AnatomyOrganismsDiseasesChemicals and DrugsPhenomena and ProcessesTechnology, Industry, AgricultureGeographicals
Adenosylmethionine DecarboxylaseMitoguazoneCarboxy-LyasesPolyaminesPutrescineS-AdenosylmethionineOrnithine DecarboxylaseSpermidineDiaminesS-AdenosylhomocysteineGlutamate DecarboxylaseDopa DecarboxylaseHistidine DecarboxylaseMethionineMethylationUroporphyrinogen DecarboxylaseOrotidine-5'-Phosphate DecarboxylaseTyrosine DecarboxylaseEflornithineAromatic-L-Amino-Acid DecarboxylasesEpitestosteroneBreast NeoplasmsDose-Response Relationship, DrugCell Line, TumorSperminePhenylacetatesBerlinHomogentisic AcidAcetalsCatalysisCamellia sinensisCamelliaRhododendronTeaClonorchis sinensisCatechinPlant Extracts
Adenosylmethionine Decarboxylase
An enzyme that catalyzes the decarboxylation of S-adenosyl-L-methionine to yield 5'-deoxy-(5'-),3-aminopropyl-(1), methylsulfonium salt. It is one of the enzymes responsible for the synthesis of spermidine from putrescine. EC 4.1.1.50.
Mitoguazone
Antineoplastic agent effective against myelogenous leukemia in experimental animals. Also acts as an inhibitor of animal S-adenosylmethionine decarboxylase.
Carboxy-Lyases
Enzymes that catalyze the addition of a carboxyl group to a compound (carboxylases) or the removal of a carboxyl group from a compound (decarboxylases). EC 4.1.1.
Polyamines
Putrescine
A toxic diamine formed by putrefaction from the decarboxylation of arginine and ornithine.
S-Adenosylmethionine
Physiologic methyl radical donor involved in enzymatic transmethylation reactions and present in all living organisms. It possesses anti-inflammatory activity and has been used in treatment of chronic liver disease. (From Merck, 11th ed)
Ornithine Decarboxylase
A pyridoxal-phosphate protein, believed to be the rate-limiting compound in the biosynthesis of polyamines. It catalyzes the decarboxylation of ornithine to form putrescine, which is then linked to a propylamine moiety of decarboxylated S-adenosylmethionine to form spermidine.
Spermidine
A polyamine formed from putrescine. It is found in almost all tissues in association with nucleic acids. It is found as a cation at all pH values, and is thought to help stabilize some membranes and nucleic acid structures. It is a precursor of spermine.
Diamines
Organic chemicals which have two amino groups in an aliphatic chain.
S-Adenosylhomocysteine
5'-S-(3-Amino-3-carboxypropyl)-5'-thioadenosine. Formed from S-adenosylmethionine after transmethylation reactions.
Glutamate Decarboxylase
A pyridoxal-phosphate protein that catalyzes the alpha-decarboxylation of L-glutamic acid to form gamma-aminobutyric acid and carbon dioxide. The enzyme is found in bacteria and in invertebrate and vertebrate nervous systems. It is the rate-limiting enzyme in determining GAMMA-AMINOBUTYRIC ACID levels in normal nervous tissues. The brain enzyme also acts on L-cysteate, L-cysteine sulfinate, and L-aspartate. EC 4.1.1.15.
Dopa Decarboxylase
One of the AROMATIC-L-AMINO-ACID DECARBOXYLASES, this enzyme is responsible for the conversion of DOPA to DOPAMINE. It is of clinical importance in the treatment of Parkinson's disease.
Histidine Decarboxylase
An enzyme that catalyzes the decarboxylation of histidine to histamine and carbon dioxide. It requires pyridoxal phosphate in animal tissues, but not in microorganisms. EC 4.1.1.22.
Methionine
A sulfur-containing essential L-amino acid that is important in many body functions.
Methylation
Addition of methyl groups. In histo-chemistry methylation is used to esterify carboxyl groups and remove sulfate groups by treating tissue sections with hot methanol in the presence of hydrochloric acid. (From Stedman, 25th ed)
Uroporphyrinogen Decarboxylase
An enzyme that catalyzes the decarboxylation of UROPORPHYRINOGEN III to coproporphyrinogen III by the conversion of four acetate groups to four methyl groups. It is the fifth enzyme in the 8-enzyme biosynthetic pathway of HEME. Several forms of cutaneous PORPHYRIAS are results of this enzyme deficiency as in PORPHYRIA CUTANEA TARDA; and HEPATOERYTHROPOIETIC PORPHYRIA.
Orotidine-5'-Phosphate Decarboxylase
Orotidine-5'-phosphate carboxy-lyase. Catalyzes the decarboxylation of orotidylic acid to yield uridylic acid in the final step of the pyrimidine nucleotide biosynthesis pathway. EC 4.1.1.23.
Tyrosine Decarboxylase
A pyridoxal-phosphate protein that catalyzes the conversion of L-tyrosine to tyramine and carbon dioxide. The bacterial enzyme also acts on 3-hydroxytyrosine and, more slowly, on 3-hydroxyphenylalanine. (From Enzyme Nomenclature, 1992) EC 4.1.1.25.
Eflornithine
An inhibitor of ORNITHINE DECARBOXYLASE, the rate limiting enzyme of the polyamine biosynthetic pathway.
Aromatic-L-Amino-Acid Decarboxylases
An enzyme group with broad specificity. The enzymes decarboxylate a range of aromatic amino acids including dihydroxyphenylalanine (DOPA DECARBOXYLASE); TRYPTOPHAN; and HYDROXYTRYPTOPHAN.
Epitestosterone
The 17-alpha isomer of TESTOSTERONE, derived from PREGNENOLONE via the delta5-steroid pathway, and via 5-androstene-3-beta,17-alpha-diol. Epitestosterone acts as an antiandrogen in various target tissues. The ratio between testosterone/epitestosterone is used to monitor anabolic drug abuse.
Breast Neoplasms
Tumors or cancer of the human BREAST.
Dose-Response Relationship, Drug
The relationship between the dose of an administered drug and the response of the organism to the drug.
Cell Line, Tumor
A cell line derived from cultured tumor cells.
Spermine
A biogenic polyamine formed from spermidine. It is found in a wide variety of organisms and tissues and is an essential growth factor in some bacteria. It is found as a polycation at all pH values. Spermine is associated with nucleic acids, particularly in viruses, and is thought to stabilize the helical structure.
Phenylacetates
Derivatives of phenylacetic acid. Included under this heading are a variety of acid forms, salts, esters, and amides that contain the benzeneacetic acid structure. Note that this class of compounds should not be confused with derivatives of phenyl acetate, which contain the PHENOL ester of ACETIC ACID.
Berlin
Homogentisic Acid
Acetals
Catalysis
The facilitation of a chemical reaction by material (catalyst) that is not consumed by the reaction.
Camellia sinensis
Camellia sinensis L. (formerly Thea sinensis) is an evergreen Asiatic shrub of the THEACEAE family. The infusion of leaves of this plant is used as Oriental TEA which contains CAFFEINE; THEOPHYLLINE; and epigallocatechin gallate.
Camellia
A plant genus in the family THEACEAE, order THEALES best known for CAMELLIA SINENSIS which is the source of Oriental TEA.
Rhododendron
A plant genus of the family ERICACEAE.
Tea
The infusion of leaves of CAMELLIA SINENSIS (formerly Thea sinensis) as a beverage, the familiar Asian tea, which contains CATECHIN (especially epigallocatechin gallate) and CAFFEINE.
Clonorchis sinensis
A species of trematode flukes of the family Opisthorchidae. Many authorities consider this genus belonging to Opisthorchis. It is common in China and other Asiatic countries. Snails and fish are the intermediate hosts.
Catechin
An antioxidant flavonoid, occurring especially in woody plants as both (+)-catechin and (-)-epicatechin (cis) forms.
Plant Extracts
Concentrated pharmaceutical preparations of plants obtained by removing active constituents with a suitable solvent, which is evaporated away, and adjusting the residue to a prescribed standard.

A new method for the assay of tissue. S-adenosylhomocysteine and S-adenosylmethione. Effect of pyridoxine deficiency on the metabolism of S-adenosylhomocysteine, S-adenosylmethionine and polyamines in rat liver. (1/292)

The hepatic synthesis and accumulation of S-adenosylhomocysteine, S-adenosylmethionine and polyamines were studied in normal and vitamin B-6-deficient male albino rats. A method involving a single chromatography on a phosphocellulose column was developed for the determination of S-adenosylhomocysteine and S-adenosylmethionine from tissue samples. Feeding the rat with pyridoxine-deficient diet for 3 or 6 weeks resulted in a four- to five-fold increase in the concentration of S-adenosylhomocysteine, whereas that of S-adenosylmethionine was only slighly elevated. The concentration of putrescine was decreased to half, that of spermidine was somewhat decreased and that of spermine remained fairly constant. The activities of L-ornithine decarboxylase, S-adenosyl-L-methionine decarboxylase, L-methionine adenosyltransferase and S-adenosyl-L-homocysteine hydrolase were moderately increased. S-Adenosylmethionine decarboxylase showed no requirement for pyridoxal 5'-phosphate. The major effect of pyridoxine deficiency of S-adenosylmethionine metabolism seems to be a block in the utilization of S-adenosylhomocysteine, resulting in the accumulation of this metabolite to a concentration that may inhibit biological methylation reactions.  (+info)

Agmatine modulates polyamine content in hepatocytes by inducing spermidine/spermine acetyltransferase. (2/292)

Agmatine has been proposed as the physiological ligand for the imidazoline receptors. It is not known whether it is also involved in the homoeostasis of intracellular polyamine content. To show whether this is the case, we have studied the effect of agmatine on rat liver cells, under both periportal and perivenous conditions. It is shown that agmatine modulates intracellular polyamine content through its effect on the synthesis of the limiting enzyme of the interconversion pathway, spermidine/spermine acetyltransferase (SSAT). Increased SSAT activity is accompanied by depletion of spermidine and spermine, and accumulation of putrescine and N1-acetylspermidine. Immunoblotting with a specific polyclonal antiserum confirms the induction. At the same time S-adenosylmethionine decarboxylase activity is significantly increased, while ornithine decarboxylase (ODC) activity and the rate of spermidine uptake are reduced. This is not due to an effect on ODC antizyme, which is not significantly changed. All these modifications are observed in HTC cells also, where they are accompanied by a decrease in proliferation rate. SSAT is also induced by low oxygen tension which mimics perivenous conditions. The effect is synergic with that promoted by agmatine.  (+info)

Mechanistic studies of the processing of human S-adenosylmethionine decarboxylase proenzyme. Isolation of an ester intermediate. (3/292)

Human S-adenosylmethionine decarboxylase is synthesized as a proenzyme that undergoes an autocatalytic cleavage reaction generating the alpha and beta subunits and forming the pyruvate prosthetic group, which is derived from an internal Ser residue (Ser-68). The mechanism of this processing reaction was studied using site-directed mutagenesis of conserved residues (His-243 and Ser-229) located close to the cleavage site. Mutant S229A failed to process, and mutant S229C cleaved very slowly, whereas mutant S229T processed normally, suggesting that the hydroxyl group of residue 229 is required for the processing reaction where Ser-229 may act as a proton acceptor. Mutant His-243A cleaved very slowly, forming a small amount of the correctly processed pyruvoyl enzyme but a much larger proportion of the alpha subunit with an amino-terminal Ser. The cleavage to form the latter was greatly enhanced by hydroxylamine. This result suggests that the N-O acyl shift needed for ester formation occurs normally in this mutant but that the next step, which is a beta-elimination reaction leading to the two subunits, does not occur. His-243 may therefore act as the basic residue that extracts the hydrogen of the alpha-carbon of Ser-68 in the ester in order to facilitate this reaction. The availability of the recombinant H243A S-adenosylmethionine decarboxylase proenzyme provides a useful model system to examine the processing reaction in vitro and test the design of specific inactivators aimed at blocking the production of the pyruvoyl prosthetic group.  (+info)

Identification of functionally important residues of Arabidopsis thaliana S-adenosylmethionine decarboxylase. (4/292)

The Arabidopsis thaliana S-adenosylmethionine decarboxylase (AdoMetDC) cDNA (GenBank(TM) U63633) was cloned, and the AdoMetDC protein was expressed, purified, and characterized. The K(m) value for S-adenosylmethionine (AdoMet) is 23.1 microM and the K(i) value for methylglyoxal bis-(guanylhydrazone) (MGBG) is 0.15 microM. Site-specific mutagenesis was performed on the AdoMetDC to introduce mutations at conserved cysteine (Cys(50), Cys(83), and Cys(230)) and lysine(81) residues, chosen by examination of the conserved sequence and proved to be involved in enzymatic activity by chemical modification. The AdoMetDC mutants K81A and C83A retained up to 60 and 10% of wild type activity, respectively, demonstrating that lysyl and sulfhydryl groups are required for full catalytic activity. However, changing Cys(50) and Cys(230) to alanine had minimal effects on the catalytic activity. Changing Lys(81) to alanine produced an altered substrate specificity. When lysine was used as a substrate instead of AdoMet, the substrate specificity for lysine increased 6-fold. The K(m) value for AdoMet is 11-fold higher than that of the wild type, but the V(max) value is more than 60%. Taken together, the results suggest that the lysine(81) residue is critical for substrate binding.  (+info)

Putrescine does not support the migration and growth of IEC-6 cells. (5/292)

The migration of IEC-6 cells is inhibited when the cells are depleted of polyamines by inhibiting ornithine decarboxylase with alpha-difluoromethylornithine (DFMO). Exogenous putrescine, spermidine, and spermine completely restore cell migration inhibited by DFMO. Because polyamines are interconverted during their synthesis and catabolism, the specific role of individual polyamines in intestinal cell migration, as well as growth, remains unclear. In this study, we used an inhibitor of S-adenosylmethionine decarboxylase, diethylglyoxal bis(guanylhydrazone)(DEGBG), to block the synthesis of spermidine and spermine from putrescine. We found that exogenous putrescine does not restore migration and growth of IEC-6 cells treated with DFMO plus DEGBG, whereas exogenous spermine does. In addition, the normal distribution of actin filaments required for migration, which is disrupted in polyamine-deficient cells, could be achieved by adding spermine but not putrescine along with DFMO and DEGBG. These results indicate that putrescine, by itself, is not essential for migration and growth, but that it is effective because it is converted into spermidine and/or spermine.  (+info)

Tumor progression is accompanied by significant changes in the levels of expression of polyamine metabolism regulatory genes and clusterin (sulfated glycoprotein 2) in human prostate cancer specimens. (6/292)

Using Northern blotting, the expression levels of the genes for polyamine metabolism regulatory proteins and clusterin have been measured in a series of 23 human prostate cancers (CaPs) dissected from radical prostatectomy specimens. Patient matched, nontumor tissue was dissected from benign areas of the gland. The results indicate that transcripts encoding ornithine decarboxylase (ODC), ODC antizyme, adenosylmethionine decarboxylase, and spermidine/spermine N1-acetyltransferase (SSAT) were significantly higher, whereas clusterin (sulfated glycoprotein 2) mRNA was significantly lower in tumors compared with the benign tissue. All mRNA levels were compared with those of histone H3 and growth arrest-specific gene 1, markers of cell proliferation and cell quiescence, respectively, and glyceraldehyde 3-phosphate dehydrogenase, a housekeeping gene. In poorly differentiated and locally invasive CaPs and in tumors with unfavorable prognosis or total prostate-specific antigen (PSA) levels > 10.0 ng/ml at diagnosis, an overall increase in the levels of H3 mRNA and a decrease in growth arrest-specific gene 1 mRNA was detected, indicative of higher proliferation activity, whereas the differences in expression levels for the polyamine metabolism and clusterin genes were higher. ODC and SSAT changes were positively correlated in normal tissue but not in high-grade cancer, whereas ODC antizyme and SSAT changes were positively correlated in more malignant CaPs but not in normal tissue. Tumor classification based on the changes in expression levels of all of the genes studied could be correlated to differentiation grade and local invasiveness classification systems in 72.2 and 83.3% of the cases, respectively. In a 1-year follow-up period, three patients whose CaPs ranked as less aggressive according to clinical staging, but classified as advanced cancers with the proposed molecular classification, showed increases in total PSA levels, indicative of tumor relapse. Thus, molecular classification, based on gene expression, may enhance the available prognostic tools for prostate tumors.  (+info)

Changes in gene expression in response to polyamine depletion indicates selective stabilization of mRNAs. (7/292)

We used differential display analysis to identify mRNAs responsive to changes in polyamine synthesis. As an overproducing model we used the kidneys of transgenic hybrid mice overexpressing ornithine decarboxylase and S-adenosylmethionine decarboxylase, two key enzymes in polyamine biosynthesis. To identify mRNAs that respond to polyamine starvation, we treated Rat-2 cells with alpha-difluoromethylornithine, a specific inhibitor of polyamine biosynthesis. We isolated 41 partial cDNA clones, representing 37 differentially expressed mRNAs. Of these, 15 have similarity with known genes, five appear to be similar to reported expressed sequence tags and seventeen clones were novel sequences. Of the 35 mRNAs expressed differentially after alpha-difluoromethylornithine treatment, 26 were up-regulated. The expression of only three mRNAs was altered in the transgenic animals and all three were down-regulated. Determination of mRNA half-life of three of the mRNAs up-regulated in response to polyamine depletion revealed that the accumulation results from stabilization of the messages. Because most of the transcripts identified from Rat-2 cells suffering polyamine starvation were accumulated, we conclude that polyamine depletion, while blocking cell growth, is stabilizing mRNAs. This may be due to the lack of spermidine for post-translational modification of the eukaryotic initiation factor 5A, which plays a major role in mRNA turnover. The coupling of mRNA stabilization with cell-growth arrest in response to polyamine starvation provides cells with an economical way to resume growth after recovery from polyamine deficiency.  (+info)

In the human malaria parasite Plasmodium falciparum, polyamines are synthesized by a bifunctional ornithine decarboxylase, S-adenosylmethionine decarboxylase. (8/292)

The polyamines putrescine, spermidine, and spermine are crucial for cell differentiation and proliferation. Interference with polyamine biosynthesis by inhibition of the rate-limiting enzymes ornithine decarboxylase (ODC) and S-adenosylmethionine decarboxylase (AdoMetDC) has been discussed as a potential chemotherapy of cancer and parasitic infections. Usually both enzymes are individually transcribed and highly regulated as monofunctional proteins. We have isolated a cDNA from the malaria parasite Plasmodium falciparum that encodes both proteins on a single open reading frame, with the AdoMetDC domain in the N-terminal region connected to a C-terminal ODC domain by a hinge region. The predicted molecular mass of the entire transcript is 166 kDa. The ODC/AdoMetDC coding region was subcloned into the expression vector pASK IBA3 and transformed into the AdoMetDC- and ODC-deficient Escherichia coli cell line EWH331. The resulting recombinant protein exhibited both AdoMetDC and ODC activity and co-eluted after gel filtration on Superdex S-200 at approximately 333 kDa, which is in good agreement with the molecular mass of approximately 326 kDa determined for the native protein from isolated P. falciparum. SDS-polyacrylamide gel electrophoresis analysis of the recombinant ODC/AdoMetDC revealed a heterotetrameric structure of the active enzyme indicating processing of the AdoMetDC domain. The data presented describe the occurrence of a unique bifunctional ODC/AdoMetDC in P. falciparum, an organization which is possibly exploitable for the design of new antimalarial drugs.  (+info)

Selective regulation of S-adenosylmethionine decarboxylase activity by the spermine analogue 6-spermyne | Biochemical JournalSelective regulation of S-adenosylmethionine decarboxylase activity by the spermine analogue 6-spermyne | Biochemical Journal
Polyamine-biosynthesis activity is known to be negatively regulated by intracellular polyamine pools. Accordingly, treatment of cultured L1210 cells with 10 microM-spermine rapidly and significantly lowered ornithine decarboxylase (ODC) and S-adenosylmethionine decarboxylase (AdoMetDC) activities in a sequential manner. By contrast, treatment for 48 h with 10 microM of the unsaturated spermine analogue 6-spermyne lowered AdoMetDC activity, but not ODC activity. An initial decrease in ODC activity at 2 h was attributed to a transient increase in free intracellular spermidine and spermine brought about through their displacement by the analogue. Thereafter, ODC activity recovered steadily to control values as 6-spermyne pools increased and spermidine and spermine pools decreased owing to analogue suppression of AdoMetDC activity. The apparent ability of 6-spermyne to regulate AdoMetDC, but not ODC, activity suggests an interesting structure-function correlation and demonstrates that the typical ...
http://www.biochemj.org/content/254/2/337
Effect of Inhibitors of S-Adenosylmethionine Decarboxylase on Polyamine Content and Growth of L1210 Cells<...Effect of Inhibitors of S-Adenosylmethionine Decarboxylase on Polyamine Content and Growth of L1210 Cells<...
TY - JOUR. T1 - Effect of Inhibitors of S-Adenosylmethionine Decarboxylase on Polyamine Content and Growth of L1210 Cells. AU - Pegg, Anthony. AU - Jones, Daniel B.. AU - Secrist, John A.. PY - 1988/3/1. Y1 - 1988/3/1. N2 - Analogues of S-adenosylmethionine that were designed as inhibitors of S-adenosylmethionine decarboxylase were tested for their abilities to inhibit the purified enzyme from rat prostate. The most potent inhibitors were 5′-deoxy-5′-[N-methyl-N-[2-(aminooxy)ethyl]amino]adenosine (MAOEA) and 5′-deoxy-5′-[N-methyl-N-(3-hydrazinopropyl)amino]adenosine (MHZPA), which had I50values of 400 nM and 70 nM, respectively, when added directly to the assay medium under standard conditions. These compounds were irreversible inactivators of the enzyme, and more than 95% of the activity was lost within 15 min of exposure to 5 μM MAOEA or 0.5 μM MHZPA. Both inhibitors led to a large reduction in the content of decarboxylated S-adenosylmethionine in LI210 cells and to a substantial ...
https://pennstate.pure.elsevier.com/en/publications/effect-of-inhibitors-of-s-adenosylmethionine-decarboxylase-on-pol
Biochemical and Pharmacological Roles of Adenosylmethionine by Italy) International Round Table on Adenosylmethionine and -...Biochemical and Pharmacological Roles of Adenosylmethionine by Italy) International Round Table on Adenosylmethionine and -...
This booklet contains thirteen chapters and opens with an creation to a few novel biochemical elements of SAM and comparable sulfur compounds, paying specific consciousness to transmethylation reactions; polyamine biosynthesis and strange organic roles of adenosylmethionine; metabolic pathways relating to adenosine-sulfur compounds; and delivery of adenosylmethionine. the next chapters speak about a couple of chemical and biochemical houses of SAM in addition to its pharmacological elements in the CNS. The relation among folate and adenosylmethionine metabolism within the mind is tested, besides the influence of SAM management on noradrenaline and serotonin metabolism in rat mind; cerebral usage of adenosylmethionine and adenosylhomocysteine; and antidepressant results of adenosylmethionine. Methylation in schizophrenia can also be thought of ...
http://threeclassicists.com/books/biochemical-and-pharmacological-roles-of-adenosylmethionine-and-the-central
Engineered polyamine accumulation in tomato enhances phytonutrient content, juice quality, and vine life. - Nuffield Department...Engineered polyamine accumulation in tomato enhances phytonutrient content, juice quality, and vine life. - Nuffield Department...
Polyamines, ubiquitous organic aliphatic cations, have been implicated in a myriad of physiological and developmental processes in many organisms, but their in vivo functions remain to be determined. We expressed a yeast S-adenosylmethionine decarboxylase gene (ySAMdc; Spe2) fused with a ripening-inducible E8 promoter to specifically increase levels of the polyamines spermidine and spermine in tomato fruit during ripening. Independent transgenic plants and their segregating lines were evaluated after cultivation in the greenhouse and in the field for five successive generations. The enhanced expression of the ySAMdc gene resulted in increased conversion of putrescine into higher polyamines and thus to ripening-specific accumulation of spermidine and spermine. This led to an increase in lycopene, prolonged vine life, and enhanced fruit juice quality. Lycopene levels in cultivated tomatoes are generally low, and increasing them in the fruit enhances its nutrient value. Furthermore, the rates of ethylene
https://www.nds.ox.ac.uk/publications/311618
Most recent papers with the keyword Stochastic gene | Read by QxMDMost recent papers with the keyword Stochastic gene | Read by QxMD
In addition to acting as template for protein synthesis, messenger RNA (mRNA) often contains sensory sequence elements that regulate this process. Here we report a new mechanism that limits the number of complete protein molecules that can be synthesized from a single mRNA molecule of the human AMD1 gene encoding adenosylmethionine decarboxylase 1 (AdoMetDC). A small proportion of ribosomes translating AMD1 mRNA stochastically read through the stop codon of the main coding region. These readthrough ribosomes then stall close to the next in-frame stop codon, eventually forming a ribosome queue, the length of which is proportional to the number of AdoMetDC molecules that were synthesized from the same AMD1 mRNA ...
https://www.readbyqxmd.com/keyword/14343
Radical S‐Adenosylmethionine (SAM) SuperfamilyRadical S‐Adenosylmethionine (SAM) Superfamily
A large superfamily of enzymes uses S‐adenosyl‐l‐methionine (SAM) to generate high‐energy carbon radicals as intermediates in a variety of metabolic and biosynthetic reactions
http://www.els.net/WileyCDA/ElsArticle/refId-a0020547.html
Prozyme - SmartPak EquineProzyme - SmartPak Equine
PROZYME is a unique, all natural, high potency supplement, made up of four highly concentrated and purified natural plant-derived enzymes (lipase, amylase, protease, and cellulase)...
https://www.smartpakequine.com/ps/prozyme-2933?cm_mmc=Social-_-Blog-_-Jessica-Normand-_-2933&bvrrp=Main_Site-en_US/reviews/product/2/2933.htm
ProZyme PlusProZyme Plus
As pets age, their systems begin to loose the ability to fully use all the vitamins, minerals, fats, carbohydrates and proteins in their food. ProZyme® Plus helps your pets body absorb all of these nutrients to maintain better health.
http://www.petsupplies4less.com/ProZyme-Plus_p_1408.html
Modifications of major aspects of myocardial ribonucleic acid metabolism as a response to noradrenaline. Action of the hormone...Modifications of major aspects of myocardial ribonucleic acid metabolism as a response to noradrenaline. Action of the hormone...
Treatment of perfused rabbit heart with reserpine causes a decrease of incorporation of labelled precursors into RNA species of subcellular fractions and polyamines. Ornithine decarboxylase, S-adenosylmethionine decarboxylase and cytoplasmic Mn2+-stimulated polyadenylate polymerase activities are not modified. Addition of noradrenaline to reserpine-treated perfused hearts enhances, compared with the control, the incorporation of precursor into RNA in all subcellular fractions other than the nuclear one, restores incorporation of labelled putrescine into polyamines, enhances ornithine decarboxylase and S-adenosylmethionine decarboxylase activities and causes a 12-fold increase in cytoplasmic Mn2+-dependent polyadenylate polymerase activity. After treatment with noradrenaline the increase in radioactivity was found solely in AMP after hydrolysis of microsomal RNA to nucleoside monophosphates. ...
http://www.biochemj.org/content/168/3/341
OriGene - AMD1 (NM 001634) Human ORF cDNA CloneOriGene - AMD1 (NM 001634) Human ORF cDNA Clone
AMD1 - AMD1 (Myc-DDK-tagged)-Human adenosylmethionine decarboxylase 1 (AMD1), transcript variant 1 available for purchase from OriGene - Your Gene Company.
http://www.origene.com/orf_clone/trueclone/NM_001634/RC221424/AMD1.aspx
Biochemical and Pharmacological Roles of Adenosylmethionine and the Central Nervous System | 9780080249292 | VitalSourceBiochemical and Pharmacological Roles of Adenosylmethionine and the Central Nervous System | 9780080249292 | VitalSource
Buy or Rent Biochemical and Pharmacological Roles of Adenosylmethionine and the Central Nervous System as an eTextbook and get instant access.
https://www.vitalsource.com/en-au/products/biochemical-and-pharmacological-roles-of-vincenzo-zappia-v9781483159874
HistCite - main: Papers by DE KoshlandHistCite - main: Papers by DE Koshland
ALLOSTERIC INHIBITION OF METHYLENETETRAHYDROFOLATE REDUCTASE BY ADENOSYLMETHIONINE - EFFECTS OF ADENOSYLMETHIONINE AND NADPH ON THE EQUILIBRIUM BETWEEN ACTIVE AND INACTIVE FORMS OF THE ENZYME AND ON THE KINETICS OF APPROACH TO EQUILIBRIUM ...
https://garfield.library.upenn.edu/histcomp/koshland-de_citing/index-91.html
Sani ProZyme™ Enzymatic Detergent CROSSTEXSani ProZyme™ Enzymatic Detergent CROSSTEX
Sani ProZyme™ Enzymatic Detergent is designed to remove organic and inorganic soils such as blood, tissue and protein-rich fluids from flexible and delicate instruments.
https://www.crosstex.com/sani-prozymetm-enzymatic-detergent-91?industry=2&brand=28
The effects of Prozyme knockout on blood form T. brucei | Open-iThe effects of Prozyme knockout on blood form T. brucei | Open-i
The effects of Prozyme knockout on blood form T. brucei.(A) Cell growth curves. Log cell number versus days in culture. Triangle, Flag-tagged prozyme Expressed
https://openi.nlm.nih.gov/detailedresult.php?img=PMC2562514_ppat.1000183.g003&req=4
Zininga GroupZininga Group
Zininga, T. and Shonhai A. (2014) Are heat shock proteins druggable candidates? American Journal of Biochemistry and Biotechnology, 10: 211-213. Zininga, T., Achilonu, I., Hoppe, H., Prinsloo, E. Dirr, HW. Shonhai A (2016). Plasmodium falciparum Hsp70-z (Hsp110c) exhibits independent chaperone activity and interacts with Hsp70-1 in a nucleotide dependent fashion. Cell Stress and Chaperones, 21(3): 499-513. Makhoba, XH, Burger, A. Coertzen, D., Zininga, T., Birkholtz, L-M., Shonhai, A. (2016). Use of a chimeric Hsp70 to enhance the quality of recombinant Plasmodium falciparum S-Adenosylmethionine Decarboxylase protein produced in Escherichia coli. PLOS One 11(3): e0152626. Zininga T. Pooe, OJ, Makhado, PB, Ramatsui, L, Prinsloo, E, Achilonu, I, Dirr, H, Shonhai, A. (2017). Polymyxin B inhibits the chaperone activity of Plasmodium falciparum Hsp70. Cell Stress and Chaperones, 22(5): 707-715. Zininga, T., Ramatsui, L., Shonhai, A. (2018) Heat shock proteins as Immunomodulants. Molecules, 23 (11), ...
http://www.sun.ac.za/english/faculty/science/biochemistry/Pages/Zininga-Group.aspx
S-Adenosylmethionine (SAMe) | Portsmouth Regional HospitalS-Adenosylmethionine (SAMe) | Portsmouth Regional Hospital
Learn more about S-Adenosylmethionine (SAMe) at Portsmouth Regional Hospital Supplement Forms/Alternate Names Ademetionine S-Adenosylmethionine SAM Uses Principal...
https://portsmouthhospital.com/hl/?/21460/S-Adenosylmethionine&com.dotmarketing.htmlpage.language=1
S-Adenosylmethionine (SAMe) | Memorial HospitalS-Adenosylmethionine (SAMe) | Memorial Hospital
Learn more about S-Adenosylmethionine (SAMe) at Memorial Hospital Supplement Forms/Alternate Names Ademetionine S-Adenosylmethionine SAM Uses Principal Proposed...
https://memorialhospitaljax.com/hl/?/21460/
s-adenosylmethionine (SAMe) | PeaceHealths-adenosylmethionine (SAMe) | PeaceHealth
S-adenosylmethionine (also known as SAMe) is a manmade form of a chemical that occurs naturally in the body. SAMe has been used in alternative medicine as a likely effective aid in reducing the symptoms of depression, and in treating osteoarthritis. SAMe is possibly effective in treating liver disease during pregnancy...
https://www.peacehealth.org/medical-topics/content/multum/d04524a1.html
ProZyme - Unlock the Nutrition in Your Pets Food! - Global Pet Foods HRMProZyme - Unlock the Nutrition in Your Pets Food! - Global Pet Foods HRM
The amazing people in our crew are friendly, passionate, hardworking pet owners. Each brings something to this family of stores and makes us who we are!
http://globalpetfoodshrm.ca/news/prozyme_unlock_the_nutrition_in_your_pets_food/
Polyamine/Methionine cycle (red: analyzed compound; inv | Open-iPolyamine/Methionine cycle (red: analyzed compound; inv | Open-i
Polyamine/Methionine cycle (red: analyzed compound; involved enzymes: 1) S-adenosylmethionine synthetase [EC:2.5.1.6]; 2) S-adenosylmethionine decarboxylase [EC
https://openi.nlm.nih.gov/detailedresult.php?img=PMC4544000_srep13374-f6&req=4
S-Adenosylmethionine (SAMe) | LewisGale Regional Health SystemS-Adenosylmethionine (SAMe) | LewisGale Regional Health System
Learn more about S-Adenosylmethionine (SAMe) at LewisGale Regional Health System Supplement Forms/Alternate Names Ademetionine S-Adenosylmethionine SAM Uses Principal...
https://lewisgale.com/hl/?/21460/SAMe&com.dotmarketing.htmlpage.language=1
S-Adenosylmethionine (SAMe) | Medical Center of AuroraS-Adenosylmethionine (SAMe) | Medical Center of Aurora
Learn more about S-Adenosylmethionine (SAMe) at Medical Center of Aurora Supplement Forms/Alternate Names Ademetionine S-Adenosylmethionine SAM Uses Principal...
https://auroramed.com/hl/?/21460/S-Adenosylmethionine--SAMe
Organic Fertilizer Fermentation System Mchine - Prozyme Bio Industry Sdn.Bhd.Organic Fertilizer Fermentation System Mchine - Prozyme Bio Industry Sdn.Bhd.
Research & Development is the foundation of the continued success of an enterprise henceforth. 24 Hours High Speed Organic Fertilizer Fermentation System. Closed Environment - No Secondary Pollution Temperature, water content and pH are kept at...
https://pbi.en.ecplaza.net/products/organic-fertilizer-fermentation-system-mchine_2480006
Organic Fermentation Machine - Prozyme Bio Industry Sdn.Bhd.Organic Fermentation Machine - Prozyme Bio Industry Sdn.Bhd.
24 High Speed Organic Fermentation Fertilizer Machine We are a manufcturer of organic fertilizer in Malaysia. Technology and consultation provider. Research & Development is the foundation of the continued success of an enterprise henceforth.
https://pbi.en.ecplaza.net/products/organic-fermentation-machine_2480022
TRC | Details of CAS = 326496-02-0, ChemicalName = 6-[[2-(tert-Butyldimethylsilyloxy)ethyl]methylamino]pyridin-3-ol, synonym =...TRC | Details of CAS = 326496-02-0, ChemicalName = 6-[[2-(tert-Butyldimethylsilyloxy)ethyl]methylamino]pyridin-3-ol, synonym =...
Buy high quality 6-[[2-(tert-Butyldimethylsilyloxy)ethyl]methylamino]pyridin-3-ol 326496-02-0 from toronto research chemicals Inc.
https://www.trc-canada.com/product-detail/?B691445
Benzeneacetic acid, alpha-[[(1,1-dimethylethoxy)carbonyl]amino]-4-[2-(methylamino)-2-oxoethoxy]-, (R),Benzeneacetic acid, alpha...Benzeneacetic acid, alpha-[[(1,1-dimethylethoxy)carbonyl]amino]-4-[2-(methylamino)-2-oxoethoxy]-, (R),Benzeneacetic acid, alpha...
Comprehensive supplier list for Benzeneacetic acid, alpha-[[(1,1-dimethylethoxy)carbonyl]amino]-4-[2-(methylamino)-2-oxoethoxy]-, (R),Benzeneacetic acid, alpha-[[(1,1-dimethylethoxy)carbonyl]amino]-4-fluoro-alpha-methyl-
https://www.chemicalregister.com/Companies/AName/Page1084/aidB.htm
ChemIDplus - 10561-01-0 - UQDJZHBCEVUVNR-OWBHPGMISA-N - 3,5-Pyrazolidinedione, 4-(3-chloro-2-butenyl)-1,2-diphenyl- - Similar...ChemIDplus - 10561-01-0 - UQDJZHBCEVUVNR-OWBHPGMISA-N - 3,5-Pyrazolidinedione, 4-(3-chloro-2-butenyl)-1,2-diphenyl- - Similar...
10561-01-0 - UQDJZHBCEVUVNR-OWBHPGMISA-N - 3,5-Pyrazolidinedione, 4-(3-chloro-2-butenyl)-1,2-diphenyl- - Similar structures search, synonyms, formulas, resource links, and other chemical information.
https://chem.nlm.nih.gov/chemidplus/rn/10561-01-0
Effects of growth hormone and glucagon on ornithine decarboxylase activity and adenosine 3,5-Monophosphate levels in isolated...Effects of growth hormone and glucagon on ornithine decarboxylase activity and adenosine 3,5-Monophosphate levels in isolated...
TY - JOUR. T1 - Effects of growth hormone and glucagon on ornithine decarboxylase activity and adenosine 3,5-Monophosphate levels in isolated rat hepatocytes. AU - Klingensmith, Mark R.. AU - Freifeld, Alison G.. AU - Pegg, Anthony E.. AU - Jefferson, Leonard S.. PY - 1980/1. Y1 - 1980/1. N2 - l-Ornithine decarboxylase (l-ornithine carboxylase; E.C. 4.1.1.17) activity was studied in isolated rat hepatocytes maintained as suspensions of free cells. Activity in freshly prepared hepatocytes was reduced to approximately 10% of the amount found in the intact liver. Activity increased to the same level as that found in the intact liver when the cells were incubated for 4 h in medium containing a mixture of 20 amino acids at concentrations 10 times those found in normal rat plasma. The increase in activity between 2 and 4 h of incubation was substantially augmented when the medium also contained 25 μg/ml of a crude preparation of bovine GH (bGH; NIH-GHB18). The increase in activity and the hormone ...
https://experts.nebraska.edu/en/publications/effects-of-growth-hormone-and-glucagon-on-ornithine-decarboxylase
Discovery and Characterization of BlsE, a Radical S-Adenosyl-L-methionine Decarboxylase Involved in the Blasticidin S...Discovery and Characterization of BlsE, a Radical S-Adenosyl-L-methionine Decarboxylase Involved in the Blasticidin S...
PubMed Central Canada (PMC Canada) provides free access to a stable and permanent online digital archive of full-text, peer-reviewed health and life sciences research publications. It builds on PubMed Central (PMC), the U.S. National Institutes of Health (NIH) free digital archive of biomedical and life sciences journal literature and is a member of the broader PMC International (PMCI) network of e-repositories.
http://pubmedcentralcanada.ca/pmcc/articles/PMC3715490/?lang=en-ca
ProzymeProzyme
A plant derived enzyme food supplement, PROZYME is a combination of natural enzymes that help pull nutrients from food that would normally pass right on through. By adding PROZYME to your pets diet, you will restore missing enzyme activity. Better digestion and absorption of their food leads to a healthier pet, improved appetite, and healthier skin and coat. Ingredients: Lactose, dried Aspergillus oryzae fermentation product, dried aspergillus niger fermentation product, and dried bromelain derived from Ananas Comosus. Enzyme Activity: Alpha-Amylase 2000 SKBU/gram, Lipase 200 LU/gram, Cellulase 50 CCHU/gram, Protease 8 GDU/ ...
http://lucy-the-dog.com/prozyme.html
Prozyme Enzyme Supplement 200G - Growlies - Victoria - Growlies Pet FoodsProzyme Enzyme Supplement 200G - Growlies - Victoria - Growlies Pet Foods
Prozyme® Plus All-Natural Enzyme Supplement for Pets is a proven, high-potency, plant-derived powder to support digestion of pets food. Does not contain lactose for pets with sensitivities or those on a vegan diet. Prozyme All-Natural Enzyme combination provides multiple-benefits that may aid with lack of energy, gas
https://growlies.ca/products/prozyme-enzyme-supplement-200g
S-Adenosylmethionine - EDRN Public PortalS-Adenosylmethionine - EDRN Public Portal
S-adenosylmethionine, also known as AdoMet or SAMe, is a biochemical intermediate involved in methyl group transfers. S-adenosylmethionine is formed from from adenosine triphosphate (ATP) and methionine, catalyzed by the enzyme methionine adenosyltransferase. S-adeosylmethionine is sold as a supplement under the common names SAM, SAMe, and SAM-e. A synthesized form of SAM-e is considered a supplement in the U.S., but SAM-e has been sold as a prescription drug in parts of Europe for decades. As a supplement, SAMe has been used to treat osteoarthritis, depression, fibromyalgia, and other conditions. Scientific studies are conflicted on the benefits of SAMe as a supplement.
https://edrn.nci.nih.gov/biomarkers/s-adenosylmethionine
Part 08: AMINO ACIDSPart 08: AMINO ACIDS
Klepacki et al. (Clin Chim Acta. 2013 Jun 5;421:91-7. doi: 10.1016/j.cca.2013.03.003) developed reliable methodology to measure adenosylmethionine (SAM) and S-adenosylhomocysteine (SAH) levels via LC-MS/MS. The found SAH concentrations to be elevated in kidney transplant patients associated with acute rejection and nephrotoxicity events compared to healthy controls and transplant patients without transplant dysfunction. This brings up interesting questions about the role of metabolism […]. ...
https://ommbidblog.com/category/part-08-amino-acids/
Radical S-adenosylmethionine enzymes: mechanism, control and function. - Semantic ScholarRadical S-adenosylmethionine enzymes: mechanism, control and function. - Semantic Scholar
Semantic Scholar extracted view of Radical S-adenosylmethionine enzymes: mechanism, control and function. by Martin R. Challand et al.
https://www.semanticscholar.org/paper/Radical-S-adenosylmethionine-enzymes-mechanism-con-Challand-Driesener/fadfcff1ef57c30ca67282a58cc5a0ddb30fbece
CAS 2212-32-0 2-((2-(dimethylamino)ethyl)methylamino)-ethanol, - BOC SciencesCAS 2212-32-0 2-((2-(dimethylamino)ethyl)methylamino)-ethanol, - BOC Sciences
Boc Sciences is the worlds leading provider for special chemicals. We offer qualified products for 2212-32-0(2-((2-(dimethylamino)ethyl)methylamino)-ethanol,),please inquire us for 2212-32-0(2-((2-(dimethylamino)ethyl)methylamino)-ethanol,).
http://www.bocsci.com/2-2-dimethylamino-ethyl-methylamino-ethanol-cas-2212-32-0-item-63169.html
4-{(1S)-1-Hydroxy-2-[(<sup>2</sup>H<sub>3</sub>)methylamino]ethyl}-1,2-benzenediol |...4-{(1S)-1-Hydroxy-2-[(<sup>2</sup>H<sub>3</sub>)methylamino]ethyl}-1,2-benzenediol |...
Structure, properties, spectra, suppliers and links for: 4-{(1S)-1-Hydroxy-2-[(|sup>2|/sup>H|sub>3|/sub>)methylamino]ethyl}-1,2-benzenediol.
http://www.chemspider.com/Chemical-Structure.78076115.html?rid=316f6b58-54fb-43da-a975-76378ac34695&page_num=0
Benzoic acid,2-[[(1,1-dimethylethoxy)carbonyl]methylamino]- - Alfa ChemistryBenzoic acid,2-[[(1,1-dimethylethoxy)carbonyl]methylamino]- - Alfa Chemistry
Benzoic acid,2-[[(1,1-dimethylethoxy)carbonyl]methylamino]-/ACM141871025 can be provided in Alfa Chemistry. We are dedicated to provide our customers the best products and services.
http://www.alfa-chemistry.com/cas_141871-02-5.htm
S-Adenosylmethionine - Can Sam-E and valerian be mixed?S-Adenosylmethionine - Can Sam-E and valerian be mixed?
3 Answers - Posted in: valerian root, depression, anxiety, osteoarthritis - Answer: Hi, Booetta! The Drugs.com Interaction Checker gave this result:...
https://www.drugs.com/answers/adenosylmethionine-sam-valerian-mixed-3557182.html
Chemical Database: Benzeneacetic acid, alpha-hydroxy-alpha-phenyl-, 2-(2-hydroxy-1,4-dioxo-4-phenyl-2-butenyl) hydrazide, (Z)- ...Chemical Database: Benzeneacetic acid, alpha-hydroxy-alpha-phenyl-, 2-(2-hydroxy-1,4-dioxo-4-phenyl-2-butenyl) hydrazide, (Z)- ...
This page contains information on the chemical Benzeneacetic acid, alpha-hydroxy-alpha-phenyl-, 2-(2-hydroxy-1,4-dioxo-4-phenyl-2-butenyl) hydrazide, (Z)- including: 2 synonyms/identifiers.
https://environmentalchemistry.com/yogi/chemicals/cn/Benzeneacetic%A0acid%2C%A0alpha-hydroxy-alpha-phenyl-%2C%A02-%282-hydroxy-1%2C4-dioxo-4-phenyl-2-butenyl%29%A0hydrazide%2C%A0%28Z%29-.html
SSRIs | Grand Strand HealthSSRIs | Grand Strand Health
Learn more about SSRIs at Grand Strand Medical Center SAMe (S-Adenosylmethionine) and 5-HTP -Possible Harmful Interaction ...
https://grandstrandmed.com/hl/?/21620/Paxil&com.dotmarketing.htmlpage.language=1
Effects of the tumor promotor TPA and serum on ornithine decarboxylase induction and polyamine synthesis in normal and...Effects of the tumor promotor TPA and serum on ornithine decarboxylase induction and polyamine synthesis in normal and...
TY - JOUR. T1 - Effects of the tumor promotor TPA and serum on ornithine decarboxylase induction and polyamine synthesis in normal and transformed fibroblasts. AU - Haddox, M. K.. AU - Magun, B. E.. AU - Russell, D. H.. PY - 1979/1/1. Y1 - 1979/1/1. UR - http://www.scopus.com/inward/record.url?scp=0018565253&partnerID=8YFLogxK. UR - http://www.scopus.com/inward/citedby.url?scp=0018565253&partnerID=8YFLogxK. M3 - Article. AN - SCOPUS:0018565253. VL - 83. SP - No. CU448. JO - Journal of Cell Biology. JF - Journal of Cell Biology. SN - 0021-9525. IS - 2 II. ER - ...
https://ohsu.pure.elsevier.com/en/publications/effects-of-the-tumor-promotor-tpa-and-serum-on-ornithine-decarbox-2
Inhibition of Translation Termination Mediated by an Interaction of Eukaryotic Release Factor 1 with a Nascent Peptidyl-tRNA |...Inhibition of Translation Termination Mediated by an Interaction of Eukaryotic Release Factor 1 with a Nascent Peptidyl-tRNA |...
Peptide sequence-dependent ribosomal stalling, as occurs after translation of uORF2, has been observed in other eukaryotic and bacterial systems (21, 36, 47). Our results raise the question of whether release factors play a role in other uORF-mediated ribosomal stalling events. The S-adenosylmethionine decarboxylase uORF codes for a sequence-dependent polyamine-responsive peptide that, like uORF2, causes ribosomal stalling specifically at the termination codon and results in accumulation of the uORF peptidyl-tRNA (30, 40). While the critical sequences of this uORF do not include the carboxy-terminal residue, the penultimate and antepenultimate residues have been implicated (35). Thus, it is possible that eRF1 acts in concert with the polyamine effector and the nascent peptide to inhibit the termination reaction. Regulation of the bacterial tryptophanase operon gene tnaC also has intriguing similarities to the uORF2 mechanism (22-24). Toeprinting assays show that ribosomes translating tnaC stall ...
https://mcb.asm.org/content/22/24/8562?ijkey=420c05c74f0e5394871c34fa19fc80ed8d99e94c&keytype2=tf_ipsecsha
A rapid method for determining decarboxylase and dihydrolase activity | Journal of Clinical PathologyA rapid method for determining decarboxylase and dihydrolase activity | Journal of Clinical Pathology
A total of 764 fresh clinical isolates were used to test a rapid method for determining lysine, arginine, and ornithine decarboxylase activity as well as arginine dihydrolase activity. The conventional Møller decarboxylase broth was tested in parallel with the rapid method on 234 Enterobacteriaceae and 140 non-fermentative Gram-negative rods. The 0·3% agar method was tested in parallel on 245 Enterobacteriaceae and 146 non-fermentors. All media were checked at half-hour or hourly intervals for up to eight hours, with the final reading taken after incubation for 24 hours at 37°C. The rapid method detected 17 positive decarboxylase or dihydrolase reactions that were not detected by the Møller broth and 16 more than the agar medium when testing Enterobacteriaceae. The corresponding figures for the nonfermentative Gram-negative rods were three and two respectively. Lysine and ornithine decarboxylase were generally detected by the rapid broth in two to four hours incubation while the arginine ...
http://jcp.bmj.com/content/27/2/148
Alfa Aesar™ 4-(Methylamino)phenol sulfate, ACS, 99.0-101.5% 50g Alfa Aesar™ 4-(Methylamino)phenol sulfate, ACS, 99.0-101.5%Alfa Aesar™ 4-(Methylamino)phenol sulfate, ACS, 99.0-101.5% 50g Alfa Aesar™ 4-(Methylamino)phenol sulfate, ACS, 99.0-101.5%
Alfa Aesar™ 4-(Methylamino)phenol sulfate, ACS, 99.0-101.5% 50g Alfa Aesar™ 4-(Methylamino)phenol sulfate, ACS, 99.0-101.5% Mercaptoe to Methoxya...
https://www.fishersci.co.uk/shop/products/4-methylamino-phenol-sulfate-acs-99-0-101-5/11384187
Structural studies of the S-adenosyl-L-methionine binding proteins<...Structural studies of the S-adenosyl-L-methionine binding proteins<...
TY - JOUR. T1 - Structural studies of the S-adenosyl-L-methionine binding proteins. AU - Raju, Deepa K.M.. AU - Ajees, A. Abdul. PY - 2017/1/1. Y1 - 2017/1/1. N2 - The post-genomic era produces an overwhelming amount of experimental data, but majority of such data lacks the characterization of its functions. Structure based approaches are useful to understand and characterize the functional aspects of proteins. Given the burgeoning requirement of understanding the functional aspects of various enzymes, we report a systematic structure based study of methyltransferases bound with S-adenosyl-L-methionine (SAM). Through this work, we identified the conserved amino acids of methyltransferase, which are interacting with SAM.. AB - The post-genomic era produces an overwhelming amount of experimental data, but majority of such data lacks the characterization of its functions. Structure based approaches are useful to understand and characterize the functional aspects of proteins. Given the burgeoning ...
https://manipal.pure.elsevier.com/en/publications/structural-studies-of-the-s-adenosyl-l-methionine-binding-protein
RCSB PDB - 1P7L: S-Adenosylmethionine synthetase complexed with AMPPNP and Met. Literature Report PageRCSB PDB - 1P7L: S-Adenosylmethionine synthetase complexed with AMPPNP and Met. Literature Report Page
1P7L: Crystal structure of the s-adenosylmethionine synthetase ternary complex: a novel catalytic mechanism of s-adenosylmethionine synthesis from ATP and MET.
http://www.rcsb.org/pdb/explore/litView.do?structureId=1P7L
Structure Cluster - 1MXC: S-ADENOSYLMETHIONINE SYNTHETASE WITH 8-BR-ADP 3D Similarity Report PageStructure Cluster - 1MXC: S-ADENOSYLMETHIONINE SYNTHETASE WITH 8-BR-ADP 3D Similarity Report Page
1MXC: Structure and function of S-adenosylmethionine synthetase: crystal structures of S-adenosylmethionine synthetase with ADP, BrADP, and PPi at 28 angstroms resolution.
http://www.rcsb.org/pdb/explore/structureCluster.do?structureId=1MXC
S-Adenosyl-L-methionine | C15H22N6O5S | ChemSpiderS-Adenosyl-L-methionine | C15H22N6O5S | ChemSpider
Structure, properties, spectra, suppliers and links for: S-Adenosyl-L-methionine, Ademetionine, S-Adenosyl methionine, 29908-03-0.
https://www.chemspider.com/Chemical-Structure.31982.html
TRC | Details of CAS = , ChemicalName = N-[3-Amino-4-(methylamino)benzoyl]-N-2-pyridinyl-β-alanine-d3 Ethyl Ester, synonym = ,...TRC | Details of CAS = , ChemicalName = N-[3-Amino-4-(methylamino)benzoyl]-N-2-pyridinyl-β-alanine-d3 Ethyl Ester, synonym = ,...
Buy high quality N-[3-Amino-4-(methylamino)benzoyl]-N-2-pyridinyl-β-alanine-d3 Ethyl Ester from toronto research chemicals Inc.
https://www.trc-canada.com/product-detail/?A611992
2-[[2-(2-Hydroxyethoxy)ethyl]methylamino]ethanol - Alfa Chemistry2-[[2-(2-Hydroxyethoxy)ethyl]methylamino]ethanol - Alfa Chemistry
2-[[2-(2-Hydroxyethoxy)ethyl]methylamino]ethanol/ACM68213989 can be provided in Alfa Chemistry. We are dedicated to provide our customers the best products and services.
http://www.alfa-chemistry.com/cas_68213-98-9.htm
Chemical Database: Barbituric acid, 5-(2-butenyl)-5-(1-methylbutyl)-, sodium salt (EnvironmentalChemistry.com)Chemical Database: Barbituric acid, 5-(2-butenyl)-5-(1-methylbutyl)-, sodium salt (EnvironmentalChemistry.com)
This page contains information on the chemical Barbituric acid, 5-(2-butenyl)-5-(1-methylbutyl)-, sodium salt including: 4 synonyms/identifiers.
https://environmentalchemistry.com/yogi/chemicals/cn/Barbituric%A0acid%2C%A05-%282-butenyl%29-5-%281-methylbutyl%29-%2C%A0sodium%A0salt.html
ChemIDplus - 38171-97-0 - FFQXRZVINHANAL-QPJJXVBHSA-N - 1-Methyl-4-(1-methyl-2-butenyl)naphthalene - Similar structures search,...ChemIDplus - 38171-97-0 - FFQXRZVINHANAL-QPJJXVBHSA-N - 1-Methyl-4-(1-methyl-2-butenyl)naphthalene - Similar structures search,...
38171-97-0 - FFQXRZVINHANAL-QPJJXVBHSA-N - 1-Methyl-4-(1-methyl-2-butenyl)naphthalene - Similar structures search, synonyms, formulas, resource links, and other chemical information.
https://chem.nlm.nih.gov/chemidplus/rn/38171-97-0
Protexin Denamarin Tablets | MedicAnimal.comProtexin Denamarin Tablets | MedicAnimal.com
Denamarin is a liver supplement which has the following benefits: Pure, stabilised S-Adenosylmethionine (SAMe). Enteric coating to prevent isomer...
https://www.medicanimal.com/Protexin-Denamarin-Tablets/p/I0003240
SSRIs | Sky Ridge Medical CenterSSRIs | Sky Ridge Medical Center
Learn more about SSRIs at Sky Ridge Medical Center SAMe (S-Adenosylmethionine) and 5-HTP -Possible Harmful Interaction ...
https://skyridgemedcenter.com/hl/?/21620/Antidepressants
trans-2-Butenyl acetatetrans-2-Butenyl acetate
Make no contact with the spilled material. ELIMINATE all ignition sources and ground all equipment. Stop leak if you can do it without risk. A vapor suppressing foam may be used to reduce vapors. Absorb or cover with dry earth, sand or other non-combustible material and transfer to containers. Use clean non-sparking tools to collect absorbed material ...
http://www.chemicaldictionary.org/dic/T/trans-2-Butenyl-acetate_2533.html
Pyridoxal-dependent decarboxylase domain-containing protein 1Pyridoxal-dependent decarboxylase domain-containing protein 1
MDASLEKIADPTLAEMGKNLKEAVKMLEDSQRRTEEENGKKLISGDIPGPLQGSGQDMVSILQLVQNLMH 1 - 70 GDEDEEPQSPRIQNIGEQGHMALLGHSLGAYISTLDKEKLRKLTTRILSDTTLWLCRIFRYENGCAYFHE 71 - 140 EEREGLAKICRLAIHSRYEDFVVDGFNVLYNKKPVIYLSAAARPGLGQYLCNQLGLPFPCLCRVPCNTVF 141 - 210 GSQHQMDVAFLEKLIKDDIERGRLPLLLVANAGTAAVGHTDKIGRLKELCEQYGIWLHVEGVNLATLALG 211 - 280 YVSSSVLAAAKCDSMTMTPGPWLGLPAVPAVTLYKHDDPALTLVAGLTSNKPTDKLRALPLWLSLQYLGL 281 - 350 DGFVERIKHACQLSQRLQESLKKVNYIKILVEDELSSPVVVFRFFQELPGSDPVFKAVPVPNMTPSGVGR 351 - 420 ERHSCDALNRWLGEQLKQLVPASGLTVMDLEAEGTCLRFSPLMTAAVLGTRGEDVDQLVACIESKLPVLC 421 - 490 CTLQLREEFKQEVEATAGLLYVDDPNWSGIGVVRYEHANDDKSSLKSDPEGENIHAGLLKKLNELESDLT 491 - 560 FKIGPEYKSMKSCLYVGMASDNVDAAELVETIAATAREIEENSRLLENMTEVVRKGIQEAQVELQKASEE 561 - 630 RLLEEGVLRQIPVVGSVLNWFSPVQALQKGRTFNLTAGSLESTEPIYVYKAQGAGVTLPPTPSGSRTKQR 631 - 700 LPGQKPFKRSLRGSDALSETSSVSHIEDLEKVERLSSGPEQITLEASSTEGHPGAPSPQHTDQTEAFQKG 701 - 770 VPHPEDDHSQVEGPESLR 771 - 788 ...
https://pharos.nih.gov/idg/targets/Q6P996
MMP2 Proenzyme protein | Technique alternative | 01011944227MMP2 Proenzyme protein | Technique alternative | 01011944227
MMP2 Proenzyme protein product information; MMP2 Proenzyme protein is available 2 times from supplier fitzgerald at Gentaur.com shop
https://gentaur.com/3554928922/mmp2-proenzyme-protein/fitzgerald?p=1011944227
S-AdenosylmethioninamineS-Adenosylmethioninamine
Adenosylmethionine decarboxylase Spermidine synthase Spermine synthase Thermospermine synthase (ACAULIS5) Takahashi, Taku; ... S-Adenosylmethioninamine (decarboxylated S-adenosyl methionine) is a substrate that is involved in the biosynthesis of ...
https://en.wikipedia.org/wiki/S-Adenosylmethioninamine
AZIN2AZIN2
"Adenovirus-mediated expression of both antisense ornithine decarboxylase and S-adenosylmethionine decarboxylase inhibits lung ... Antizyme inhibitor 2 (AzI2) also known as arginine decarboxylase (ADC) is an enzyme that in humans is encoded by the AZIN2 gene ... Pitkänen LT, Heiskala M, Andersson LC (2001). "Expression of a novel human ornithine decarboxylase-like protein in the central ... López-Contreras AJ, López-Garcia C, Jiménez-Cervantes C, Cremades A, Peñafiel R (2006). "Mouse ornithine decarboxylase-like ...
https://en.wikipedia.org/wiki/AZIN2
LdcC RNA motifLdcC RNA motif
The genes presumably regulated by ldcC RNAs are decarboxylases of arginine, ornithine, S-adenosylmethionine or other substrates ...
https://en.wikipedia.org/wiki/LdcC_RNA_motif
Herbert TaborHerbert Tabor
... and S-adenosylmethionine decarboxylase. Tabor was elected to the National Academy of Sciences in 1977. In 1986, Tabor and his ... The research has concentrated on the structure and regulation of ornithine decarboxylase, spermidine synthase, spermine ...
https://en.wikipedia.org/wiki/Herbert_Tabor
List of MeSH codes (D08)List of MeSH codes (D08)
... adenosylmethionine decarboxylase MeSH D08.811.520.224.125.100 - aromatic-L-amino-acid decarboxylase MeSH D08.811.520.224. ... glutamate decarboxylase MeSH D08.811.520.224.125.300 - histidine decarboxylase MeSH D08.811.520.224.125.350 - indole-3-glycerol ... ornithine decarboxylase MeSH D08.811.520.224.125.450 - orotidine-5'-phosphate decarboxylase MeSH D08.811.520.224.125.500 - ... tyrosine decarboxylase MeSH D08.811.520.224.125.900 - uroporphyrinogen decarboxylase MeSH D08.811.520.224.187 - ...
https://en.wikipedia.org/wiki/List_of_MeSH_codes_(D08)
Spermidine synthaseSpermidine synthase
Spermine synthase Adenosylmethionine decarboxylase Ikeguchi Y, Bewley MC, Pegg AE (January 2006). "Aminopropyltransferases: ... No known spermidine synthase can use S-adenosyl methionine. This is prevented by a conserved aspartatyl residue in the active ... The putrescine-N-methyl transferase whose substrates are putrescine and S-adenosyl methionine and which is evolutionary related ... site, which is thought to repel the carboxyl moiety of S-adenosyl methionine. ...
https://en.wikipedia.org/wiki/Spermidine_synthase
Protein primary structureProtein primary structure
... especially decarboxylases such as S-adenosylmethionine decarboxylase (SAMDC) that exploit the electron-withdrawing power of the ...
https://en.wikipedia.org/wiki/Protein_primary_structure
Adenosylmethionine decarboxylaseAdenosylmethionine decarboxylase
... is an enzyme that catalyzes the conversion of S-adenosyl methionine to S- ... S-adenosylmethionine decarboxylase (AdoMetDC) plays an essential regulatory role in the polyamine biosynthetic pathway by ... Pegg AE, Xiong H, Feith DJ, Shantz LM (November 1998). "S-adenosylmethionine decarboxylase: structure, function and regulation ... Unlike many amino acid decarboxylases AdoMetDC uses a covalently bound pyruvate residue as a cofactor rather than the more ...
https://en.wikipedia.org/wiki/Adenosylmethionine_decarboxylase
Ornithine decarboxylaseOrnithine decarboxylase
"Comparison of androgen regulation of ornithine decarboxylase and S-adenosylmethionine decarboxylase gene expression in rodent ... Ornithine decarboxylase at herkules.oulu.fi Ornithine+decarboxylase at the US National Library of Medicine Medical Subject ... The enzyme ornithine decarboxylase (ODC) catalyzes the decarboxylation of ornithine (a product of the urea cycle) to form ... Therefore, ornithine decarboxylase is an essential enzyme for cell growth, producing the polyamines necessary to stabilize ...
https://en.wikipedia.org/wiki/Ornithine_decarboxylase
S-Adenosyl methionineS-Adenosyl methionine
Here, SAM-e is decarboxylated by adenosylmethionine decarboxylase (EC 4.1.1.50) to form S-adenosylmethioninamine. This compound ... S-Adenosyl methionine (SAM-e) is a common cosubstrate involved in methyl group transfers, transsulfuration, and ... Chiang P, Gordon R, Tal J, Zeng G, Doctor B, Pardhasaradhi K, McCann P (1996). "S-Adenosylmethionine and methylation". FASEB J ... Najm WI, Reinsch S, Hoehler F, Tobis JS, Harvey PW (February 2004). "S-Adenosyl methionine (SAMe) versus celecoxib for the ...
https://en.wikipedia.org/wiki/S-Adenosyl_methionine
Fructose-bisphosphate aldolaseFructose-bisphosphate aldolase
Acetoacetate decarboxylase. *Adenosylmethionine decarboxylase. *Arginine decarboxylase. *Aromatic L-amino acid decarboxylase. * ...
https://en.wikipedia.org/wiki/Aldolase
Category:Protein pages needing a pictureCategory:Protein pages needing a picture
Adenosylmethionine decarboxylase. *Adenylosuccinate synthase. *AdoMet MTase. *Adrenocorticotropic hormone. *AFTPH. *AGCS family ...
https://en.wikipedia.org/wiki/Category:Protein_pages_needing_a_picture
Glutamate decarboxylaseGlutamate decarboxylase
Acetoacetate decarboxylase. *Adenosylmethionine decarboxylase. *Arginine decarboxylase. *Aromatic L-amino acid decarboxylase. * ... Glutamate decarboxylase or glutamic acid decarboxylase (GAD) is an enzyme that catalyzes the decarboxylation of glutamate to ... Role of glutamate decarboxylase in Citrus[edit]. It is also believed that the control of glutamate decarboxylase has the ... Ueno H (October 2000). "Enzymatic and structural aspects on glutamate decarboxylase". Journal of Molecular Catalysis B: ...
https://en.wikipedia.org/wiki/GAD_antibodies
SpermineSpermine
Thereafter the enzyme spermidine synthase effects two N-alkylation by decarboxy-S-Adenosyl methionine. The intermediate is ... Spermine biosynthesis in animals starts with decarboxylation of ornithine by the enzyme Ornithine decarboxylase in the presence ...
https://en.wikipedia.org/wiki/Spermine
PutrescinePutrescine
In one pathway, arginine is converted into agmatine, with a reaction catalyzed by the enzyme arginine decarboxylase (ADC); then ... Spermidine synthase uses putrescine and S-adenosylmethioninamine (decarboxylated S-adenosyl methionine) to produce spermidine. ... Putrescine is synthesized in small quantities by healthy living cells by the action of ornithine decarboxylase. Putrescine is ... arginine is converted into ornithine and then ornithine is converted into putrescine by ornithine decarboxylase (ODC). In rats ...
https://en.wikipedia.org/wiki/Putrescine
MelatoninMelatonin
A decarboxylase with cofactor pyridoxal phosphate (PLP) removes CO2 from 5-hydroxy-L-tryptophan to produce 5-hydroxytryptamine ... N-acetylserotonin is methylated at the hydroxyl position by S-adenosyl methionine (SAM) to produce S-adenosyl homocysteine (SAH ... Hydroxyindole O-methyltransferase and S-adenosyl methionine convert N-acetylserotonin into melatonin through methylation of the ... This intermediate (5-HTP) is decarboxylated by pyridoxal phosphate and 5-hydroxytryptophan decarboxylase to produce serotonin. ...
https://en.wikipedia.org/wiki/Melatonin
MescalineMescaline
These create dopamine, which then experiences methylation by a catechol-O-methyltransferase (COMT) by an S-adenosyl methionine ... Tyrosine can either undergo a decarboxylation via tyrosine decarboxylase to generate tyramine and subsequently undergo an ... monophenol hydroxylase or first be hydroxylated by tyrosine hydroxylase to form L-DOPA and decarboxylated by DOPA decarboxylase ...
https://en.wikipedia.org/wiki/Mescaline
List of EC numbers (EC 4)List of EC numbers (EC 4)
... adenosylmethionine decarboxylase EC 4.1.1.51: 3-hydroxy-2-methylpyridine-4,5-dicarboxylate 4-decarboxylase EC 4.1.1.52: 6- ... EC 4.1.1.1: pyruvate decarboxylase EC 4.1.1.2: oxalate decarboxylase EC 4.1.1.3: oxaloacetate decarboxylase EC 4.1.1.4: ... aspartate 1-decarboxylase EC 4.1.1.12: aspartate 4-decarboxylase EC 4.1.1.13: deleted EC 4.1.1.14: valine decarboxylase EC 4.1. ... aconitate decarboxylase EC 4.1.1.7: benzoylformate decarboxylase EC 4.1.1.8: oxalyl-CoA decarboxylase EC 4.1.1.9: malonyl-CoA ...
https://en.wikipedia.org/wiki/List_of_EC_numbers_(EC_4)
AdrenalineAdrenaline
Then it is subsequently decarboxylated to give dopamine by DOPA decarboxylase (aromatic L-amino acid decarboxylase). Dopamine ... This reaction is catalyzed by the enzyme phenylethanolamine N-methyltransferase (PNMT) which utilizes S-adenosyl methionine ( ...
https://en.wikipedia.org/wiki/Adrenaline
Catechol-O-methyltransferaseCatechol-O-methyltransferase
When given with an inhibitor of dopa decarboxylase (carbidopa or benserazide), levodopa is optimally saved. This "triple ... which is donated by S-adenosyl methionine (SAM). Any compound having a catechol structure, like catecholestrogens and catechol- ...
https://en.wikipedia.org/wiki/Catechol-O-methyltransferase
N,N-DimethyltryptamineN,N-Dimethyltryptamine
"Lack of enhancement of dimethyltryptamine formation in rat brain and rabbit lung in vivo by methionine or S-adenosylmethionine ... the biosynthesis begins with its decarboxylation by an aromatic amino acid decarboxylase (AADC) enzyme (step 1). The resulting ... catalyzes the transfer of a methyl group from cofactor S-adenosyl-methionine (SAM), via nucleophilic attack, to tryptamine. ...
https://en.wikipedia.org/wiki/N,N-Dimethyltryptamine
SpeF leaderSpeF leader
2005). "Evidence for a second class of S-adenosylmethionine riboswitches and other regulatory RNA motifs in alpha- ... the majority of species analysed it is located in the leader of an operon containing the speF gene an ornithine decarboxylase ...
https://en.wikipedia.org/wiki/SpeF_leader
ReelinReelin
Guidotti A, Ruzicka W, Grayson DR, Veldic M, Pinna G, Davis JM, Costa E (January 2007). "S-adenosyl methionine and DNA ... "GABAergic dysfunction in schizophrenia and mood disorders as reflected by decreased levels of glutamic acid decarboxylase 65 ... As one study shows, S-adenosyl methionine (SAM) concentration in patients' prefrontal cortex is twice as high as in the ... "Histone hyperacetylation induces demethylation of reelin and 67-kDa glutamic acid decarboxylase promoters". Proceedings of the ...
https://en.wikipedia.org/wiki/Reelin
Roland DouceRoland Douce
Cohen-Addad C, Pares S, Sieker L, Neuburger M, Douce R (1995). "The lipoamide arm in the glycine decarboxylase complex is not ... chloroplasts are autonomous for de novo methionine synthesis and can import S-adenosyl methionine from the cytosol". J Biol ... Douce R, Bourguignon J, Neuburger M, Rébeillé F (2001). "The glycine decarboxylase system: a fascinating complex". Trends Plant ... in particular of the proteins involved in photorespiration and the subunits of the glycine-decarboxylase complex. Chloroplasts ...
https://en.wikipedia.org/wiki/Roland_Douce
Radical SAMRadical SAM
Pierrel F, Douki T, Fontecave M, Atta M (November 2004). "MiaB protein is a bifunctional radical-S-adenosylmethionine enzyme ... a radical S-adenosyl-L-methionine decarboxylase involved in the blasticidin S biosynthetic pathway". PLOS ONE. 8 (7): e68545. ... Grell TA, Goldman PJ, Drennan CL (February 2015). "SPASM and twitch domains in S-adenosylmethionine (SAM) radical enzymes". The ... Allen KD, Xu H, White RH (September 2014). "Identification of a unique radical S-adenosylmethionine methylase likely involved ...
https://en.wikipedia.org/wiki/Radical_SAM
CholineCholine
This is a S-adenosylmethionine (SAM) precursor. SAM is a common reagent in biological methylation reactions. For example, it ... which is catalyzed by a serine decarboxylase. The synthesis of choline from ethanolamine may take place in three parallel ... Choline is required to produce acetylcholine - a neurotransmitter - and S-adenosylmethionine, a universal methyl donor involved ... S-adenosylmethionine). SAM is the substrate for almost all methylation reactions in mammals. It has been suggested that ...
https://en.wikipedia.org/wiki/Choline
Amino acid synthesisAmino acid synthesis
Finally, DAP decarboxylase LysA mediates the last step of the lysine synthesis and is common for all studied bacterial species ... The repressor protein MetJ, in cooperation with the corepressor protein S-adenosyl-methionine, mediates the repression of ... a protein which plays a role in purine synthesis and S-adeno-sylmethionine are known to down regulate glyA. PurR binds directly ...
https://en.wikipedia.org/wiki/Amino_acid_synthesis
3-O-Methyldopa3-O-Methyldopa
DDC acting as decarboxylase inhibitor makes COMT main metabolic pathway catalyzing this conversion of Levodopa. This process is ... The necessary cofactor for this enzymatic reaction is s-adenosyl methionine (SAM). Its half-life (approximately 15 hours) is ... On the other hand, the possibility of blocking peripheral decarboxylation by adding an aromatic amino acid decarboxylase (AADC ... This reaction happen in the process of decarboxylation by aromatic amino acid decarboxylase (AADC) also called dopa- ...
https://en.wikipedia.org/wiki/3-O-Methyldopa
Amino acidAmino acid
Ornithine and S-adenosylmethionine are precursors of polyamines. Aspartate, glycine, and glutamine are precursors of ... and eflornithine drug that inhibits ornithine decarboxylase and used in the treatment of sleeping sickness. Since 2001, 40 non- ... through the transsulfuration pathway or by the demethylation of methionine via the intermediate metabolite S-adenosylmethionine ...
https://en.wikipedia.org/wiki/Amino_acid
PhosphatidylethanolaminePhosphatidylethanolamine
Phosphatidylserine decarboxylase is the enzyme that is used to decarboxylate phosphatidylserine in the first pathway. The ... S-Adenosyl methionine can subsequently methylate the amine of phosphatidylethanolamines to yield phosphatidylcholines. It can ...
https://en.wikipedia.org/wiki/Phosphatidylethanolamine
MelatoninMelatonin
A decarboxylase with cofactor pyridoxal phosphate (PLP) removes CO2 from 5-hydroxy-L-tryptophan to produce 5-hydroxytryptamine. ... Hydroxyindole O-methyltransferase and S-adenosyl methionine convert N-acetylserotonin into melatonin through methylation of the ... N-acetylserotonin is methylated at the hydroxyl position by S-adenosyl methionine (SAM) to produce S-adenosyl homocysteine (SAH ... This intermediate (5-HTP) is decarboxylated by pyridoxal phosphate and 5-hydroxytryptophan decarboxylase to produce serotonin. ...
https://en.m.wikipedia.org/wiki/Melatonin
Acetyl-CoAAcetyl-CoA
Malonyl-CoA decarboxylase. References[edit]. *^ "Acetyl CoA Crossroads". chemistry.elmhurst.edu. Retrieved 2016-11-08.. ... generation of homocysteine: S-Adenosyl methionine. *S-Adenosyl-L-homocysteine. *Homocysteine. *conversion to cysteine: ...
https://en.wikipedia.org/wiki/Acetyl_coa
PutrescinePutrescine
Spermidine synthase uses putrescine and S-adenosylmethioninamine (decarboxylated S-adenosyl methionine) to produce spermidine. ... In one pathway, arginine is converted into agmatine, with a reaction catalyzed by the enzyme arginine decarboxylase (ADC); then ... Putrescine is synthesized in small quantities by healthy living cells by the action of ornithine decarboxylase. ... arginine is converted into ornithine and then ornithine is converted into putrescine by ornithine decarboxylase (ODC). ...
https://en.m.wikipedia.org/wiki/Putrescine
Κατάθλιψη - ΒικιπαίδειαΚατάθλιψη - Βικιπαίδεια
A methyl donor, adenosylmethionine, in depression. Folia Neuropsychiat. 16(4), 1973. *↑ Block W. Depression and arthritis. Life ... L-5-hydroxytryptophan alone and in combination with a peripheral decarboxylase inhibitor in the treatment of depression. ... S-adenosylmethionine (SAM-e) for the treatment of depression in people living with HIV/AIDS. BMC Psychiatry. 4:38, 2004. ... S-Adenosyl-Methionine improves depression in patients with Parkinson's disease in an open-label clinical trial. Mov Disord. 15( ...
https://el.wikipedia.org/wiki/Κατάθλιψη
Protein primary structureProtein primary structure
... especially decarboxylases such as S-adenosylmethionine decarboxylase (SAMDC) that exploit the electron-withdrawing power of the ...
https://en.m.wikipedia.org/wiki/Protein_primary_structure
HistidineHistidine
generation of homocysteine: S-Adenosyl methionine. *S-Adenosyl-L-homocysteine. *Homocysteine. *conversion to cysteine: ... Conversion of histidine to histamine by histidine decarboxylase. Requirements[edit]. The Food and Nutrition Board (FNB) of the ...
https://en.wikipedia.org/wiki/L-Histidine
Cofactor (biochemistry)Cofactor (biochemistry)
Chiang PK, Gordon RK, Tal J, Zeng GC, Doctor BP, Pardhasaradhi K, McCann PP (March 1996). "S-Adenosylmethionine and methylation ... which is tightly bound in transketolase or pyruvate decarboxylase, while it is less tightly bound in pyruvate dehydrogenase.[26 ...
https://en.wikipedia.org/wiki/Cofactor_
Glutamic acidGlutamic acid
This reaction is catalyzed by glutamate decarboxylase (GAD), which is most abundant in the cerebellum and pancreas. ... generation of homocysteine: S-Adenosyl methionine. *S-Adenosyl-L-homocysteine. *Homocysteine. *conversion to cysteine: ...
https://en.wikipedia.org/wiki/Glutamic_acid
List of enzymesList of enzymes
Ornithine decarboxylase (EC 4.1.1.17). *Uridine monophosphate synthetase (EC 4.1.1.23). *Aromatic-L-amino-acid decarboxylase ( ... Adenosylmethionine hydrolase. *S-adenosyl-L-homocysteine hydrolase. *Alkenylglycerophosphocholine hydrolase. * ...
https://en.m.wikipedia.org/wiki/List_of_enzymes
OrnithineOrnithine
... , via the action of ornithine decarboxylase (E.C. 4.1.1.17), is the starting point for the synthesis of polyamines ... generation of homocysteine: S-Adenosyl methionine. *S-Adenosyl-L-homocysteine. *Homocysteine. *conversion to cysteine: ...
https://en.wikipedia.org/wiki/Ornithine
NeurotransmitterNeurotransmitter
These conversions require vitamin B6, vitamin C, and S-adenosylmethionine. A few studies suggest potential antidepressant ... and the biosynthetic enzyme aromatic amino acid decarboxylase (AADC).. ...
https://en.wikipedia.org/wiki/Neuro_transmitter
Fatty acid synthesisFatty acid synthesis
BCKA decarboxylase and relative activities of α-keto acid substrates The BCKA decarboxylase enzyme is composed of two subunits ... S-adenosyl-methionine donates a methyl group to the double bond of oleic acid. This methylation reaction forms the intermediate ... All of these factors may affect chain length, and HSFs have been demonstrated to alter the specificity of BCKA decarboxylase ... Decarboxylation of the primer precursors occurs through the branched-chain α-keto acid decarboxylase (BCKA) enzyme. Elongation ...
https://en.wikipedia.org/wiki/Fatty_acid_synthesis
List of enzymesList of enzymes
Category:EC 3.3 Adenosylmethionine hydrolase S-adenosyl-L-homocysteine hydrolase Alkenylglycerophosphocholine hydrolase ... Aromatic-L-amino-acid decarboxylase (EC 4.1.1.28) RubisCO (EC 4.1.1.39) Category:EC 4.1.2 Fructose-bisphosphate aldolase (EC ... EC 4.1.1 Ornithine decarboxylase (EC 4.1.1.17) Uridine monophosphate synthetase (EC 4.1.1.23) ...
https://en.wikipedia.org/wiki/List_of_enzymes
NeurotransmitterNeurotransmitter
These conversions require vitamin B6, vitamin C, and S-adenosylmethionine. A few studies suggest potential antidepressant ... and the biosynthetic enzyme aromatic amino acid decarboxylase (AADC). Malenka RC, Nestler EJ, Hyman SE (2009). "Chapter 6: ...
https://en.wikipedia.org/wiki/Neurotransmitter
List of EC numbers (EC 2)List of EC numbers (EC 2)
... malonate decarboxylase holo-(acyl-carrier protein) synthase EC 2.7.7.67: CDP-archaeol synthase EC 2.7.7.68: 2-phospho-L-lactate ... adenosylmethionine cyclotransferase EC 2.5.1.5: galactose-6-sulfurylase EC 2.5.1.6: methionine adenosyltransferase EC 2.5.1.7: ... adenosylmethionine-8-amino-7-oxononanoate transaminase EC 2.6.1.63: kynurenine-glyoxylate transaminase EC 2.6.1.64: glutamine- ...
https://en.wikipedia.org/wiki/List_of_EC_numbers_(EC_2)
Adenosylmethionine decarboxylase - WikipediaAdenosylmethionine decarboxylase - Wikipedia
Adenosylmethionine decarboxylase is an enzyme that catalyzes the conversion of S-adenosyl methionine to S- ... S-adenosylmethionine decarboxylase (AdoMetDC) plays an essential regulatory role in the polyamine biosynthetic pathway by ... Pegg AE, Xiong H, Feith DJ, Shantz LM (November 1998). "S-adenosylmethionine decarboxylase: structure, function and regulation ... Unlike many amino acid decarboxylases AdoMetDC uses a covalently bound pyruvate residue as a cofactor rather than the more ...
https://en.wikipedia.org/wiki/Adenosylmethionine_decarboxylase
S-adenosylmethionine decarboxylase proenzyme precursor - Trypanosoma cruziS-adenosylmethionine decarboxylase proenzyme precursor - Trypanosoma cruzi
S-adenosylmethionine decarboxylase proenzyme (C4B63_18g214), S-adenosylmethionine decarboxylase proenzyme (TcCL_ESM01038), S- ... S-adenosylmethionine decarboxylase beta chainBy similarityAdd BLAST. 85. ChainiPRO_0000029986. 86 - 370. S-adenosylmethionine ... adenosylmethionine decarboxylase proenzyme (C3747_28g21), S-adenosylmethionine decarboxylase proenzyme. This subpathway is part ... S-adenosylmethionine decarboxylase proenzyme (EC:4.1.1.50*Search proteins in UniProtKB for this EC number. ...
https://www.uniprot.org/uniprot/O76240
RCSB PDB - 1MSV: The S68A S-adenosylmethionine decarboxylase proenzyme processing mutant. Macromolecule Annotations...RCSB PDB - 1MSV: The S68A S-adenosylmethionine decarboxylase proenzyme processing mutant. Macromolecule Annotations...
Decarboxylase Proenzyme Processing as Revealed by the Structure of the S68A Mutant. ... S-adenosylmethionine decarboxylase S-adenosylmethionine decarboxylase S-adenosylmethionine decarboxylase S-adenosylmethionine ... S-adenosylmethionine decarboxylase S-adenosylmethionine decarboxylase S-adenosylmethionine decarboxylase S-adenosylmethionine ... S-adenosylmethionine decarboxylase S-adenosylmethionine decarboxylase B. 1msvB00. Alpha Beta 4-Layer Sandwich S- ...
http://www.rcsb.org/pdb/explore/derivedData.do?structureId=1MSV
Impact of S-Adenosylmethionine Decarboxylase 1 on Pulmonary Vascular RemodelingCLINICAL PERSPECTIVE | CirculationImpact of S-Adenosylmethionine Decarboxylase 1 on Pulmonary Vascular RemodelingCLINICAL PERSPECTIVE | Circulation
Impact of S-Adenosylmethionine Decarboxylase 1 on Pulmonary Vascular RemodelingCLINICAL PERSPECTIVE. Friederike Christine ... Microarray analysis from these mice revealed s-adenosylmethionine decarboxylase 1 (AMD-1) as one of the most downregulated ... Impact of S-Adenosylmethionine Decarboxylase 1 on Pulmonary Vascular RemodelingCLINICAL PERSPECTIVE ... Impact of S-Adenosylmethionine Decarboxylase 1 on Pulmonary Vascular RemodelingCLINICAL PERSPECTIVE ...
http://circ.ahajournals.org/content/129/14/1510.short?rss=1
Isolation and characterization of Saccharomyces cerevisiae mutants deficient in S-adenosylmethionine decarboxylase, spermidine,...Isolation and characterization of Saccharomyces cerevisiae mutants deficient in S-adenosylmethionine decarboxylase, spermidine,...
Four mutants were isolated from Saccharomyces cerevisiae that are deficient in S-adenosylmethionine decarboxylase (spe2). All ... Isolation and characterization of Saccharomyces cerevisiae mutants deficient in S-adenosylmethionine decarboxylase, spermidine ... Isolation and characterization of Saccharomyces cerevisiae mutants deficient in S-adenosylmethionine decarboxylase, spermidine ... Isolation and characterization of Saccharomyces cerevisiae mutants deficient in S-adenosylmethionine decarboxylase, spermidine ...
https://jb.asm.org/content/134/1/208?ijkey=9fa4289273f466fb14e9bcabec128fa861da37ae&keytype2=tf_ipsecsha
In vitro and in vivo anti-tumor action of the S-adenosylmethionine decarboxylase (SAMDC) inhibitor SAM486A in human breast...In vitro and in vivo anti-tumor action of the S-adenosylmethionine decarboxylase (SAMDC) inhibitor SAM486A in human breast...
In vitro and in vivo anti-tumor action of the S-adenosylmethionine decarboxylase (SAMDC) inhibitor SAM486A in human breast ... In vitro and in vivo anti-tumor action of the S-adenosylmethionine decarboxylase (SAMDC) inhibitor SAM486A in human breast ... In vitro and in vivo anti-tumor action of the S-adenosylmethionine decarboxylase (SAMDC) inhibitor SAM486A in human breast ... In vitro and in vivo anti-tumor action of the S-adenosylmethionine decarboxylase (SAMDC) inhibitor SAM486A in human breast ...
http://cancerres.aacrjournals.org/content/64/7_Supplement/1201.1
Selective regulation of S-adenosylmethionine decarboxylase activity by the spermine analogue 6-spermyne | Biochemical JournalSelective regulation of S-adenosylmethionine decarboxylase activity by the spermine analogue 6-spermyne | Biochemical Journal
Selective regulation of S-adenosylmethionine decarboxylase activity by the spermine analogue 6-spermyne. C W Porter, J McManis ... Selective regulation of S-adenosylmethionine decarboxylase activity by the spermine analogue 6-spermyne ... Selective regulation of S-adenosylmethionine decarboxylase activity by the spermine analogue 6-spermyne ... Selective regulation of S-adenosylmethionine decarboxylase activity by the spermine analogue 6-spermyne ...
http://www.biochemj.org/content/254/2/337
4-Hydroxyphenylacetate decarboxylase activating enzyme catalyses a classical S-adenosylmethionine reductive cleavage reaction -...4-Hydroxyphenylacetate decarboxylase activating enzyme catalyses a classical S-adenosylmethionine reductive cleavage reaction -...
4-Hydroxyphenylacetate decarboxylase activating enzyme catalyses a classical S-adenosylmethionine reductive cleavage reaction. ... 4-Hydroxyphenylacetate decarboxylase activating enzyme catalyses a classical S-adenosylmethionine reductive cleavage reaction ...
https://www.biologie.hu-berlin.de/en/gruppenseiten-en/struktbio/publications-martin-and-dobbek/articlereference.2013-08-07.1968337596
RNAi silencing of three homologues of S-adenosylmethionine decarboxylase gene in tapetal tissue of tomato results in male...RNAi silencing of three homologues of S-adenosylmethionine decarboxylase gene in tapetal tissue of tomato results in male...
Solanumlycopersicum Male sterility Polyamines S-Adenosylmethionine decarboxylase RNAi Pollen development Electronic ... Song J, Nada K, Tachibana S (2001) The early increase of S-adenosylmethionine decarboxylase activity is essential for the ... RNAi silencing of three homologues of S-adenosylmethionine decarboxylase gene in tapetal tissue of tomato results in male ... In the present study, S-adenosylmethionine decarboxylase (SAMDC), a key gene involved in polyamine biosynthesis, has been ...
https://rd.springer.com/article/10.1007/s11103-013-0051-2
The functional intronless S-adenosylmethionine decarboxylase gene of the mouse (Amd-2) is linked to the ornithine decarboxylase...The functional intronless S-adenosylmethionine decarboxylase gene of the mouse (Amd-2) is linked to the ornithine decarboxylase...
... is linked to the ornithine decarboxylase gene (Odc) on Chromosome 12 and is present in distantly related species of the genus ... "The functional intronless S-adenosylmethionine decarboxylase gene of the mouse (Amd-2) ... The functional intronless S-adenosylmethionine decarboxylase gene of the mouse (Amd-2) is linked to the ornithine decarboxylase ... The functional intronless S-adenosylmethionine decarboxylase gene of the mouse (Amd-2) is linked to the ornithine decarboxylase ...
https://www.deepdyve.com/lp/springer_journal/the-functional-intronless-s-adenosylmethionine-decarboxylase-gene-of-MHl9x0vtMC
Delineation of functional roles of parasite-specific inserts in the malarial S-adenosylmethionine decarboxylase / ornithine...Delineation of functional roles of parasite-specific inserts in the malarial S-adenosylmethionine decarboxylase / ornithine...
Delineation of functional roles of parasite-specific inserts in the malarial S-adenosylmethionine decarboxylase / ornithine ... Delineation of functional roles of parasite-specific inserts in the malarial S-adenosylmethionine decarboxylase / ornithine ... Ornithine decarboxylase (ODC) and Sadenosylmethionine decarboxylase (AdoMetDC) are the rate-limiting enzymes in polyamine ... activity analysis thereof showed that these inserts are essential for the catalytic activities of both the decarboxylase ...
https://repository.up.ac.za/handle/2263/26979
A phage display study of interacting peptide binding partners of malarial S-Adenosylmethionine decarboxylase/Ornithine...A phage display study of interacting peptide binding partners of malarial S-Adenosylmethionine decarboxylase/Ornithine...
... namely ornithine decarboxylase (ODC) and S-adenosylmethionine decarboxylase (AdoMetDC). The AdoMetDC/ODC domains are assembled ... A phage display study of interacting peptide binding partners of malarial S-Adenosylmethionine decarboxylase/Ornithine ... A phage display study of interacting peptide binding partners of malarial S-Adenosylmethionine decarboxylase/Ornithine ... Inhibition of both decarboxylase activities is curative of murine malaria and indicates the viability of such strategies in ...
https://repository.up.ac.za/handle/2263/24105
Purification of Human S-Adenosylmethionine Decarboxylase Expressed in Escherichia coli and Use of This Protein To Investigate...Purification of Human S-Adenosylmethionine Decarboxylase Expressed in Escherichia coli and Use of This Protein To Investigate...
Human S-adenosylmethionine decarboxylase (AdoMetDC) was expressed in high yield in Escherichia coli using the pIN-III(lppp-5) ... Shantz, L., Stanley, B., Pegg, A., & Secrist, J. A. (1992). Purification of Human S-Adenosylmethionine Decarboxylase Expressed ... N2 - Human S-adenosylmethionine decarboxylase (AdoMetDC) was expressed in high yield in Escherichia coli using the pIN-III(lppp ... AB - Human S-adenosylmethionine decarboxylase (AdoMetDC) was expressed in high yield in Escherichia coli using the pIN-III(lppp ...
https://pennstate.pure.elsevier.com/en/publications/purification-of-human-s-adenosylmethionine-decarboxylase-expresse
Effect of Inhibitors of S-Adenosylmethionine Decarboxylase on Polyamine Content and Growth of L1210 Cells<...Effect of Inhibitors of S-Adenosylmethionine Decarboxylase on Polyamine Content and Growth of L1210 Cells<...
Analogues of S-adenosylmethionine that were designed as inhibitors of S-adenosylmethionine decarboxylase were tested for their ... N2 - Analogues of S-adenosylmethionine that were designed as inhibitors of S-adenosylmethionine decarboxylase were tested for ... AB - Analogues of S-adenosylmethionine that were designed as inhibitors of S-adenosylmethionine decarboxylase were tested for ... abstract = "Analogues of S-adenosylmethionine that were designed as inhibitors of S-adenosylmethionine decarboxylase were ...
https://pennstate.pure.elsevier.com/en/publications/effect-of-inhibitors-of-s-adenosylmethionine-decarboxylase-on-pol
The pivotal roles of the plant S-adenosylmethionine decarboxylase 5′ untranslated leader sequence in regulation of gene...The pivotal roles of the plant S-adenosylmethionine decarboxylase 5′ untranslated leader sequence in regulation of gene...
S-Adenosylmethionine decarboxylase (SAMDC; EC 4.1.1.50) is a key rate-limiting enzyme located in the polyamine biosynthesis ... Hu, W.-W., Gong, H., Eng, C.P. (2005). The pivotal roles of the plant S-adenosylmethionine decarboxylase 5′ untranslated leader ... The pivotal roles of the plant S-adenosylmethionine decarboxylase 5′ untranslated leader sequence in regulation of gene ...
http://scholarbank.nus.edu.sg/handle/10635/101986
Mitoguazone (Methylglyoxal-bis(guanylhydrazone)) | S-adenosyl-methionine Decarboxylase Inhibitor | MedChemExpressMitoguazone (Methylglyoxal-bis(guanylhydrazone)) | S-adenosyl-methionine Decarboxylase Inhibitor | MedChemExpress
Mitoguazone is a brain-penetrant and competitive S-adenosyl-methionine decarboxylase (SAMDC) inhibitor that disrupts polyamine ... Mitoguazone is a brain-penetrant and competitive S-adenosyl-methionine decarboxylase (SAMDC) inhibitor that disrupts polyamine ... Mitoguazone is a brain-penetrant and competitive S-adenosyl-methionine decarboxylase (SAMDC) inhibitor that disrupts polyamine ... MGBG Methyl-GAGHIVApoptosisHuman immunodeficiency virusChemotherapeuticpolyaminebiosynthesisS-adenosyl-methioninedecarboxylase ...
https://www.medchemexpress.com/mitoguazone.html
Amd1-ps1 (adenosylmethionine decarboxylase 1, pseudogene 1) - Chinchilla Research Resource DatabaseAmd1-ps1 (adenosylmethionine decarboxylase 1, pseudogene 1) - Chinchilla Research Resource Database
adenosylmethionine decarboxylase 1, pseudogene 1 LOC103691677 S-adenosylmethionine decarboxylase proenzyme pseudogene Data ... adenosylmethionine decarboxylase 1, pseudogene 1 AMDP1 S-adenosylmethionine decarboxylase (AMDP1) pseudogene Nomenclature ... AMDP1; LOC103691677; S-adenosylmethionine decarboxylase (AMDP1) pseudogene; S-adenosylmethionine decarboxylase proenzyme ... S-adenosylmethionine decarboxylase proenzyme pseudogene Symbol and Name status set to provisional. 70820. PROVISIONAL. ...
https://crrd.mcw.edu/rgdweb/report/gene/main.html?id=1590834
Overexpression of carnation S-adenosylmethionine decarboxylase gene generates a broad-spectrum tolerance to abiotic stresses in...Overexpression of carnation S-adenosylmethionine decarboxylase gene generates a broad-spectrum tolerance to abiotic stresses in...
Wi, S. J., Kim, W. T., & Park, K. Y. (2006). Overexpression of carnation S-adenosylmethionine decarboxylase gene generates a ... Wi, SJ, Kim, WT & Park, KY 2006, Overexpression of carnation S-adenosylmethionine decarboxylase gene generates a broad- ... Sense construct of full-length cDNA for S-adenosylmethionine decarboxylase (SAMDC), a key enzyme in PA biosynthesis, from ... Sense construct of full-length cDNA for S-adenosylmethionine decarboxylase (SAMDC), a key enzyme in PA biosynthesis, from ...
https://yonsei.pure.elsevier.com/en/publications/overexpression-of-carnation-s-adenosylmethionine-decarboxylase-ge
Discovery of enzymes for toluene synthesis from anoxic microbial communities(Journal Article) | DOE PAGESDiscovery of enzymes for toluene synthesis from anoxic microbial communities(Journal Article) | DOE PAGES
Structural Basis for Putrescine Activation of Human S-Adenosylmethionine Decarboxylase. Journal Article Bale, Shridhar ; Lopez ... activates the autoprocessing and decarboxylation reactions of human S-adenosylmethionine decarboxylase (AdoMetDC), a critical ... 4-Hydroxyphenylacetate Decarboxylases: Properties of a Novel Subclass of Glycyl Radical Enzyme Systems † journal, August 2006 * ... p -Hydroxyphenylacetate decarboxylase from Clostridium difficile : A novel glycyl radical enzyme catalysing the formation of ...
https://www.osti.gov/pages/biblio/1530356-discovery-enzymes-toluene-synthesis-from-anoxic-microbial-communities
A polyamine-independent role for S-adenosylmethionine decarboxylase<...A polyamine-independent role for S-adenosylmethionine decarboxylase<...
A polyamine-independent role for S-adenosylmethionine decarboxylase. Bin Li, Shin Kurihara, Sok Ho Kim, Jue Liang, Anthony J. ... Li, B, Kurihara, S, Kim, SH, Liang, J & Michael, AJ 2019, A polyamine-independent role for S-adenosylmethionine decarboxylase ... A polyamine-independent role for S-adenosylmethionine decarboxylase. / Li, Bin; Kurihara, Shin; Kim, Sok Ho; Liang, Jue; ... A polyamine-independent role for S-adenosylmethionine decarboxylase. Biochemical Journal. 2019 Sep 20;476(18):2579-2594. https ...
https://utsouthwestern.pure.elsevier.com/en/publications/a-polyamine-independent-role-for-s-adenosylmethionine-decarboxyla
AMD1 mRNA employs ribosome stalling as a mechanism for molecular memory formation | NatureAMD1 mRNA employs ribosome stalling as a mechanism for molecular memory formation | Nature
... molecules that can be synthesized from a single mRNA molecule of the human AMD1 gene encoding adenosylmethionine decarboxylase ... protein molecules that can be synthesized from a single mRNA molecule of the human AMD1 gene encoding adenosylmethionine ... decarboxylase 1. The translation of messenger RNA (mRNA) sequences into proteins is regulated at many levels. Pavel Baranov and ... Pegg, A. E. S-Adenosylmethionine decarboxylase. Essays Biochem. 46, 25-46 (2009) ...
https://www.nature.com/articles/nature25174?error=cookies_not_supported&code=8b782958-a389-46f5-be3f-a5f7037195d1
Polyamine Cell Signaling | SpringerLinkPolyamine Cell Signaling | SpringerLink
Regulation of S-Adenosylmethionine Decarboxylase Colin Hanfrey. Pages 449-464 * Genetic Engineering of Polyamine Catabolism in ...
https://link.springer.com/book/10.1007%2F978-1-59745-145-1
Genome-Wide Identification of Genes Probably Relevant to the Uniqueness of Tea Plant (Camellia sinensis) and Its CultivarsGenome-Wide Identification of Genes Probably Relevant to the Uniqueness of Tea Plant (Camellia sinensis) and Its Cultivars
S-Adenosylmethionine decarboxylase 3. 0.88. 0.94. Caffeine biosynthesis. GMP synthase. 1. 0.65. 0.32. 0.53. ... Uroporphyrinogen decarboxylase. 1301. A. G. No. CGCAGATTTGAGACTGGTTG. TGGCCAATCAAGTGAAGATG. UN010458. KT427374. KT427366. ... Uroporphyrinogen decarboxylase. 1310. A. G. Yes. CGCAGATTTGAGACTGGTTG. TGGCCAATCAAGTGAAGATG. UN010458. KT427374. KT427366. ... Uroporphyrinogen decarboxylase. 1421. A. G. Yes. CGCAGATTTGAGACTGGTTG. TGGCCAATCAAGTGAAGATG. UN014682. KT427373. KT427365. ...
https://www.hindawi.com/journals/ijg/2015/527054/
Search: All Pfam signatures | InterPro | EMBL-EBISearch: All Pfam signatures | InterPro | EMBL-EBI
S-adenosylmethionine decarboxylase (IPR001985) Pfam signature: PF01536 Herpesvirus glycoprotein D/GG/GX domain (IPR002896) Pfam ... Orn/DAP/Arg decarboxylase 2, C-terminal (IPR022643) Pfam signature: PF00278 Proteinase inhibitor I13, potato inhibitor I ( ... S-adenosylmethionine synthetase, N-terminal (IPR022628) Pfam signature: PF00438 Bromodomain (IPR001487) Pfam signature: PF00439 ... Orotidine 5-phosphate decarboxylase domain (IPR001754) Pfam signature: PF00215 Histone-like DNA-binding protein (IPR000119) ...
http://www.ebi.ac.uk/interpro/member-database/Pfam
RCSB PDB - 3H0W: Human AdoMetDC with 5-Deoxy-5-[(N-dimethyl)amino]-8-methyl-adenosineRCSB PDB - 3H0W: Human AdoMetDC with 5'-Deoxy-5'-[(N-dimethyl)amino]-8-methyl-adenosine
S-adenosylmethionine decarboxylase proenzyme. B. 67. Homo sapiens. Mutation(s): 0 Gene Names: AMD1, AMD. EC: 4.1.1.50. ... S-adenosylmethionine decarboxylase proenzyme. A. 266. Homo sapiens. Mutation(s): 0 Gene Names: AMD1, AMD. EC: 4.1.1.50. ... S-Adenosylmethionine decarboxylase (AdoMetDC) is a key enzyme in the polyamine biosynthetic pathway. Inhibition of this pathway ... S-Adenosylmethionine decarboxylase (AdoMetDC) is a key enzyme in the polyamine biosynthetic pathway. Inhibition of this pathway ...
https://www.rcsb.org/structure/3H0W
Purification of Human S-Adenosylmethionine Decarboxylase Expressed in Escherichia coli and Use of This Protein To Investigate...Purification of Human S-Adenosylmethionine Decarboxylase Expressed in Escherichia coli and Use of This Protein To Investigate...
Human S-adenosylmethionine decarboxylase (AdoMetDC) was expressed in high yield in Escherichia coli using the pIN-III(lppp-5) ... Purification of Human S-Adenosylmethionine Decarboxylase Expressed in Escherichia coli and Use of This Protein To Investigate ...
https://scholars.uab.edu/display/pub2081863
Critical functions of the polyamine putrescine for proliferation and viability of Leishmania donovani parasites | SpringerLinkCritical functions of the polyamine putrescine for proliferation and viability of Leishmania donovani parasites | SpringerLink
The enzyme S-adenosylmethionine decarboxylase (ADOMETDC) forms decarboxylated S-adenosylmethionine, the aminopropyl-group donor ... Roberts SC et al (2002) S-Adenosylmethionine decarboxylase from Leishmania donovani. Molecular, genetic, and biochemical ... and S-adenosylmethionine decarboxylase (ADOMETDC) (Fig. 1). ARG, the first and committed step in polyamine biosynthesis, ... Boitz JM, Yates PA, Kline C, Gaur U, Wilson ME, Ullman B, Roberts SC (2009) Leishmania donovani ornithine decarboxylase is ...
https://link.springer.com/article/10.1007/s00726-019-02736-z?error=cookies_not_supported&code=f79854ef-a38e-4f2f-8592-41bfde528510
Initial characterization of a HTC cell variant partially resistant to the anti-proliferative effect of ornithine decarboxylase...Initial characterization of a HTC cell variant partially resistant to the anti-proliferative effect of ornithine decarboxylase...
Initial characterization of a HTC cell variant partially resistant to the anti-proliferative effect of ornithine decarboxylase ... Adenosylmethionine Decarboxylase / metabolism* * Carboxy-Lyases / metabolism* * Cell Division / drug effects* * Cell Line ... Initial characterization of a HTC cell variant partially resistant to the anti-proliferative effect of ornithine decarboxylase ...
https://pubmed.ncbi.nlm.nih.gov/689093/?dopt=Abstract
Recent Advances in Polyamine Metabolism and Abiotic Stress ToleranceRecent Advances in Polyamine Metabolism and Abiotic Stress Tolerance
... dcSAM is synthesized by action of S-adenosylmethionine decarboxylase (AdoMetDC; EC 4.1.4.50) on S-adenosyl-methionine which in ... S-adenosylmethionine decarboxylase (EC 4.1.4.50); AIH: agmatine iminohydrolase (EC 3.5.3.12); CPA: N-carbamoylputrescine ... Figure 1: Polyamine biosynthetic pathway with special reference to plants. ADC: arginine decarboxylase (EC 4.1.1.9); AdoMetDC: ... I. Hummel, G. Gouesbet, A. El Amrani, A. Aïnouche, and I. Couée, "Characterization of the two arginine decarboxylase (polyamine ...
https://www.hindawi.com/journals/bmri/2014/239621/
Plus itPlus it
... adenosylmethionine decarboxylase; the PLP-dependent 18) cystathionine β-synthase, and 19) cystathionine γ-lyase. AdoHCy, S- ... and SHMT activity in MCF-7 human mammary carcinoma cells in vitro and was accompanied by decrease in levels of S-adenosyl-methionine ...
https://jpet.aspetjournals.org/content/366/2/238
OrnithineAdoMetDCAMD1SAMDCHuman S-AdenosylmethiInhibitorProenzymeEnzymesPutrescineInhibitionAnalogues of S-adenosylmethionineRegulationProteinPeggArginineTrypanosomaInhibitorsAdenosineMetabolismSynthaseMethylationPolyamine biosynthesisEnzyme that catalyzesMethionineGene OntologyDecarboxylationMutantsLiverFunctionalActivity
Ornithine13
  • Both ornithine decarboxylase (ODC), the first and rate-limiting enzyme in the PA pathway promoting the synthesis of Pu, and SAMDC involved in the synthesis of the more distal PA, Sd and Sm, are attractive therapeutic targets. (aacrjournals.org)
  • Accordingly, treatment of cultured L1210 cells with 10 microM-spermine rapidly and significantly lowered ornithine decarboxylase (ODC) and S-adenosylmethionine decarboxylase (AdoMetDC) activities in a sequential manner. (biochemj.org)
  • We also show, through analysis of an interspecific backcross, that Amd-2 is located on Chr 12, tightly linked to the gene (Odc) that encodes ornithine decarboxylase, another key enzyme in polyamine synthesis. (deepdyve.com)
  • Ornithine decarboxylase (ODC) and Sadenosylmethionine decarboxylase (AdoMetDC) are the rate-limiting enzymes in polyamine metabolism. (up.ac.za)
  • Polyamine synthesis in P. falciparum is uniquely facilitated by a single open reading frame that encodes both rate-limiting enzymes in the pathway, namely ornithine decarboxylase (ODC) and S-adenosylmethionine decarboxylase (AdoMetDC). (up.ac.za)
  • The combined application of 100 μM MAOEA and 5 mM α-(difluoromethyl)ornithine (an ornithine decarboxylase inhibitor) to L1210 cells completely prevented the synthesis of putrescine, spermidine, and spermine for up to 48 h. (elsevier.com)
  • To address this question, we assessed the effect of polyamine depletion in Leishmania donovani mutants lacking ornithine decarboxylase (Δ odc ) or spermidine synthase (Δ spdsyn ). (springer.com)
  • d , l -α-Difluoromethylornithine (DFMO) is a suicide inhibitor of ornithine decarboxylase (ODC), the enzyme that catalyzes putrescine biosynthesis, and shows remarkable therapeutic efficacy in treating African sleeping sickness caused by T. brucei gambiense (Babokhov et al. (springer.com)
  • A ) Reactions catalyzed by T. brucei S -adenosyl-L-methionine decarboxylase ( Tb AdoMetDC/prozyme heterodimer), ornithine decarboxylase ( Tb ODC) and spermidine synthase ( Tb SpdSyn) are shown. (elifesciences.org)
  • The biosynthesis of putrescine occurs from the processing of ornithine and/or arginine, and is regulated by the enzymes ornithine decarboxylase (ODC) and arginine decarboxylase (ADC), respectively. (biologists.org)
  • DFMO (α-difluoromethylornithine) is an oral irreversible inhibitor of ornithine decarboxylase, the first rate-limiting enzyme in polyamine synthesis. (aacrjournals.org)
  • We constructed clones that overproduce these enzymes and studied the sequence, structure, and regulation of these enzymes (e.g., ornithine decarboxylase, spermidine synthase, spermine synthase, and S-adenosylmethionine decarboxylase). (nih.gov)
  • Regulation of ornithine decarboxylase in skeletal muscle. (elsevier.com)
AdoMetDC9
  • S-adenosylmethionine decarboxylase (AdoMetDC) plays an essential regulatory role in the polyamine biosynthetic pathway by generating the n-propylamine residue required for the synthesis of spermidine and spermine from putrescein. (wikipedia.org)
  • Unlike many amino acid decarboxylases AdoMetDC uses a covalently bound pyruvate residue as a cofactor rather than the more common pyridoxal 5'-phosphate. (wikipedia.org)
  • Berger, Franklin G. 1999-08-01 00:00:00 S-Adenosylmethionine decarboxylase (AdoMetDC) is a key enzyme in the biosynthesis of polyamines. (deepdyve.com)
  • Human S-adenosylmethionine decarboxylase (AdoMetDC) was expressed in high yield in Escherichia coli using the pIN-III(lpp p-5 ) expression vector and purified to apparent homogeneity using affinity chromatography on methylglyoxal bis(guanylhydrazone)-Sepharose. (elsevier.com)
  • The only known function of S-adenosylmethionine decarboxylase (AdoMetDC) is to supply, with its partner aminopropyltransferase enzymes such as spermidine synthase (SpdSyn), the aminopropyl donor for polyamine biosynthesis. (elsevier.com)
  • Here we report a new mechanism that limits the number of complete protein molecules that can be synthesized from a single mRNA molecule of the human AMD1 gene encoding adenosylmethionine decarboxylase 1 (AdoMetDC). (nature.com)
  • S-Adenosylmethionine decarboxylase (AdoMetDC) is a key enzyme in the polyamine biosynthetic pathway. (rcsb.org)
  • These enzymes, S- adenosylmethionine decarboxylase (AdoMetDC) and deoxyhypusine synthase, have been characterized from Trypanosoma brucei , the causative agent of HAT. (elifesciences.org)
  • This mechanism emerged from a study of the mRNA that is transcribed from the AMD1 gene, which encodes the protein adenosylmethionine decarboxylase 1 (AdoMetDC). (genengnews.com)
AMD11
  • The human S-adenosylmethionine decarboxylase gene: nucleotide sequence of a pseudogene and chromosomal localization of the active gene (AMD1) and the pseudogene (AMD2). (abnova.com)
SAMDC5
  • In the present study, S-adenosylmethionine decarboxylase ( SAMDC ), a key gene involved in polyamine biosynthesis, has been targeted in tapetal tissue of tomato using RNAi to examine its effect on tapetum development and pollen viability. (springer.com)
  • Mitoguazone is a brain-penetrant and competitive S-adenosyl-methionine decarboxylase (SAMDC) inhibitor that disrupts polyamine biosynthesis . (medchemexpress.com)
  • Sense construct of full-length cDNA for S-adenosylmethionine decarboxylase (SAMDC), a key enzyme in PA biosynthesis, from carnation (Dianthus caryophyllus L.) flower was introduced into tobacco (Nicotiana tabacum L.) by Agrobacterium tumefaciens-mediated transformation. (elsevier.com)
  • Subsequent reactions convert putrescine into spermidine and spermine, and these are catalyzed by spermidine and spermine synthases, which add propylamino groups from decarboxylated S -adenosylmethionine, catalyzed by S -adenosylmethionine decarboxylase (SAMDC) ( Pegg, 1988 ). (biologists.org)
  • Here, we have modulated the spermidine levels either by overexpressing the S-adenosylmethionine decarboxylase (samdc) gene or treating the cells with methylglyoxal-bis (guanylhydrazone) (MGBG), an inhibitor of SAMDC. (dictybase.org)
Human S-Adenosylmethi3
  • The crystal structure of human S-adenosylmethionine decarboxylase at 2.25 A resolution reveals a novel fold. (abnova.com)
  • New insights into the design of inhibitors of human S-adenosylmethionine decarboxylase: studies of adenine C8 substitution in structural analogues of S-adenosylmethionine. (ebi.ac.uk)
  • 2009 Mar 12;52(5):1388-407.New insights into the design of inhibitors of human S-adenosylmethionine decarboxylase: studies of adenine C8 substitution in structural analogues of S-adenosylmethionine. (nus.edu.sg)
Inhibitor2
  • These results indicate that S-adenosyl-1,8-diamino-3-thiooctane is taken up by mammalian cells and is an effective inhibitor of spermidine synthase in vivo and that S-adenosylmethionine decarboxylase is regulated by the content of spermidine, but not of spermine. (nih.gov)
  • Methylglyoxal bis(guanylhydrazone) {1,1′-[(methylethanediylidene)-dinitrilo]diguanidine} is a very potent inhibitor of putrescine-activated S -adenosylmethionine decarboxylases from many different mammalian tissues, including sublines of mouse L1210 leukaemia that are resistant to the drug as well as sublines that are sensitive. (portlandpress.com)
Proenzyme1
  • 1MSV: The S68A S-adenosylmethionine decarboxylase proenzyme processing mutant. (rcsb.org)
Enzymes1
  • These proteins can be divided into two main groups which show little sequence similarity either to each other, or to other pyruvoyl-dependent amino acid decarboxylases: class I enzymes found in bacteria and archaea, and class II enzymes found in eukaryotes. (wikipedia.org)
Putrescine4
  • These results indicate that inhibitors of S-adenosylmethionine decarboxylase block cell growth by means of their inhibition of the production of spermidine and that putrescine cannot satisfy the requirement for spermidine in the growth of LI210 cells. (elsevier.com)
  • Meanwhile, levels of putrescine progressively increased under cold, which was consistent with up-regulation of an arginine decarboxylase gene. (biomedcentral.com)
  • Putrescine activation of Trypanosoma cruzi S-adenosylmethionine decarboxylase. (semanticscholar.org)
  • The inhibition of purified rat ventral prostate S -adenosylmethionine decarboxylase is competitive with respect to the S -adenosylmethionine substrate, and is much greater in the presence than in the absence of the activator putrescine. (portlandpress.com)
Inhibition3
  • Inhibition of both decarboxylase activities is curative of murine malaria and indicates the viability of such strategies in malaria control. (up.ac.za)
  • These results are consistent with their bringing about an inhibition of S-adenosylmethionine decarboxylase activity in the cell which leads to a reduction in the synthesis of spermidine and spermine. (elsevier.com)
  • Inhibition by the drug depends, among other things, on the nature of the aliphatic amines that can serve as stimulators of rat prostate S -adenosylmethionine decarboxylase. (portlandpress.com)
Analogues of S-adenosylmethionine2
  • Analogues of S-adenosylmethionine that were designed as inhibitors of S-adenosylmethionine decarboxylase were tested for their abilities to inhibit the purified enzyme from rat prostate. (elsevier.com)
  • They also demonstrate that analogues of S-adenosylmethionine are taken up by some mammalian cells and can influence polyamine metabolism. (elsevier.com)
Regulation2
  • Law, G. L., Raney, A., Heusner, C. & Morris, D. R. Polyamine regulation of ribosome pausing at the upstream open reading frame of S -adenosylmethionine decarboxylase. (nature.com)
  • S-Adenosylmethionine (SAM), synthesized from methionine and ATP, is a methyl group donor in many important transfer reactions including DNA methylation for regulation of gene expression. (genome.jp)
Protein1
  • Use of a chimeric Hsp70 to enhance the quality of recombinant Plasmodium falciparum S-Adenosylmethionine Decarboxylase protein produced in Escherichia coli. (sun.ac.za)
Pegg1
  • Pegg, A. E. S -Adenosylmethionine decarboxylase. (nature.com)
Arginine1
  • This pathway isn't completely worked out, but mutations appeared in arginine decarboxylase (SpeA), S-adenosylmethionine decarboxylase (SpeD), and spermidine synthase (SpeE). (sciencemag.org)
Trypanosoma1
  • We report X-ray structures of Trypanosoma brucei S -adenosylmethionine decarboxylase alone and in functional complex with its catalytically dead paralogous partner, prozyme. (elifesciences.org)
Inhibitors3
  • Both inhibitors led to a large reduction in the content of decarboxylated S-adenosylmethionine in LI210 cells and to a substantial decrease in the production of 5′-(methylthio)adenosine by these cells. (elsevier.com)
  • Secrist, John A. / Effect of Inhibitors of S-Adenosylmethionine Decarboxylase on Polyamine Content and Growth of L1210 Cells . (elsevier.com)
  • Substrate analogue inhibitors display an absolute requirement for a positive charge at the position equivalent to the sulfonium of S-adenosylmethionine. (rcsb.org)
Adenosine1
  • SAMe, formed from the reaction of L-methionine and adenosine triphosphate catalyzed by the enzyme S-adenosylmethionine synthetase, is the methyl-group donor in the biosynthesis of both DNA and RNA nucleic acids, phospholipids, proteins, epinephrine, melatonin, creatine and other molecules. (drugbank.ca)
Metabolism1
  • The severe reduction in levels of this essential biochemical substrate would be expected to compromise seriously metabolism and brain function in patients with Alzheimer's disease and may provide the basis for the observations of improved cognition in some Alzheimer's patients following S-adenosylmethionine therapy. (lifeextension.com)
Synthase1
  • The spermine content of the cells was increased by exposure to this drug presumably since spermine synthase was able to use a greater proportion of the available decarboxylated S-adenosylmethionine when spermidine synthase was inhibited. (nih.gov)
Methylation2
  • S-Adenosylmethionine and methylation. (nature.com)
  • however, no information is available regarding the status of S-adenosylmethionine or S-adenosylmethionine-dependent methylation in the brain of patients with this disorder. (lifeextension.com)
Polyamine biosynthesis3
  • S-Adenosylmethionine is an essential ubiquitous metabolite central to many biochemical pathways, including transmethylation and polyamine biosynthesis. (lifeextension.com)
  • Reduced S-adenosylmethionine levels could be due to excessive utilization in polyamine biosynthesis. (lifeextension.com)
  • OBJECTIVE: We measured the activity of S-adenosylmethionine decarboxylase, a key regulatory enzyme of polyamine biosynthesis, in the temporal cortex of patients with epilepsy. (lifeextension.com)
Enzyme that catalyzes1
  • Adenosylmethionine decarboxylase is an enzyme that catalyzes the conversion of S-adenosyl methionine to S-adenosylmethioninamine. (wikipedia.org)
Methionine1
  • S-adenosylmethionine is an intermediate metabolite of methionine. (drugbank.ca)
Gene Ontology1
  • Gene Ontology (GO) annotations related to this gene include adenosylmethionine decarboxylase activity . (genecards.org)
Decarboxylation1
  • Here we report the toluene-producing enzyme PhdB, a glycyl radical enzyme of bacterial origin that catalyzes phenylacetate decarboxylation, and its cognate activating enzyme PhdA, a radical S-adenosylmethionine enzyme, discovered in two distinct anoxic microbial communities that produce toluene. (osti.gov)
Mutants2
  • Isolation and characterization of Saccharomyces cerevisiae mutants deficient in S-adenosylmethionine decarboxylase, spermidine, and spermine. (asm.org)
  • Four mutants were isolated from Saccharomyces cerevisiae that are deficient in S-adenosylmethionine decarboxylase (spe2). (asm.org)
Liver2
  • S-Adenosylmethionine (SAMe) is used as a drug in Europe for the treatment of depression, liver disorders, fibromyalgia, and osteoarthritis. (drugbank.ca)
  • Approximately 50% of S-Adenosylmethionine (SAMe) is metabolized in the liver. (drugbank.ca)
Functional1
  • The functional intronless S-adenosylmethionine decarboxylase gene of the mouse (Amd-2) is linked. (deepdyve.com)
Activity2
  • The independent removal of all three the PfAdoMetDC domain parasite-specific inserts and subsequent activity analysis thereof showed that these inserts are essential for the catalytic activities of both the decarboxylase domains. (up.ac.za)
  • The decarboxylated S-adenosylmethionine content rose substantially because the activity of S-adenosylmethionine decarboxylase was increased in response to the decline in spermidine. (nih.gov)
AMD1 mRNA employs ribosome stalling as a mechanism for molecular memory formation | Nature
AMD1 mRNA employs ribosome stalling as a mechanism for molecular memory formation | Nature (nature.com)
Impact of S-Adenosylmethionine Decarboxylase 1 on Pulmonary Vascular RemodelingCLINICAL PERSPECTIVE | Circulation
Impact of S-Adenosylmethionine Decarboxylase 1 on Pulmonary Vascular RemodelingCLINICAL PERSPECTIVE | Circulation (circ.ahajournals.org)
Polyamine Cell Signaling | SpringerLink
Polyamine Cell Signaling | SpringerLink (link.springer.com)
RCSB PDB - 3H0W: Human AdoMetDC with 5'-Deoxy-5'-[(N-dimethyl)amino]-8-methyl-adenosine
RCSB PDB - 3H0W: Human AdoMetDC with 5'-Deoxy-5'-[(N-dimethyl)amino]-8-methyl-adenosine (rcsb.org)
Critical functions of the polyamine putrescine for proliferation and viability of Leishmania donovani parasites | SpringerLink
Critical functions of the polyamine putrescine for proliferation and viability of Leishmania donovani parasites | SpringerLink (link.springer.com)
Isolation and characterization of Saccharomyces cerevisiae mutants deficient in S-adenosylmethionine decarboxylase, spermidine,...
Isolation and characterization of Saccharomyces cerevisiae mutants deficient in S-adenosylmethionine decarboxylase, spermidine,... (jb.asm.org)
Recent Advances in Polyamine Metabolism and Abiotic Stress Tolerance
Recent Advances in Polyamine Metabolism and Abiotic Stress Tolerance (hindawi.com)
Plus it
Plus it (jpet.aspetjournals.org)
KEGG PATHWAY: hsa00270
KEGG PATHWAY: hsa00270 (genome.jp)
Anti-AMD1 antibody (ab65820) | Abcam
Anti-AMD1 antibody (ab65820) | Abcam (abcam.com)
Frontiers | Candidatus Nitrosocaldus cavascurensis, an Ammonia Oxidizing, Extremely Thermophilic Archaeon with a Highly Mobile...
Frontiers | Candidatus Nitrosocaldus cavascurensis, an Ammonia Oxidizing, Extremely Thermophilic Archaeon with a Highly Mobile... (frontiersin.org)
Fast skeletal muscle transcriptome of the Gilthead sea bream (Sparus aurata) determined by next generation sequencing | BMC...
Fast skeletal muscle transcriptome of the Gilthead sea bream (Sparus aurata) determined by next generation sequencing | BMC... (bmcgenomics.biomedcentral.com)
Relief of autoinhibition by conformational switch explains enzyme activation by a catalytically dead paralog | eLife
Relief of autoinhibition by conformational switch explains enzyme activation by a catalytically dead paralog | eLife (elifesciences.org)
Xenbase Personal Page
Xenbase Personal Page (xenbase.org)
Amd2 - PCR Primer Pair - Probe | PrimePCR | Bio-Rad
Amd2 - PCR Primer Pair - Probe | PrimePCR | Bio-Rad (bio-rad.com)
RNAi silencing of three homologues of S-adenosylmethionine decarboxylase gene in tapetal tissue of tomato results in male...
RNAi silencing of three homologues of S-adenosylmethionine decarboxylase gene in tapetal tissue of tomato results in male... (rd.springer.com)
Browse ORF cDNA clones by species Ovis aries, page 1
Browse ORF cDNA clones by species Ovis aries, page 1 (genscript.com)
DsbA_中国教育装备采购网
DsbA_中国教育装备采购网 (caigou.com.cn)
AMD1 polyclonal antibody - (PAB8007) - Products - Abnova
AMD1 polyclonal antibody - (PAB8007) - Products - Abnova (abnova.com)
Jan Larsson
Jan Larsson (umu.se)
Frontiers | Proteomic Analysis Reveals the Positive Roles of the Plant-Growth-Promoting Rhizobacterium NSY50 in the Response of...
Frontiers | Proteomic Analysis Reveals the Positive Roles of the Plant-Growth-Promoting Rhizobacterium NSY50 in the Response of... (frontiersin.org)
MAATS1 Gene - GeneCards | CFA91 Protein | CFA91 Antibody
MAATS1 Gene - GeneCards | CFA91 Protein | CFA91 Antibody (genecards.org)
23S rRNA Nucleotides in the Peptidyl Transferase Center Are Essential for Tryptophanase Operon Induction | Journal of...
23S rRNA Nucleotides in the Peptidyl Transferase Center Are Essential for Tryptophanase Operon Induction | Journal of... (jb.asm.org)
Frontiers | Pan-Cancer Analysis Reveals the Functional Importance of Protein Lysine Modification in Cancer Development |...
Frontiers | Pan-Cancer Analysis Reveals the Functional Importance of Protein Lysine Modification in Cancer Development |... (frontiersin.org)
Frontiers | Unraveling the Transcriptional Basis of Temperature-Dependent Pinoxaden Resistance in Brachypodium hybridum | Plant...
Frontiers | Unraveling the Transcriptional Basis of Temperature-Dependent Pinoxaden Resistance in Brachypodium hybridum | Plant... (frontiersin.org)
PDB 3dz3 structure summary ‹ Protein Data Bank in Europe (PDBe) ‹ EMBL-EBI
PDB 3dz3 structure summary ‹ Protein Data Bank in Europe (PDBe) ‹ EMBL-EBI (ebi.ac.uk)
Frontiers | Metabolism and Regulatory Functions of O-Acetylserine, S-Adenosylmethionine, Homocysteine, and Serine in Plant...
Frontiers | Metabolism and Regulatory Functions of O-Acetylserine, S-Adenosylmethionine, Homocysteine, and Serine in Plant... (frontiersin.org)
Skeletal muscle in aged mice reveals extensive transformation of muscle gene expression | BMC Genetics | Full Text
Skeletal muscle in aged mice reveals extensive transformation of muscle gene expression | BMC Genetics | Full Text (bmcgenet.biomedcentral.com)
Translational Regulation by Upstream Open Reading Frames and Its Relevance to Human Genetic Disease
Translational Regulation by Upstream Open Reading Frames and Its Relevance to Human Genetic Disease (els.net)
Ademetionine - DrugBank
Ademetionine - DrugBank (drugbank.ca)
Detailed Information (TTD) -- BIDD
Detailed Information (TTD) -- BIDD (bidd.nus.edu.sg)
Meloidogyne javanica fatty acid- and retinol-binding protein (Mj-FAR-1) regulates expression of lipid-, cell wall-, stress- and...
Meloidogyne javanica fatty acid- and retinol-binding protein (Mj-FAR-1) regulates expression of lipid-, cell wall-, stress- and... (bmcgenomics.biomedcentral.com)