituted nitrogen atom integrated in to lactones-ring, hence production 15-membered lactones. Azithromycin is used to prevent and treat a variety of bacterial infections and its use in treating sexually transmitted infections like cervicitis, non gonococcal-urethritis & Chlamydia is proven … ...
T01026 (acav,adh,amin,apom,arn,asoc,ato,bara,bko,camg,cmb,def,fln,gli,gtm,les,mbov,mee,ntp,ntt,parb,part,pht,ppoa,ptu,rhu,sgv,smal,sscu,sya,tpaf,trl : calculation not yet completed ...
T01026 (bbev,caer,carg,ccar,clus,cmag,cpap,csph,cuh,cwe,cyy,ddq,egz,hbe,hbr,hhh,jsv,kqv,mass,ment,mgot,mko,mlac,moc,mtw,nfu,odi,oro,pavi,pet,pgs,pib,pmac,prap,pret,psuf,ros,rrz,shyd,sob,soe,spun,stan,svu,tmu,tprf,vro,wpa,xph,zne : calculation not yet completed ...
Accepted name: 2-hydroxycyclohexanone 2-monooxygenase. Reaction: 2-hydroxycyclohexan-1-one + NADPH + H+ + O2 = 6-hydroxyhexan-6-olide + NADP+ + H2O. Systematic name: 2-hydroxycyclohexan-1-one,NADPH:oxygen 2-oxidoreductase (1,2-lactonizing). Comment: the product decomposes spontaneously to 6-oxohexanoic acid (adipic semialdehyde).. Links to other databases: BRENDA, EXPASY, KEGG, Metacyc, CAS registry number: 62628-31-3. References. 1. Davey, J.F. and Trudgill, P.W. The metabolism of trans-cyclohexan-1,2-diol by an Acinetobacter species. Eur. J. Biochem. 74 (1977) 115-127. [PMID: 856571]. ...
Find quality suppliers and manufacturers of 68201-57-0(Rosin, fumarated, polymer with adipic acid and pentaerythritol) for price inquiry. where to buy 68201-57-0(Rosin, fumarated, polymer with adipic acid and pentaerythritol).Also offer free database of 68201-57-0(Rosin, fumarated, polymer with adipic acid and pentaerythritol) including MSDS sheet(poisoning, toxicity, hazards and safety),chemical properties,Formula, density and structure, solution etc.
INTERNATIONAL PROGRAMME ON CHEMICAL SAFETY WORLD HEALTH ORGANIZATION SUMMARY OF TOXICOLOGICAL DATA OF CERTAIN FOOD ADDITIVES WHO FOOD ADDITIVES SERIES NO. 12 The data contained in this document were examined by the Joint FAO/WHO Expert Committee on Food Additives* Geneva, 18-27 April 1977 Food and Agriculture Organization of the United Nations World Health Organization * Twenty-first Report of the Joint FAO/WHO Expert Committee on Food Additives, Geneva, 1977, WHO Technical Report Series No. 617 ADIPIC ACID Explanation This substance has been evaluated for acceptable daily intake by the Joint FAO/WHO Expert Committee on Food Additives (see Annex I, Ref. Nos. 11 and 13) in 1965. The previous monograph has been expanded and is reproduced below. EVALUATION FOR ACCEPTABLE DAILY INTAKE BIOLOGICAL DATA BIOCHEMICAL ASPECTS Four young dogs were injected subcutaneously with 0.25 g adipic acid (sodium salt), twice daily, for a period of five days. Urine was collected during this period, and for three days ...
Spiramycin adipate (CAS 1405-20-5) Market Research Report 2018 aims at providing comprehensive data on spiramycin adipate market globally and regionally
Bioassay-guided fractionation of metabolites from the fungus Cephalosporium sp.AL031 isolated from Sinarundinaria nitida led to the discovery of a new isobenzofuranone derivative, 4,6-dihydroxy-5-methoxy-7-methylphthalide (1), together with three known compounds: 4,5,6-trihydroxy-7-methyl-1,3-dihydroisobenzofuran (2), 4,6-dihydroxy-5-methoxy-7-methyl-1,3-dihydroisobenzofuran (3) and 4,5,6-trihydroxy-7-methylphthalide (4). The structure of the new compound 1 was determined based on MS, 1D and 2D NMR spectral data. Compounds 1-4 showed potent antioxidant activity with EC50 values of 10, 7, 22 and 5 μM by 1,1-diphenyl-2-picryhydrazyl (DPPH) radical-scavenging assay.
PubMed journal article Poly(glycerol adipate)-fatty acid esters as versatile nanocarriers: From nanocubes over ellipsoids to nanosphere were found in PRIME PubMed. Download Prime PubMed App to iPhone, iPad, or Android
Sigma-Aldrich offers abstracts and full-text articles by [Simon Ningsun Zhou, Richard P Moody, Bio Aikawa, Anna Yip, Bing Wang, Jiping Zhu].
Copyright 2016 by Simone Lazar. In accordance with Title 17 of the United States Code, Copyright Law of the United States of America, this material is copyrighted, and any further reproduction or distribution is prohibited without the permission of the copyright owner ...
Copyright 2016 by Simone Lazar. In accordance with Title 17 of the United States Code, Copyright Law of the United States of America, this material is copyrighted, and any further reproduction or distribution is prohibited without the permission of the copyright owner ...
by Product (Diacetone Acrylamide (DAAM), Adipic Dihydrazide (ADH)), by Application (Coatings & Adhesives, Formaldehyde Absorbers, Chemical Intermediates, Curing Agents, Textile, Paper) and by Region, Trend, Forecast, Competitive Analysis, and Growth Oppor
Page contains details about paclitaxel loaded adipic dihydrazide/octanedioic acid/branched polyethyleneimine-modified hyaluronic acid micelles . It has composition images, properties, Characterization methods, synthesis, applications and reference articles : nano.nature.com
4FPI: X-ray crystallographic and molecular docking studies on a unique chloromuconolactone dehalogenase from Rhodococcus opacus 1CP.
Pseudomonas aeruginosa remains one of the major pathogens affecting immunocompromised patients. LPS-based monovalent (MV) and polyvalent (PV) conjugate vaccines were prepared from the most prevalent strains of P. aeruginosa International Antigenic Typing Scheme (IATS) 6, 10, 11 and 20 to evaluate their immunogenicity and protective capacities from infection by the pathogens. Conjugation of the O-polysaccharide (O-PS) antigens of P. aeruginosa strains to the common immunogenic recombinant Exotoxin A (rEPA) supports the multi-antigenic approach for the development of a vaccine that provides cross protection against various strains of the pathogen. The O-PSs were indirectly conjugated through adipic acid dihydrazide (ADH) to rEPA by carbodiimidemediated condensation reaction. Mice were immunized with the conjugates emulsified with monophosphoryl lipid A (MPL) or Freunds adjuvant compared with conjugates without adjuvant, unconjugated mixture of rEPA and O-PS emulsified with MPL, and sterile saline. The MV
Evidence for two uptake systems in Rhizobium leguminosarum for hydroxy-aromatic compounds metabolized by the 3-oxoadipate pathway. Wong, C.M.; Dilworth, M.J.; Glenn, A.R.; Arch. Microbiol. 156, 385-391 (1991) ...
CR382138.PE377 Location/Qualifiers FT CDS complement(751782..752987) FT /transl_table=12 FT /locus_tag=DEHA2F08712g FT /old_locus_tag=DEHA0F09603g FT /old_locus_tag=DEHA-IPF8377 FT /old_locus_tag=DEHA-CDS3172.1 FT /product=DEHA2F08712p FT /note=similar to uniprot,P41338 Saccharomyces cerevisiae FT YPL028W ERG10 Acetyl-CoA C-acetyltransferase (acetoacetyl- FT CoA thiolase) cytosolic enzyme that transfers an acetyl FT group from one acetyl-CoA molecule to another forming FT acetoacetyl-CoA FT /db_xref=EnsemblGenomes-Gn:DEHA2F08712g FT /db_xref=EnsemblGenomes-Tr:CAG89081 FT /db_xref=GOA:Q6BM30 FT /db_xref=InterPro:IPR002155 FT /db_xref=InterPro:IPR016039 FT /db_xref=InterPro:IPR020610 FT /db_xref=InterPro:IPR020613 FT /db_xref=InterPro:IPR020615 FT /db_xref=InterPro:IPR020616 FT /db_xref=InterPro:IPR020617 FT /db_xref=UniProtKB/TrEMBL:Q6BM30 FT /protein_id=CAG89081.1 FT /translation=MSSVYIVSTARTPIGAFQGGLSSLTYSDLGSHAVHAALKKVPQIK FT ...
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class=publication>Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href=http://www.nrbook.com/b/bookcpdf.php>Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
Ban, T; Sada, S; Takahashi, Y; Sada, H; Fujita, T (1985). Effects of para-substituted beta-adrenoceptor blocking agents and methyl-substituted phenoxypropanolamine derivatives on maximum upstroke velocity of action potential in guinea-pig papillary muscles. Naunyn-Schmiedebergs Archives of Pharmacology. 329 (1): 77-85. doi:10.1007/bf00695196. PMID 2582279 ...
Find Calcium D-Glucarate. Calcium D-Glucarate includes the patented compound glucarate which has been shown to enhance the major detoxification pathways in the body.
Macroporous Strong acid Cation resin with oxidation resistant, such as nitric acid,recovery metal in a strong oxidation media.recovery Cu,V from adipic acid
Relationship between twisting phenomenon and structural discontinuity of stacked lamellae in the spherulite of poly(ethylene adipate) as studied by the synchrotron X-ray microbeam technique (Special issue : Cutting Edge of Scattering from Softmaterials) (2019 ...
Buy Calcium D-Glucarate Capsules from Absorb Health to Detoxify and Reduce Excess Estrogen! We are Proud to Offer Ours for the Affordable Price of Only...
2-Oxo-2,3-dihydrofuran-5-acetate; 3-Oxoadipate enol-lactone; 4,5-Dihydro-5-oxofuran-2-acetate; 5-Oxo-4,5-dihydrofuran-2-acetate; C03586 ...
Revisions to the drugs that may not be compounded and allowed bulk drug substances. Discussion about the identification of a substance as demonstrably difficult to compound
DHTKD1 Antibody 27493-1-AP has been identified with WB, ELISA. 27493-1-AP detected 103 kDa band in HepG2 cells with 1:500-1:1000 dilution...
... is formed by treating dimethyl adipate with concentrated ammonia. MSDS at Oxford University Musser, M. T. (2005). " ... "Dimethyl Adipate". chemicalland21.com. v t e. ...
Polybutylene adipate terephthalate (PBAT)Edit. Polybutylene adipate terephthalate (PBAT) is a biodegradable random copolymer ... Biodegradable starch blends include starch/polylactic acid,[12] starch/polycaprolactone,[13] and starch/polybutylene-adipate-co ...
... adipate, maleate, stearate, myristate, etc.), Plasticizers (acrylates, maleates, etc.), Pesticides: Dinocap Lubricants: Zinc ...
One case is in regard to diethylhexyl adipate (DEHA). DEHA is a plasticizer, a substance added to some plastics in order to ...
Polybutylene adipate terephthalate (PBAT) is a biodegradable random copolymer. No international standard has been established ... Biodegradable starch blends include starch/polylactic acid, starch/polycaprolactone, and starch/polybutylene-adipate-co- ...
Wislicenus prepared cyclopentane from cyclopentanone ("Ketopentamethen"), which is prepared by heating calcium adipate. ...
For composite rocket propellants, dioctyl adipate, isodecyl pelargonate, and dioctyl phthalate are often used. Plasticizers can ...
KI72: identification of the enzymes responsible for the conversion of 6-aminohexanoate to adipate". Applied Microbiology and ...
Typical polyols used are polyethylene adipate (a polyester) and poly(tetramethylene ether) glycol (a polyether). 4,4'-MDI is ...
Polyester adipate. *Camphor (obsolete)[8]:30. *Stabilizers, to prevent or slow down self-decomposition[7]:307-311*Diphenylamine ...
"Determination That Delcobese (Amphetamine Adipate, Amphetamine Sulfate, Dextroamphetamine Adipate, Dextroamphetamine Sulfate) ... Frequently prepared solid salts of amphetamine include amphetamine adipate, aspartate, hydrochloride, phosphate, saccharate, ...
A wide variety of substances can be used as plasticizers including phthalates, adipates, trimellitates, polymeric plasticizers ... These are for example the antioxidant bisphenol A, the biocide benzisothiazolinone, propylene glycol/adipate polyester and ... DEHP alternatives, which are gradually replacing it, are adipates, butyryltrihexylcitrate (BTHC), cyclohexane-1,2-dicarboxylic ...
The title of his M.S. thesis was 'Catabolism of alpha-amino adipate by Pseudomonas putida p2'. He went on to attend the ...
... and the polyethylene adipate diol (PEA). They are then used as prepolymers. Thermally stable polymers, which have a high ...
Adipate List of food additives Sodium bicarbonate Erich Lück and Gert-Wolfhard von Rymon Lipinski "Foods, 3. Food Additives" in ...
... s of phthalates, adipates, and azelates with C8 - C10 alcohols have found commercial use as lubricants, spin ...
Laboratory preparation could be achieved by reduction of adipates with lithium aluminium hydride, although this method is ...
An example is: Bis(2-ethylhexyl)adipate (DEHA) Sebacate- based plasticizers are provides excellent compatibility with a range ... The wide variety of ester chemistries that are in production include sebacates, adipates, terephthalates, dibenzoates, ... Adipate-based plasticizers are used for low-temperature or resistance to ultraviolet light. ...
... polybutylene adipate-co-terephthalate produced by BASF) blends. These blends are used for industrial applications and are also ... such as succinates and adipates, have obtained these certificates. Additive-based bioplastics sold as photodegradable or Oxo ...
... adipate". Reprod. Toxicol. 19 (4): 505-515. doi:10.1016/j.reprotox.2004.11.005. PMID 15749265. Braga-Basaria M, Dobs AS, Muller ...
... adipate". Reproductive Toxicology (Elmsford, N.Y.). 19 (4): 505-515. doi:10.1016/j.reprotox.2004.11.005. ISSN 0890-6238. PMID ...
Effect of Heat-Treatment on Characteristics of Anodized Aluminum Oxide Formed in Ammonium Adipate Solution [1] DOI: 10.1149/ ...
"GC/MS Method for the Determination of Adipate Plasticizers in Ham Sausage and Its Application to Kinetic and Penetration ...
... hydrate, piperazine adipate and piperazine citrate (used to treat ascariasis and enterobiasis) are the most common ... and the adipate, C4H10N2.C6H10O4 (containing 1 molecule each of piperazine and adipic acid). Piperazine is formed as a co- ...
... the binder needs a plasticizer like dioctyl adipate (DOP) or 2-nitro-diphenylamine (2-NDPA) to make the explosive more flexible ...
... butylene succinate-co-adipate)and poly(butylene terephthalate-co-adipate) as drug encapsulation systems". Colloids and Surfaces ...
"A prokaryotic gene cluster involved in synthesis of lysine through the amino adipate pathway: a key to the evolution of amino ...
Bis(2-ethylhexyl) adipate, present in plastic wrap based on PVC, is also of concern, as are the volatile organic compounds ... For example, plasticizers like adipates and phthalates are often added to brittle plastics like PVC to make them pliable enough ...
Di-PPG-2 myreth-10 adipate is a water-dispersible emollient that forms clear solutions with surfactant systems ...
Amchur (mango powder) Ammonium acetate - preservative, acidity regulator Ammonium adipates - acidity regulator Ammonium ... Potassium acetates - preservative, acidity regulator Potassium adipate - food acid Potassium alginate - thickener, vegetable ... acidity regulator Sodium adipate - food acid Sodium alginate - thickener, vegetable gum, stabilizer, gelling agent, emulsifier ... emulsifier Acetylated distarch adipate - thickener, vegetable gum Acetylated distarch phosphate - thickener, vegetable gum ...
Potassium adipate (E357) Some adipate esters are used as plasticizers, including: Bis(2-ethylhexyl) adipate Dioctyl adipate ... The anionic (HO2C(CH2)4CO2−) and dianionic (−O2C(CH2)4CO2−) forms of adipic acid are also referred to as adipate. Some adipate ... Adipates are the salts and esters of adipic acid. ...
Dimethyl adipate is the organic compound with the formula (CH2CH2CO2CH3)2. It is a colorless oily liquid. Although the main ... Dimethyl adipate is prepared by esterification of adipic acid with methanol. Less conventional routes include the ... commercial interest in adipates is related to the production of nylons, this diester is used as a plasticizer, a solvent for ...
Ethyl adipate; 1,6-Diethyl hexanedioate; Diethylester kyseliny adipove; Hexanedioic acid, 1,6-diethyl ester; NSC 19160 ... and infrared spectra of industrially important adipate esters, J. Chromatogr. Sci., 1993, 31, 6, 225-230, https://doi.org/ ...
The National Institute of Standards and Technology (NIST) uses its best efforts to deliver a high quality copy of the Database and to verify that the data contained therein have been selected on the basis of sound scientific judgment. However, NIST makes no warranties to that effect, and NIST shall not be liable for any damage that may result from errors or omissions in the Database ...
Beyond providing Skin Deep® as an educational tool for consumers, EWG offers its EWG VERIFIED™ mark as a quick and easily identifiable way of conveying personal care products that meet EWGs strict health criteria. Before a company can use EWG VERIFIEDTM on such products, the company must show that it fully discloses the products ingredients on their labels or packaging, they do not contain EWG ingredients of concern, and are made with good manufacturing practices, among other criteria. Note that EWG receives licensing fees from all EWG VERIFIED member companies that help to support the important work we do. Learn more , Legal Disclaimer ...
... adipate. Find out what is in your tap water ... Di(2-ethylhexyl) adipate is used in PVC plastic, plastic wrap ... The EWG Health Guideline of 200 ppb for di(2-ethylhexyl) adipate was defined by the California Office of Environmental Health ... The legal limit for di(2-ethylhexyl) adipate, established in 1992, was based on a toxicity study in laboratory animals ... In studies of laboratory animals, di(2-ethylhexyl) adipate can harm fetal development. ...
Information on Registered Substances comes from registration dossiers which have been assigned a registration number. The assignment of a registration number does however not guarantee that the information in the dossier is correct or that the dossier is compliant with Regulation (EC) No 1907/2006 (the REACH Regulation). This information has not been reviewed or verified by the Agency or any other authority. The content is subject to change without prior notice ...
Diisotridecyl adipate. Regulatory process names 3 CAS names 1 IUPAC names 14 Trade names 9 Other identifiers 1 ...
Diisotridecyl adipate. Regulatory process names 1 CAS names 1 IUPAC names 7 Trade names 7 Other identifiers 1 ...
The viscosity of dimethyl adipate has been determined to be 3.03 mPa.s at 25 °C. ...
Looking for SPECTRUM Di N Alkyl Adipate,25ml (26XD27)? Graingers got your back. Price:$37.90. Easy ordering & convenient ...
The adipate salt form of itacitinib, an orally bioavailable inhibitor of Janus-associated kinase 1 (JAK1) with potential ... itacitinib adipate The adipate salt form of itacitinib, an orally bioavailable inhibitor of Janus-associated kinase 1 (JAK1) ...
Amfetamine adipate. UNII. Z58RH02W4M. CAS Number. 64770-51-0. Weight. Average: 281.352. Monoisotopic: 281.162708225. Chemical ... Amphetamine adipate. Drug Entry. Amphetamine. Amphetamines are non-catecholamine sympathomimetic amines with CNS stimulant ...
Sodium adipate , C6H8Na2O4 , CID 24073 - structure, chemical names, physical and chemical properties, classification, patents, ...
Dibutyl Adipate was observed to be a low level skin and eye irritant and a non-sensitizer. Dibutyl Adipate was not genotoxic in ... Dibutyl Adipate is the diester of butyl alcohol. and adipic acid. Another technical name for Dibutyl Adipate is Hexanedioic ... Dibutyl Adipate produced no effect. The CIR Expert Panel recognized that use of Dibutyl Adipate in suntan cosmetic products ... Dibutyl Adipate is the diester of butyl alcohol. and adipic acid. It is a clear colorless oily liquid. In cosmetics and ...
Paula Begoun is the best-selling author of 20 books about skincare and makeup. She is known worldwide as The Cosmetics Cop and creator of Paulas Choice Skincare. Paulas expertise has led to hundreds of appearances on national and international radio, print, and television including:. ...
The current research is focused on evaluating polybutyrate-adipate-terephthalate-polymer (PBAT) for fused deposition modelling ... Extrusion 3D Printing of Polybutyrate-Adipate-Terephthalate-Polymer Composites in the Pellet Form Sarat Singamneni 1,*, Dawn ... Singamneni S, Smith D, LeGuen M-J, Truong D. Extrusion 3D Printing of Polybutyrate-Adipate-Terephthalate-Polymer Composites in ... "Extrusion 3D Printing of Polybutyrate-Adipate-Terephthalate-Polymer Composites in the Pellet Form." Polymers 10, no. 8: 922. ...
Market Research Report 2018 aims at providing comprehensive data on spiramycin adipate market globally and regionally ... Spiramycin adipate prices in other regions. 7. SPIRAMYCIN ADIPATE END-USE SECTOR 7.1. Spiramycin adipate market by application ... 6. SPIRAMYCIN ADIPATE MARKET PRICES. 6.1. Spiramycin adipate prices in Europe. 6.2. Spiramycin adipate prices in Asia 6.3. ... 2. SPIRAMYCIN ADIPATE APPLICATIONS. 2.1. Spiramycin adipate application spheres, downstream products. 3. SPIRAMYCIN ADIPATE ...
... adipate , Di(2-ethylhexyl)adipate , Dioctyl adipate , DIOCTYL ADIPATE (CA DPR Chem Code Text ) , Dioctyladipate , is(2- ... Di-capryl adipate. View. View. View. Adjuvant. No. Not Listed. Related. 1. Diisopropyl adipate. View. View. View. No. Not ... Dimethyl adipate. View. View. View. Adjuvant, Solvent. No. Not Listed. 103-23-1. Related. 1. Dioctyl adipate. View. View. View ... Dioctyl adipate Adipic acid Illinois EPA list. Keith list. Colborn list. Benbrook list. Danish Inert list. EU list. Not listed ...
Di-capryl adipate. View. View. View. Adjuvant. No. Not Listed. Related. 1. Diisopropyl adipate. View. View. View. No. Not ... Dimethyl adipate. View. View. View. Adjuvant, Solvent. No. Not Listed. 103-23-1. Related. 1. Dioctyl adipate. View. View. View ... US EPA PC Code ) , 5846 (CA DPR Chem Code) ) , 900072 (US EPA PC Code Text ) , Diisopropyl Adipate , DIISOPROPYL ADIPATE (CA ... Diisopropyl adipate Adipic acid Illinois EPA list. Keith list. Colborn list. Benbrook list. Danish Inert list. EU list. Not ...
Paula Begoun is the best-selling author of 20 books about skincare and makeup. She is known worldwide as The Cosmetics Cop and creator of Paulas Choice Skincare. Paulas expertise has led to hundreds of appearances on national and international radio, print, and television including:. ...
Co adipate, Co(C6H8O4), has been found to order near 10 K into a magnetic structure featuring sheets of tetrahedral Co cations ... Co adipate, Co(C6H8O4), has been found to order near 10 K into a magnetic structure featuring sheets of tetrahedral Co cations ... Cobalt adipate, Co(C6H8O4): antiferromagnetic structure, unusual thermal expansion and magnetoelastic coupling P. J. Saines, P ... Cobalt adipate, Co(C6H8O4): antiferromagnetic structure, unusual thermal expansion and magnetoelastic coupling† ...
... glycerol adipate)-fatty acid esters as versatile nanocarriers: From nanocubes over ellipsoids to nanosphere were found in PRIME ... "Poly(glycerol Adipate)-fatty Acid Esters as Versatile Nanocarriers: From Nanocubes Over Ellipsoids to Nanospheres." Journal of ... Poly(glycerol adipate)-fatty acid esters as versatile nanocarriers: From nanocubes over ellipsoids to nanospheres. J Control ... Poly(glycerol Adipate)-fatty Acid Esters as Versatile Nanocarriers: From Nanocubes Over Ellipsoids to Nanospheres. J Control ...
128 Pages Report] Check for Discount on Global Monoethyl Adipate (MEA) Market Research Report to 2018 report by HeyReport. ... Figure Global Monoethyl Adipate (MEA) Market Size and CAGR 2011-2017 (Million USD). Figure Global Monoethyl Adipate (MEA) ... Figure Global Monoethyl Adipate (MEA) Market Forecast and CAGR 2018-2025 (Million USD). Figure Global Monoethyl Adipate (MEA) ... Figure Europe Monoethyl Adipate (MEA) Market Size and CAGR 2011-2017 (Million USD). Figure Europe Monoethyl Adipate (MEA) ...
Get contact details of Piperazine Adipate Manufacturers, Wholesale Piperazine Adipate Exporters, Best Piperazine Adipate ... Business Directory for Piperazine Adipate Suppliers in Rajkot - ... Piperazine Adipate in Rajkot. * * Cities : Eluru , Ahmedabad , ... piperazine adipate, Aluminium Sulphate, Poly Aluminium Chloride, Sodium Carboxymethyl Cellulose, Polyaluminum Chloride... ...
In vitro dermal absorption of di(2-ethylhexyl) adipate (DEHA) in a roll-on deodorant using human skin.. [Simon Ningsun Zhou, ... Bis(2-ethylhexyl) adipate, Selectophore™, ≥99.0% C22H42O4 ... Bis(2-ethylhexyl) adipate, ≥97.0% (GC) C22H42O4 ... Bis(2-ethylhexyl) adipate, analytical standard C22H42O4 ... adipate solution, certified reference material, 2000 μg/mL in ... In vitro dermal absorption experiments were conducted using a roll-on deodorant that contains 1.56% di(2-ethylhexyl) adipate ( ...
... and structure of the present requirements of the Diethyl Adipate market.Diethyl Adipate the market study offers a comprehensive ... Covid-19 Update Diethyl Adipate Market future growth ly in coming years 2020-2029. 3 weeks ago Jacqueline Love ... The Diethyl Adipate market report covers all the features of the trade with a dedicated examination of key players Hangzhou ... Type Segments: This Diethyl Adipate market report shows the growth of the market for various types of products marketed by the ...
... butylene adipate) (PBA) was synthesized by melt polycondensation. The chain extension of the prepolymers was carried out using ... S. Y. Luo et al., "Chain Extension of Poly(butylene adipate) with 2,2-(1,4- Phenylene)-bis(2-oxazoline)", Advanced Materials ... HomeAdvanced Materials ResearchAICAM 2005Chain Extension of Poly(butylene adipate) with... ... Low molecular weight poly(butylene adipate) (PBA) was synthesized by melt polycondensation. The chain extension of the ...
Polystyrene/TiO2 composite electrospun fibers as fillers for poly(butylene succinate-co-adipate): Structure, morphology and ... Polystyrene/TiO2 composite electrospun fibers as fillers for poly(butylene succinate-co-adipate): Structure, morphology and ... Polystyrene/TiO2 composite electrospun fibers as fillers for poly(butylene succinate-co-adipate): Structure, morphology and ... Polystyrene/TiO2 composite electrospun fibers as fillers for poly(butylene succinate-co-adipate): Structure, morphology and ...
The Global and Chinese Bis[(3,4-Epoxycyclohexyl)Methyl]Adipate... ... 150 Pages Report] Check for Discount on 2016 Bis[(3,4-Epoxycyclohexyl)Methyl]Adipate (CAS 3130-19-6) Industry Market Report ... 1.1 Brief Introduction of Bis[(3,4-Epoxycyclohexyl)Methyl]Adipate 1.2 Development of Bis[(3,4-Epoxycyclohexyl)Methyl]Adipate ... Chapter Nine Market Dynamics of Bis[(3,4-Epoxycyclohexyl)Methyl]Adipate Industry 9.1 Bis[(3,4-Epoxycyclohexyl)Methyl]Adipate ...
  • Dimethyl adipate is the organic compound with the formula (CH2CH2CO2CH3)2. (wikipedia.org)
  • Dimethyl adipate is prepared by esterification of adipic acid with methanol. (wikipedia.org)
  • The viscosity of dimethyl adipate has been determined to be 3.03 mPa.s at 25 °C. (europa.eu)
  • Related Products List: CAS No.627-93-0 C8H14O4, Dimethyl Adipate DMA Solvent, Pharmaceutical Intermediate of Plasticizer, CAS No. 626-86-8 C8H14O4, CAS No 106-65-0 C6H10O4, CAS No.6938-94-9 C12H22O4, CAS No 79-94-7 C15H12Br4O2, CAS 96-47-9 C5H10O. (stappenindestad.nl)
  • Dimethyl Adipate (Sta-Sol ESS 165) - J R Hess & Co., Inc. (stappenindestad.nl)
  • FlexiSolv® DBE® esters are mixtures of refined dicarboxylic dimethylesters (dimethyl succinate, dimethyl glutarate, and dimethyl adipate). (stappenindestad.nl)
  • Dimethyl Adipate is a chemical intermediate used in the manufacturing of polymers and agrochemicals, and as a specialty solvent for resins, adhesives, and inks. (stappenindestad.nl)
  • Jun 15, 2019· Solubility and liquid-liquid equilibria data for dimethyl adipate +1,6-hexanediol + water or ethylene glycol ternary systems at T = 313.15K and 323.15K under atmospheric pressure were measured.The distribution coefficient and separation factors were calculated according to the tie-line data and water was considered to be the suitable solvent to extract 1,6-hexanediol. (stappenindestad.nl)
  • Articles of Dimethyl adipate are included as well. (stappenindestad.nl)
  • Occupational exposure to dimethyl adipate may occur through inhalation and dermal contact with this compound at workplaces where dimethyl adipate is produced or used as a plasticizer. (lottoresultaten.be)
  • The general population may be exposed to dimethyl adipate via inhalation or dermal contact with finish removers in which, dimethyl adipate is used as a solvent. (lottoresultaten.be)
  • Although the main commercial interest in adipates is related to the production of nylons, this diester is used as a plasticizer, a solvent for paint stripping and resins, and a pigment dispersant. (wikipedia.org)
  • In vitro dermal absorption experiments were conducted using a roll-on deodorant that contains 1.56% di(2-ethylhexyl) adipate (DEHA), a plasticizer widely used in consumer products. (sigmaaldrich.com)
  • Zhejiang Jiaao Enprotech Stock Co.,Ltd is one of the top level China plasticizer manufacturers and suppliers, with professional factory, we are always able to offer you best plasticizer, stabilizer, dioctyl adipate products. (posbud-ogrodzenia.pl)
  • This invention relates to a novel group of plasticizers for polyvinyl butyral wherein the plasticizer comprises a mixture of at least one triethylene glycol diester of a monocarboxylic acid having a carbon chain comprising 7 or 8 carbon atoms and at least one dialkyl adipate in which the alkyl group contains from 3 to 8 carbon atoms or at least one alkyl alkylaryl adipate. (posbud-ogrodzenia.pl)
  • The polyester adipate plasticizer product group offers excellent oil resistance and non-migratory property, as well as low volatility.In addition, D645 has high molecular weight for a member of the polyester adipate plasticizer product group and excellent heat-aging resistance. (m-chemical.co.jp)
  • D645 has high molecular weight for a member of the polyester adipate plasticizer product group and by its characteristically excellent heat-aging resistance. (m-chemical.co.jp)
  • D640A has a relatively low molecular weight for a member of the polyester adipate plasticizer product group. (m-chemical.co.jp)
  • Epoxy Fatty Acid Methyl Ester /dioctyl Adipate Plasticizer , Find Complete Details about Epoxy Fatty Acid Methyl Ester /dioctyl Adipate Plasticizer,Plasticizer,Dioctyl Adipate,Fatty Acid from Electronics Chemicals Supplier or Manufacturer-Tanyun Junrong (Liaoning) Chemical Research Institute New Materials Incubator Co., Ltd. (lottoresultaten.be)
  • Plastic Eco-plasticizer Efame Dioctyl Adipate Doa Plasticizer , Find Complete Details about Plastic Eco-plasticizer Efame Dioctyl Adipate Doa Plasticizer,Epoxidized Soybean Oil,Dioctyl Adipate Doa Plasticizer 123-79-5,Epoxy Fatty Acid Methyl Ester from Electronics Chemicals Supplier or Manufacturer-Hebei Jingu Plasticizer Co., Ltd. (lottoresultaten.be)
  • plasticizers: doa DOA, dioctyl adipate is a primary plasticizer resulting from the esterification of 2-Ethyl Hexanol with Adipic Acid, it is the most important in the adipate group, it offers a high efficiency, better flexibility properties at low temperatures and resistance to the loss of color by exposure to heat and ultraviolet light. (nijmegen-nieuws.nl)
  • Dioctyl adipate (DOA) is a light colored, oily liquid generally used as a plasticizer for PVC. (nijmegen-nieuws.nl)
  • DOA, dioctyl adipate is a primary plasticizer. (nijmegen-nieuws.nl)
  • DOA, dioctyl adipate is a primary plasticizer resulting from the esterification of 2- Ethyl Hexanol with Adipic Acid, it is the most important in the adipate group. (nijmegen-nieuws.nl)
  • PubMed:Migration of di-(2-ethylhexylexyl)adipate plasticizer from food-grade polyvinyl chloride film into hard and soft cheeses. (nijmegen-nieuws.nl)
  • Diocty Adipate (DOA) is an excellent cold-resistant plasticizer,it has plasticized high efficiency,low volatility,When using as paste it has low initial viscosity,good viscosity stability, many countries allow this plasticizer to be used as food packing material such as USA, France, Italy ,Japan,Holland etc. (nijmegen-nieuws.nl)
  • Poly(glycerol adipate) (PGA) is a biodegradable polymer with promising features for nanoparticulate drug carrier systems. (unboundmedicine.com)
  • Home Advanced Materials Research AICAM 2005 Chain Extension of Poly(butylene adipate) with. (scientific.net)
  • Low molecular weight poly(butylene adipate) (PBA) was synthesized by melt polycondensation. (scientific.net)
  • In this work, composite polystyrene/titanium dioxide (PS/TiO(sub2)) electrospun fibers were used as a reinforcement for a poly(butylene succinate-co-adipate) (PBSA) matrix. (csir.co.za)
  • 2014. Polystyrene/TiO2 composite electrospun fibers as fillers for poly(butylene succinate-co-adipate): Structure, morphology and properties. (csir.co.za)
  • Optimising Ductility of Poly(Lactic Acid)/Poly(Butylene Adipate-co-Terephthalate) Blends Through. (deepdyve.com)
  • Thomas, Noreen 2018-06-01 00:00:00 Keywords Poly(lactic acid) · Poly(butylene adipate-co-terephthalate) · Co-continuous phase · Biodegradable · Blends Extended author information available on the last page of the article Vol:.(1234567890) 1 3 Journal of Polymers and the Environment (2018) 26:3802-3816 3803 hydrophilic properties [2]. (deepdyve.com)
  • Jiang Poly(butylene adipate-co-terephthalate) (PBAT) is a ductile et al. (deepdyve.com)
  • The films made from this aliphatic polyester tend to be brittle which can be overcome by blending PLA with another bio-based polymer with high flexibility poly(butylene adipate-co-terephthalate) (PBAT), but the resultant blend is only biodegradable in composting conditions. (k-state.edu)
  • Novel Poly (glycerol-adipate) Polymers Used for Nanoparticle Making: A Study of Surface Free Energy', Iranian Journal of Pharmaceutical Research , Volume 7(Number 1), pp. 11-19. (ac.ir)
  • Poly(butylene succinate) and Poly(butylene adipate) - Quantitative Determination of Degradation Products and Application as PVC Plasticizers Annika Lindström AKADEMISK AVHANDLING som med tillstånd av Kungliga Tekniska Högskolan framlägges till offentlig granskning för avläggande av teknisk licentiatexamen fredagen den 11 februari 2005, kl. (posbud-ogrodzenia.pl)
  • Development of poly(glycerol adipate) nanoparticles loaded with non-steroidal anti-inflammatory drugs. (ru.nl)
  • The aim of this study was to assess acylated and non-acylated poly(glycerol adipate) polymers (PGA) as suitable nanoparticulate systems for encapsulation and release of ibuprofen, ibuprofen sodium salt (IBU-Na) and ketoprofen as model drugs. (ru.nl)
  • Poly(glycerol-adipate) (PGA) is a biocompatible and biodegradable polymer that can be used to produce self-assembled nanoparticles (NPs) able to encapsulate active ingredients, with encouraging perspectives for drug delivery purposes. (herts.ac.uk)
  • The effect of electric field on phase separation behavior and crystallization kinetics in binary semicrystalline blends of poly(vinylidene fluoride) (PVDF) and poly(1,4-butylene adipate) (PBA) has been investigated by means of time-resolved small-angle light scattering (SALS) and polarizing optical microscopy. (elsevier.com)
  • We report the photochemically induced molecular transformations of the poly(butylene adipate-co-terephthalate) (PBAT) polymer by quantifying the reaction rate constants (k) and yields for the primary photochemical pathways, including Norrish type I and II scission reactions, oxidation through hydroxylation of the terephthalate, and cross-linking. (umn.edu)
  • Maurer-Jones, MA & Monzo, EM 2021, ' Quantifying Photochemical Transformations of Poly(butylene adipate- co-terephthalate) Films ', ACS Applied Polymer Materials , vol. 3, no. 2, pp. 1003-1011. (umn.edu)
  • Monzo, Ellen M. / Quantifying Photochemical Transformations of Poly(butylene adipate- co-terephthalate) Films . (umn.edu)
  • Emulsion blending as a new method to combine a water-soluble biopolymer, gelatin, with a synthetic biodegradable elastomer, poly(butylene succinate-co-adipate) (PBSA), was investigated. (unipi.it)
  • In this paper, we investigate the impact of retting by NaOH alkaline soak and enzymatic retting using pectinase on the crystallization and mechanical performance of a biopolymer blend of poly(hydroxybutyrate-co- valerate)/poly(butylene adipate-co-terephthalate). (unthsc.edu)
  • The crystalline/crystalline poly(l-lactic acid)/poly(1,4-butylene adipate) (PLLA/PBA) blend system exhibits upper critical solution temperature (UCST) behavior below the melting temperature of PLLA. (ncku.edu.tw)
  • How can we support you with Diisopropyl Adipate? (imcdus.com)
  • Adipates are the salts and esters of adipic acid. (wikipedia.org)
  • The anionic (HO2C(CH2)4CO2−) and dianionic (−O2C(CH2)4CO2−) forms of adipic acid are also referred to as adipate. (wikipedia.org)
  • An adipate is a salt or ester of adipic acid. (answers.com)
  • Adipic acid and adipates can be used by all religious groups, vegans and vegetarians. (foodnetindia.in)
  • Sodium adipate is the sodium salt of adipic acid which is obtained by the oxidation of fat. (noshly.com)
  • Dioctyl Adipate Doa(cas Rn : 103-23-1 ) For Polyester Adipate , Find Complete Details about Dioctyl Adipate Doa(cas Rn : 103-23-1 ) For Polyester Adipate,Polyester Adipate,Polyester Adipate,Dioctyl Adipate from Other Organic Intermediates Supplier or Manufacturer-Tanyun Junrong (Liaoning) Chemical Research Institute New Materials Incubator Co., Ltd. (posbud-ogrodzenia.pl)
  • In vitro dermal absorption of di(2-ethylhexyl) adipate (DEHA) in a roll-on deodorant using human skin. (sigmaaldrich.com)
  • Food-grade polyvinyl chloride (PVC) cling-film containing 5.3% (w/w) di(2-ethylhexyl) adipate (DEHA) and 3.0% (w/w) acetyltributyl citrate (ATBC) plasticizers was used to wrap halawa tehineh (halva) samples. (openarchives.gr)
  • Recently published Advanced report on Global Diethyl Adipate market offers an insightful take on the drivers and restraints present in the market. (theloop21.com)
  • The report begins with a brief presentation and market summary of Diethyl Adipate market about the current market landscape, coming market trends, leading market players, product type, application, and region. (theloop21.com)
  • The research report covers the trends that are currently displayed by the main companies in the Diethyl Adipate market including the appropriation of new technology. (theloop21.com)
  • The Diethyl Adipate market report covers all the features of the trade with a dedicated examination of key players Hangzhou Qianyang Technology, Eastman, Changzhou XiaQing Chemical, Weifang Bincheng Chemical and Weifang Limin Chemical that includes market leaders, supporters, and new players by region North America, the market in Europe, the market in the Middle East and Africa, the market in the Asia Pacific and Latin America. (theloop21.com)
  • Type Segments: This Diethyl Adipate market report shows the growth of the market for various types of products marketed by the most comprehensive companies. (theloop21.com)
  • Manufacturing Profiles: The top players in the Diethyl Adipate market are detailed in the report based on their market size, served market, products, applications, regional growth, and other factors. (theloop21.com)
  • piperazine adipate api manufacturer, piperazine adipate api exporter, piperazine adipate api supplier, piperazine adipate derivatives, piperazine adipate manufacturer in india. (saintroylifescience.com)
  • Hydroxyl value is measured by titrating a known mass of glycol adipate polyol against potassium hydroxide (KOH), and is expressed as mg KOH/g. (tri-iso.com)
  • In cosmetics and personal care products, Dibutyl Adipate is used in nail polish and skin care products. (cosmeticsinfo.org)
  • Dibutyl Adipate softens synthetic polymers by reducing brittleness and cracking. (cosmeticsinfo.org)
  • The CIR Expert Panel evaluated the scientific data and concluded that Dibutyl Adipate was safe for use as a cosmetic ingredient. (cosmeticsinfo.org)
  • CIR Safety Review: Dibutyl Adipate was not toxic in acute oral or dermal toxicity tests. (cosmeticsinfo.org)
  • Dibutyl Adipate was observed to be a low level skin and eye irritant and a non-sensitizer. (cosmeticsinfo.org)
  • Dibutyl Adipate was not genotoxic in two test systems. (cosmeticsinfo.org)
  • Dibutyl Adipate at 0.1% was not an ocular irritant in two male volunteers. (cosmeticsinfo.org)
  • Dibutyl Adipate produced no effect. (cosmeticsinfo.org)
  • The CIR Expert Panel recognized that use of Dibutyl Adipate in suntan cosmetic products will result in repeated, frequent exposure in a leave-on product. (cosmeticsinfo.org)
  • Combined with the data demonstrating very little acute toxicity, no skin or ocular irritation, and no reproductive or developmental toxicity, these data provided an adequate basis for reaching a conclusion that Dibutyl Adipate was safe as a cosmetic and personal care product ingredient. (cosmeticsinfo.org)
  • Dibutyl Adipate may be used in cosmetics and personal care products marketed in Europe according to the general provisions of the Cosmetics Regulation of the European Union . (cosmeticsinfo.org)
  • Another technical name for Dibutyl Adipate is Hexanedioic Acid, Dibutyl Ester . (cosmeticsinfo.org)
  • Its flash point is greater than 230 F. Dibutyl adipate is soluble in alcohol and ether and insoluble in water. (chemicalbook.com)
  • Offering you a complete choice of products which include basf hexamoll dinch plasticizers, dioctyl phthalate dop, dibutyl phthalate, dioctyl adipate, chlorinated paraffin wax and epoxidized soybean oil. (nijmegen-nieuws.nl)
  • The current research is focused on evaluating polybutyrate-adipate-terephthalate-polymer (PBAT) for fused deposition modelling. (mdpi.com)
  • New glycerol adipate polymers with hydroxyl group substituted with different percent of acyl group, sited as figures within the abbreviated name in the text, and triptophan were synthesized and proposed to be used in the preparction of dexamethason phosphate loaded nanoparticles, using the evaporation-deposition technique. (ac.ir)
  • Bis[2-(2-butoxyethoxy)ethyl]adipate, is used to improve cold flexibility and/or hydrocarbons extraction in both PVC and polar rubbers compounds. (plasticisers.org)
  • In addition to this, Ammonium Adipate chemical offered by us is available to customers in bulk amount as per their requirement at market leading prices. (shreejiexports.net)
  • ECHA organiseert raadplegingen om van alle geïnteresseerde partijen feedback te krijgen en om zo breed mogelijke wetenschappelijke informatie te verzamelen voor de regelgevingsprocedures. (europa.eu)
  • It captures spiramycin adipate market trends, pays close attention to spiramycin adipate manufacturers and names suppliers. (marketpublishers.com)
  • The legal limit for di(2-ethylhexyl) adipate, established in 1992, was based on a toxicity study in laboratory animals conducted in the 1980s. (ewg.org)
  • These characteristics include: the hydroxyl number or hydroxyl value (OH value), OH equivalent weight, molecular weight, and the functionality of the glycol adipate polyol. (tri-iso.com)
  • Lower hydroxyl values indicate lower hydroxyl content and a higher molecular weight for the overall glycol adipate polyol. (tri-iso.com)
  • The synthesis, characterization, single crystal structure and magnetic properties of the compound [(CuN3(OH2))2(adp)]n (1) are presented, in which adp stands for the adipate(2-) anion. (st-andrews.ac.uk)
  • Cite this entry as: Gooch J.W. (2011) 1,3-Butylene Glycol Adipate Polyester. (posbud-ogrodzenia.pl)
  • The polyester adipate product group of plasticizers offers excellent oil resistance and non-migration, as well as low volatility. (m-chemical.co.jp)
  • Di(2-ethylhexyl) adipate is used in PVC plastic, plastic wrap and other consumer products. (ewg.org)
  • Adipates are colourless and odourless and they are used in a number of coating, washing and cleaning applications, lubricants and greases, plant protection products, adhesive and sealants, polishes and waxes. (plasticisers.org)
  • Wego is a supplier and distributor of Dicapryl Adipate worldwide. (wegochem.com)
  • There are several key characteristics which define what performance properties a given glycol adipate polyol will impart in a given polyurethane. (tri-iso.com)
  • 2018. "Extrusion 3D Printing of Polybutyrate-Adipate-Terephthalate-Polymer Composites in the Pellet Form. (mdpi.com)
  • Spiramycin adipate (CAS 1405-20-5) Market Research Report 2018 aims at providing comprehensive data on spiramycin adipate market globally and regionally (Europe, Asia, North America, Latin America etc. (marketpublishers.com)
  • Spiramycin adipate (CAS 1405-20-5) Market Research Report 2018 contents were prepared and placed on the website in January, 2018. (marketpublishers.com)
  • Please note that Spiramycin adipate (CAS 1405-20-5) Market Research Report 2018 is a half ready publication and contents are subject to change. (marketpublishers.com)
  • Co adipate, Co(C 6 H 8 O 4 ), has been found to order near 10 K into a magnetic structure featuring sheets of tetrahedral Co cations coupled antiferromagnetically in two dimensions through carboxylate groups. (rsc.org)
  • It is the most important in the adipate group, it offers a high efficiency, better flexibility properties at low temperatures and resistance to the loss of color by exposure to heat and ultraviolet light. (nijmegen-nieuws.nl)