Adenosylmethionine Decarboxylase: An enzyme that catalyzes the decarboxylation of S-adenosyl-L-methionine to yield 5'-deoxy-(5'-),3-aminopropyl-(1), methylsulfonium salt. It is one of the enzymes responsible for the synthesis of spermidine from putrescine. EC 4.1.1.50.Mitoguazone: Antineoplastic agent effective against myelogenous leukemia in experimental animals. Also acts as an inhibitor of animal S-adenosylmethionine decarboxylase.Carboxy-Lyases: Enzymes that catalyze the addition of a carboxyl group to a compound (carboxylases) or the removal of a carboxyl group from a compound (decarboxylases). EC 4.1.1.PolyaminesPutrescine: A toxic diamine formed by putrefaction from the decarboxylation of arginine and ornithine.S-Adenosylmethionine: Physiologic methyl radical donor involved in enzymatic transmethylation reactions and present in all living organisms. It possesses anti-inflammatory activity and has been used in treatment of chronic liver disease. (From Merck, 11th ed)Ornithine Decarboxylase: A pyridoxal-phosphate protein, believed to be the rate-limiting compound in the biosynthesis of polyamines. It catalyzes the decarboxylation of ornithine to form putrescine, which is then linked to a propylamine moiety of decarboxylated S-adenosylmethionine to form spermidine.Spermidine: A polyamine formed from putrescine. It is found in almost all tissues in association with nucleic acids. It is found as a cation at all pH values, and is thought to help stabilize some membranes and nucleic acid structures. It is a precursor of spermine.Diamines: Organic chemicals which have two amino groups in an aliphatic chain.S-Adenosylhomocysteine: 5'-S-(3-Amino-3-carboxypropyl)-5'-thioadenosine. Formed from S-adenosylmethionine after transmethylation reactions.Glutamate Decarboxylase: A pyridoxal-phosphate protein that catalyzes the alpha-decarboxylation of L-glutamic acid to form gamma-aminobutyric acid and carbon dioxide. The enzyme is found in bacteria and in invertebrate and vertebrate nervous systems. It is the rate-limiting enzyme in determining GAMMA-AMINOBUTYRIC ACID levels in normal nervous tissues. The brain enzyme also acts on L-cysteate, L-cysteine sulfinate, and L-aspartate. EC 4.1.1.15.Dopa Decarboxylase: One of the AROMATIC-L-AMINO-ACID DECARBOXYLASES, this enzyme is responsible for the conversion of DOPA to DOPAMINE. It is of clinical importance in the treatment of Parkinson's disease.Histidine Decarboxylase: An enzyme that catalyzes the decarboxylation of histidine to histamine and carbon dioxide. It requires pyridoxal phosphate in animal tissues, but not in microorganisms. EC 4.1.1.22.Methionine: A sulfur-containing essential L-amino acid that is important in many body functions.Methylation: Addition of methyl groups. In histo-chemistry methylation is used to esterify carboxyl groups and remove sulfate groups by treating tissue sections with hot methanol in the presence of hydrochloric acid. (From Stedman, 25th ed)Uroporphyrinogen Decarboxylase: An enzyme that catalyzes the decarboxylation of UROPORPHYRINOGEN III to coproporphyrinogen III by the conversion of four acetate groups to four methyl groups. It is the fifth enzyme in the 8-enzyme biosynthetic pathway of HEME. Several forms of cutaneous PORPHYRIAS are results of this enzyme deficiency as in PORPHYRIA CUTANEA TARDA; and HEPATOERYTHROPOIETIC PORPHYRIA.Orotidine-5'-Phosphate Decarboxylase: Orotidine-5'-phosphate carboxy-lyase. Catalyzes the decarboxylation of orotidylic acid to yield uridylic acid in the final step of the pyrimidine nucleotide biosynthesis pathway. EC 4.1.1.23.Tyrosine Decarboxylase: A pyridoxal-phosphate protein that catalyzes the conversion of L-tyrosine to tyramine and carbon dioxide. The bacterial enzyme also acts on 3-hydroxytyrosine and, more slowly, on 3-hydroxyphenylalanine. (From Enzyme Nomenclature, 1992) EC 4.1.1.25.Eflornithine: An inhibitor of ORNITHINE DECARBOXYLASE, the rate limiting enzyme of the polyamine biosynthetic pathway.Aromatic-L-Amino-Acid Decarboxylases: An enzyme group with broad specificity. The enzymes decarboxylate a range of aromatic amino acids including dihydroxyphenylalanine (DOPA DECARBOXYLASE); TRYPTOPHAN; and HYDROXYTRYPTOPHAN.Epitestosterone: The 17-alpha isomer of TESTOSTERONE, derived from PREGNENOLONE via the delta5-steroid pathway, and via 5-androstene-3-beta,17-alpha-diol. Epitestosterone acts as an antiandrogen in various target tissues. The ratio between testosterone/epitestosterone is used to monitor anabolic drug abuse.Breast Neoplasms: Tumors or cancer of the human BREAST.Dose-Response Relationship, Drug: The relationship between the dose of an administered drug and the response of the organism to the drug.Cell Line, Tumor: A cell line derived from cultured tumor cells.Spermine: A biogenic polyamine formed from spermidine. It is found in a wide variety of organisms and tissues and is an essential growth factor in some bacteria. It is found as a polycation at all pH values. Spermine is associated with nucleic acids, particularly in viruses, and is thought to stabilize the helical structure.Phenylacetates: Derivatives of phenylacetic acid. Included under this heading are a variety of acid forms, salts, esters, and amides that contain the benzeneacetic acid structure. Note that this class of compounds should not be confused with derivatives of phenyl acetate, which contain the PHENOL ester of ACETIC ACID.BerlinHomogentisic AcidAcetalsCatalysis: The facilitation of a chemical reaction by material (catalyst) that is not consumed by the reaction.Early Growth Response Protein 1: An early growth response transcription factor that has been implicated in regulation of CELL PROLIFERATION and APOPTOSIS.Apoptosis: One of the mechanisms by which CELL DEATH occurs (compare with NECROSIS and AUTOPHAGOCYTOSIS). Apoptosis is the mechanism responsible for the physiological deletion of cells and appears to be intrinsically programmed. It is characterized by distinctive morphologic changes in the nucleus and cytoplasm, chromatin cleavage at regularly spaced sites, and the endonucleolytic cleavage of genomic DNA; (DNA FRAGMENTATION); at internucleosomal sites. This mode of cell death serves as a balance to mitosis in regulating the size of animal tissues and in mediating pathologic processes associated with tumor growth.Melanoma: A malignant neoplasm derived from cells that are capable of forming melanin, which may occur in the skin of any part of the body, in the eye, or, rarely, in the mucous membranes of the genitalia, anus, oral cavity, or other sites. It occurs mostly in adults and may originate de novo or from a pigmented nevus or malignant lentigo. Melanomas frequently metastasize widely, and the regional lymph nodes, liver, lungs, and brain are likely to be involved. The incidence of malignant skin melanomas is rising rapidly in all parts of the world. (Stedman, 25th ed; from Rook et al., Textbook of Dermatology, 4th ed, p2445)Cytochrome c Group: A group of cytochromes with covalent thioether linkages between either or both of the vinyl side chains of protoheme and the protein. (Enzyme Nomenclature, 1992, p539)Caspases: A family of intracellular CYSTEINE ENDOPEPTIDASES that play a role in regulating INFLAMMATION and APOPTOSIS. They specifically cleave peptides at a CYSTEINE amino acid that follows an ASPARTIC ACID residue. Caspases are activated by proteolytic cleavage of a precursor form to yield large and small subunits that form the enzyme. Since the cleavage site within precursors matches the specificity of caspases, sequential activation of precursors by activated caspases can occur.Xanthobacter: A genus of gram-negative, aerobic, rod-shaped bacteria found in wet soil containing decaying organic material and in water. Cells tend to be pleomorphic if grown on media containing succinate or coccoid if grown in the presence of an alcohol as the sole carbon source. (From Bergey's Manual of Determinative Bacteriology, 9th ed)Ribulose-Bisphosphate Carboxylase: A carboxy-lyase that plays a key role in photosynthetic carbon assimilation in the CALVIN-BENSON CYCLE by catalyzing the formation of 3-phosphoglycerate from ribulose 1,5-biphosphate and CARBON DIOXIDE. It can also utilize OXYGEN as a substrate to catalyze the synthesis of 2-phosphoglycolate and 3-phosphoglycerate in a process referred to as photorespiration.Ethylene Dichlorides: Toxic, chlorinated, saturated hydrocarbons. Include both the 1,1- and 1,2-dichloro isomers. The latter is considerably more toxic. It has a sweet taste, ethereal odor and has been used as a fumigant and intoxicant among sniffers. Has many household and industrial uses.Gram-Negative Aerobic Bacteria: A large group of aerobic bacteria which show up as pink (negative) when treated by the gram-staining method. This is because the cell walls of gram-negative bacteria are low in peptidoglycan and thus have low affinity for violet stain and high affinity for the pink dye safranine.Hydrolases: Any member of the class of enzymes that catalyze the cleavage of the substrate and the addition of water to the resulting molecules, e.g., ESTERASES, glycosidases (GLYCOSIDE HYDROLASES), lipases, NUCLEOTIDASES, peptidases (PEPTIDE HYDROLASES), and phosphatases (PHOSPHORIC MONOESTER HYDROLASES). EC 3.Rhodospirillum rubrum: Vibrio- to spiral-shaped phototrophic bacteria found in stagnant water and mud exposed to light.Sugar Alcohols: Polyhydric alcohols having no more than one hydroxy group attached to each carbon atom. They are formed by the reduction of the carbonyl group of a sugar to a hydroxyl group.(From Dorland, 28th ed)Terminology as Topic: The terms, expressions, designations, or symbols used in a particular science, discipline, or specialized subject area.Enzymes: Biological molecules that possess catalytic activity. They may occur naturally or be synthetically created. Enzymes are usually proteins, however CATALYTIC RNA and CATALYTIC DNA molecules have also been identified.International Agencies: International organizations which provide health-related or other cooperative services.Molecular Biology: A discipline concerned with studying biological phenomena in terms of the chemical and physical interactions of molecules.Databases, Genetic: Databases devoted to knowledge about specific genes and gene products.Internet: A loose confederation of computer communication networks around the world. The networks that make up the Internet are connected through several backbone networks. The Internet grew out of the US Government ARPAnet project and was designed to facilitate information exchange.International Cooperation: The interaction of persons or groups of persons representing various nations in the pursuit of a common goal or interest.Retinoids: A group of tetraterpenes, with four terpene units joined head-to-tail. Biologically active members of this class are used clinically in the treatment of severe cystic ACNE; PSORIASIS; and other disorders of keratinization.Vitamin A: Retinol and derivatives of retinol that play an essential role in metabolic functioning of the retina, the growth of and differentiation of epithelial tissue, the growth of bone, reproduction, and the immune response. Dietary vitamin A is derived from a variety of CAROTENOIDS found in plants. It is enriched in the liver, egg yolks, and the fat component of dairy products.Receptors, Retinoic Acid: Proteins in the nucleus or cytoplasm that specifically bind RETINOIC ACID or RETINOL and trigger changes in the behavior of cells. Retinoic acid receptors, like steroid receptors, are ligand-activated transcription regulators. Several types have been recognized.Keratinocytes: Epidermal cells which synthesize keratin and undergo characteristic changes as they move upward from the basal layers of the epidermis to the cornified (horny) layer of the skin. Successive stages of differentiation of the keratinocytes forming the epidermal layers are basal cell, spinous or prickle cell, and the granular cell.Retinoid X Receptors: A subtype of RETINOIC ACID RECEPTORS that are specific for 9-cis-retinoic acid which function as nuclear TRANSCRIPTION FACTORS that regulate multiple signaling pathways.Ligands: A molecule that binds to another molecule, used especially to refer to a small molecule that binds specifically to a larger molecule, e.g., an antigen binding to an antibody, a hormone or neurotransmitter binding to a receptor, or a substrate or allosteric effector binding to an enzyme. Ligands are also molecules that donate or accept a pair of electrons to form a coordinate covalent bond with the central metal atom of a coordination complex. (From Dorland, 27th ed)Tretinoin: An important regulator of GENE EXPRESSION during growth and development, and in NEOPLASMS. Tretinoin, also known as retinoic acid and derived from maternal VITAMIN A, is essential for normal GROWTH; and EMBRYONIC DEVELOPMENT. An excess of tretinoin can be teratogenic. It is used in the treatment of PSORIASIS; ACNE VULGARIS; and several other SKIN DISEASES. It has also been approved for use in promyelocytic leukemia (LEUKEMIA, PROMYELOCYTIC, ACUTE).

A new method for the assay of tissue. S-adenosylhomocysteine and S-adenosylmethione. Effect of pyridoxine deficiency on the metabolism of S-adenosylhomocysteine, S-adenosylmethionine and polyamines in rat liver. (1/292)

The hepatic synthesis and accumulation of S-adenosylhomocysteine, S-adenosylmethionine and polyamines were studied in normal and vitamin B-6-deficient male albino rats. A method involving a single chromatography on a phosphocellulose column was developed for the determination of S-adenosylhomocysteine and S-adenosylmethionine from tissue samples. Feeding the rat with pyridoxine-deficient diet for 3 or 6 weeks resulted in a four- to five-fold increase in the concentration of S-adenosylhomocysteine, whereas that of S-adenosylmethionine was only slighly elevated. The concentration of putrescine was decreased to half, that of spermidine was somewhat decreased and that of spermine remained fairly constant. The activities of L-ornithine decarboxylase, S-adenosyl-L-methionine decarboxylase, L-methionine adenosyltransferase and S-adenosyl-L-homocysteine hydrolase were moderately increased. S-Adenosylmethionine decarboxylase showed no requirement for pyridoxal 5'-phosphate. The major effect of pyridoxine deficiency of S-adenosylmethionine metabolism seems to be a block in the utilization of S-adenosylhomocysteine, resulting in the accumulation of this metabolite to a concentration that may inhibit biological methylation reactions.  (+info)

Agmatine modulates polyamine content in hepatocytes by inducing spermidine/spermine acetyltransferase. (2/292)

Agmatine has been proposed as the physiological ligand for the imidazoline receptors. It is not known whether it is also involved in the homoeostasis of intracellular polyamine content. To show whether this is the case, we have studied the effect of agmatine on rat liver cells, under both periportal and perivenous conditions. It is shown that agmatine modulates intracellular polyamine content through its effect on the synthesis of the limiting enzyme of the interconversion pathway, spermidine/spermine acetyltransferase (SSAT). Increased SSAT activity is accompanied by depletion of spermidine and spermine, and accumulation of putrescine and N1-acetylspermidine. Immunoblotting with a specific polyclonal antiserum confirms the induction. At the same time S-adenosylmethionine decarboxylase activity is significantly increased, while ornithine decarboxylase (ODC) activity and the rate of spermidine uptake are reduced. This is not due to an effect on ODC antizyme, which is not significantly changed. All these modifications are observed in HTC cells also, where they are accompanied by a decrease in proliferation rate. SSAT is also induced by low oxygen tension which mimics perivenous conditions. The effect is synergic with that promoted by agmatine.  (+info)

Mechanistic studies of the processing of human S-adenosylmethionine decarboxylase proenzyme. Isolation of an ester intermediate. (3/292)

Human S-adenosylmethionine decarboxylase is synthesized as a proenzyme that undergoes an autocatalytic cleavage reaction generating the alpha and beta subunits and forming the pyruvate prosthetic group, which is derived from an internal Ser residue (Ser-68). The mechanism of this processing reaction was studied using site-directed mutagenesis of conserved residues (His-243 and Ser-229) located close to the cleavage site. Mutant S229A failed to process, and mutant S229C cleaved very slowly, whereas mutant S229T processed normally, suggesting that the hydroxyl group of residue 229 is required for the processing reaction where Ser-229 may act as a proton acceptor. Mutant His-243A cleaved very slowly, forming a small amount of the correctly processed pyruvoyl enzyme but a much larger proportion of the alpha subunit with an amino-terminal Ser. The cleavage to form the latter was greatly enhanced by hydroxylamine. This result suggests that the N-O acyl shift needed for ester formation occurs normally in this mutant but that the next step, which is a beta-elimination reaction leading to the two subunits, does not occur. His-243 may therefore act as the basic residue that extracts the hydrogen of the alpha-carbon of Ser-68 in the ester in order to facilitate this reaction. The availability of the recombinant H243A S-adenosylmethionine decarboxylase proenzyme provides a useful model system to examine the processing reaction in vitro and test the design of specific inactivators aimed at blocking the production of the pyruvoyl prosthetic group.  (+info)

Identification of functionally important residues of Arabidopsis thaliana S-adenosylmethionine decarboxylase. (4/292)

The Arabidopsis thaliana S-adenosylmethionine decarboxylase (AdoMetDC) cDNA (GenBank(TM) U63633) was cloned, and the AdoMetDC protein was expressed, purified, and characterized. The K(m) value for S-adenosylmethionine (AdoMet) is 23.1 microM and the K(i) value for methylglyoxal bis-(guanylhydrazone) (MGBG) is 0.15 microM. Site-specific mutagenesis was performed on the AdoMetDC to introduce mutations at conserved cysteine (Cys(50), Cys(83), and Cys(230)) and lysine(81) residues, chosen by examination of the conserved sequence and proved to be involved in enzymatic activity by chemical modification. The AdoMetDC mutants K81A and C83A retained up to 60 and 10% of wild type activity, respectively, demonstrating that lysyl and sulfhydryl groups are required for full catalytic activity. However, changing Cys(50) and Cys(230) to alanine had minimal effects on the catalytic activity. Changing Lys(81) to alanine produced an altered substrate specificity. When lysine was used as a substrate instead of AdoMet, the substrate specificity for lysine increased 6-fold. The K(m) value for AdoMet is 11-fold higher than that of the wild type, but the V(max) value is more than 60%. Taken together, the results suggest that the lysine(81) residue is critical for substrate binding.  (+info)

Putrescine does not support the migration and growth of IEC-6 cells. (5/292)

The migration of IEC-6 cells is inhibited when the cells are depleted of polyamines by inhibiting ornithine decarboxylase with alpha-difluoromethylornithine (DFMO). Exogenous putrescine, spermidine, and spermine completely restore cell migration inhibited by DFMO. Because polyamines are interconverted during their synthesis and catabolism, the specific role of individual polyamines in intestinal cell migration, as well as growth, remains unclear. In this study, we used an inhibitor of S-adenosylmethionine decarboxylase, diethylglyoxal bis(guanylhydrazone)(DEGBG), to block the synthesis of spermidine and spermine from putrescine. We found that exogenous putrescine does not restore migration and growth of IEC-6 cells treated with DFMO plus DEGBG, whereas exogenous spermine does. In addition, the normal distribution of actin filaments required for migration, which is disrupted in polyamine-deficient cells, could be achieved by adding spermine but not putrescine along with DFMO and DEGBG. These results indicate that putrescine, by itself, is not essential for migration and growth, but that it is effective because it is converted into spermidine and/or spermine.  (+info)

Tumor progression is accompanied by significant changes in the levels of expression of polyamine metabolism regulatory genes and clusterin (sulfated glycoprotein 2) in human prostate cancer specimens. (6/292)

Using Northern blotting, the expression levels of the genes for polyamine metabolism regulatory proteins and clusterin have been measured in a series of 23 human prostate cancers (CaPs) dissected from radical prostatectomy specimens. Patient matched, nontumor tissue was dissected from benign areas of the gland. The results indicate that transcripts encoding ornithine decarboxylase (ODC), ODC antizyme, adenosylmethionine decarboxylase, and spermidine/spermine N1-acetyltransferase (SSAT) were significantly higher, whereas clusterin (sulfated glycoprotein 2) mRNA was significantly lower in tumors compared with the benign tissue. All mRNA levels were compared with those of histone H3 and growth arrest-specific gene 1, markers of cell proliferation and cell quiescence, respectively, and glyceraldehyde 3-phosphate dehydrogenase, a housekeeping gene. In poorly differentiated and locally invasive CaPs and in tumors with unfavorable prognosis or total prostate-specific antigen (PSA) levels > 10.0 ng/ml at diagnosis, an overall increase in the levels of H3 mRNA and a decrease in growth arrest-specific gene 1 mRNA was detected, indicative of higher proliferation activity, whereas the differences in expression levels for the polyamine metabolism and clusterin genes were higher. ODC and SSAT changes were positively correlated in normal tissue but not in high-grade cancer, whereas ODC antizyme and SSAT changes were positively correlated in more malignant CaPs but not in normal tissue. Tumor classification based on the changes in expression levels of all of the genes studied could be correlated to differentiation grade and local invasiveness classification systems in 72.2 and 83.3% of the cases, respectively. In a 1-year follow-up period, three patients whose CaPs ranked as less aggressive according to clinical staging, but classified as advanced cancers with the proposed molecular classification, showed increases in total PSA levels, indicative of tumor relapse. Thus, molecular classification, based on gene expression, may enhance the available prognostic tools for prostate tumors.  (+info)

Changes in gene expression in response to polyamine depletion indicates selective stabilization of mRNAs. (7/292)

We used differential display analysis to identify mRNAs responsive to changes in polyamine synthesis. As an overproducing model we used the kidneys of transgenic hybrid mice overexpressing ornithine decarboxylase and S-adenosylmethionine decarboxylase, two key enzymes in polyamine biosynthesis. To identify mRNAs that respond to polyamine starvation, we treated Rat-2 cells with alpha-difluoromethylornithine, a specific inhibitor of polyamine biosynthesis. We isolated 41 partial cDNA clones, representing 37 differentially expressed mRNAs. Of these, 15 have similarity with known genes, five appear to be similar to reported expressed sequence tags and seventeen clones were novel sequences. Of the 35 mRNAs expressed differentially after alpha-difluoromethylornithine treatment, 26 were up-regulated. The expression of only three mRNAs was altered in the transgenic animals and all three were down-regulated. Determination of mRNA half-life of three of the mRNAs up-regulated in response to polyamine depletion revealed that the accumulation results from stabilization of the messages. Because most of the transcripts identified from Rat-2 cells suffering polyamine starvation were accumulated, we conclude that polyamine depletion, while blocking cell growth, is stabilizing mRNAs. This may be due to the lack of spermidine for post-translational modification of the eukaryotic initiation factor 5A, which plays a major role in mRNA turnover. The coupling of mRNA stabilization with cell-growth arrest in response to polyamine starvation provides cells with an economical way to resume growth after recovery from polyamine deficiency.  (+info)

In the human malaria parasite Plasmodium falciparum, polyamines are synthesized by a bifunctional ornithine decarboxylase, S-adenosylmethionine decarboxylase. (8/292)

The polyamines putrescine, spermidine, and spermine are crucial for cell differentiation and proliferation. Interference with polyamine biosynthesis by inhibition of the rate-limiting enzymes ornithine decarboxylase (ODC) and S-adenosylmethionine decarboxylase (AdoMetDC) has been discussed as a potential chemotherapy of cancer and parasitic infections. Usually both enzymes are individually transcribed and highly regulated as monofunctional proteins. We have isolated a cDNA from the malaria parasite Plasmodium falciparum that encodes both proteins on a single open reading frame, with the AdoMetDC domain in the N-terminal region connected to a C-terminal ODC domain by a hinge region. The predicted molecular mass of the entire transcript is 166 kDa. The ODC/AdoMetDC coding region was subcloned into the expression vector pASK IBA3 and transformed into the AdoMetDC- and ODC-deficient Escherichia coli cell line EWH331. The resulting recombinant protein exhibited both AdoMetDC and ODC activity and co-eluted after gel filtration on Superdex S-200 at approximately 333 kDa, which is in good agreement with the molecular mass of approximately 326 kDa determined for the native protein from isolated P. falciparum. SDS-polyacrylamide gel electrophoresis analysis of the recombinant ODC/AdoMetDC revealed a heterotetrameric structure of the active enzyme indicating processing of the AdoMetDC domain. The data presented describe the occurrence of a unique bifunctional ODC/AdoMetDC in P. falciparum, an organization which is possibly exploitable for the design of new antimalarial drugs.  (+info)

Polyamine-biosynthesis activity is known to be negatively regulated by intracellular polyamine pools. Accordingly, treatment of cultured L1210 cells with 10 microM-spermine rapidly and significantly lowered ornithine decarboxylase (ODC) and S-adenosylmethionine decarboxylase (AdoMetDC) activities in a sequential manner. By contrast, treatment for 48 h with 10 microM of the unsaturated spermine analogue 6-spermyne lowered AdoMetDC activity, but not ODC activity. An initial decrease in ODC activity at 2 h was attributed to a transient increase in free intracellular spermidine and spermine brought about through their displacement by the analogue. Thereafter, ODC activity recovered steadily to control values as 6-spermyne pools increased and spermidine and spermine pools decreased owing to analogue suppression of AdoMetDC activity. The apparent ability of 6-spermyne to regulate AdoMetDC, but not ODC, activity suggests an interesting structure-function correlation and demonstrates that the typical ...
TY - JOUR. T1 - Effect of Inhibitors of S-Adenosylmethionine Decarboxylase on Polyamine Content and Growth of L1210 Cells. AU - Pegg, Anthony. AU - Jones, Daniel B.. AU - Secrist, John A.. PY - 1988/3/1. Y1 - 1988/3/1. N2 - Analogues of S-adenosylmethionine that were designed as inhibitors of S-adenosylmethionine decarboxylase were tested for their abilities to inhibit the purified enzyme from rat prostate. The most potent inhibitors were 5′-deoxy-5′-[N-methyl-N-[2-(aminooxy)ethyl]amino]adenosine (MAOEA) and 5′-deoxy-5′-[N-methyl-N-(3-hydrazinopropyl)amino]adenosine (MHZPA), which had I50values of 400 nM and 70 nM, respectively, when added directly to the assay medium under standard conditions. These compounds were irreversible inactivators of the enzyme, and more than 95% of the activity was lost within 15 min of exposure to 5 μM MAOEA or 0.5 μM MHZPA. Both inhibitors led to a large reduction in the content of decarboxylated S-adenosylmethionine in LI210 cells and to a substantial ...
This booklet contains thirteen chapters and opens with an creation to a few novel biochemical elements of SAM and comparable sulfur compounds, paying specific consciousness to transmethylation reactions; polyamine biosynthesis and strange organic roles of adenosylmethionine; metabolic pathways relating to adenosine-sulfur compounds; and delivery of adenosylmethionine. the next chapters speak about a couple of chemical and biochemical houses of SAM in addition to its pharmacological elements in the CNS. The relation among folate and adenosylmethionine metabolism within the mind is tested, besides the influence of SAM management on noradrenaline and serotonin metabolism in rat mind; cerebral usage of adenosylmethionine and adenosylhomocysteine; and antidepressant results of adenosylmethionine. Methylation in schizophrenia can also be thought of ...
Polyamines, ubiquitous organic aliphatic cations, have been implicated in a myriad of physiological and developmental processes in many organisms, but their in vivo functions remain to be determined. We expressed a yeast S-adenosylmethionine decarboxylase gene (ySAMdc; Spe2) fused with a ripening-inducible E8 promoter to specifically increase levels of the polyamines spermidine and spermine in tomato fruit during ripening. Independent transgenic plants and their segregating lines were evaluated after cultivation in the greenhouse and in the field for five successive generations. The enhanced expression of the ySAMdc gene resulted in increased conversion of putrescine into higher polyamines and thus to ripening-specific accumulation of spermidine and spermine. This led to an increase in lycopene, prolonged vine life, and enhanced fruit juice quality. Lycopene levels in cultivated tomatoes are generally low, and increasing them in the fruit enhances its nutrient value. Furthermore, the rates of ethylene
In addition to acting as template for protein synthesis, messenger RNA (mRNA) often contains sensory sequence elements that regulate this process. Here we report a new mechanism that limits the number of complete protein molecules that can be synthesized from a single mRNA molecule of the human AMD1 gene encoding adenosylmethionine decarboxylase 1 (AdoMetDC). A small proportion of ribosomes translating AMD1 mRNA stochastically read through the stop codon of the main coding region. These readthrough ribosomes then stall close to the next in-frame stop codon, eventually forming a ribosome queue, the length of which is proportional to the number of AdoMetDC molecules that were synthesized from the same AMD1 mRNA ...
A large superfamily of enzymes uses S‐adenosyl‐l‐methionine (SAM) to generate high‐energy carbon radicals as intermediates in a variety of metabolic and biosynthetic reactions
PROZYME is a unique, all natural, high potency supplement, made up of four highly concentrated and purified natural plant-derived enzymes (lipase, amylase, protease, and cellulase)...
As pets age, their systems begin to loose the ability to fully use all the vitamins, minerals, fats, carbohydrates and proteins in their food. ProZyme® Plus helps your pets body absorb all of these nutrients to maintain better health.
Treatment of perfused rabbit heart with reserpine causes a decrease of incorporation of labelled precursors into RNA species of subcellular fractions and polyamines. Ornithine decarboxylase, S-adenosylmethionine decarboxylase and cytoplasmic Mn2+-stimulated polyadenylate polymerase activities are not modified. Addition of noradrenaline to reserpine-treated perfused hearts enhances, compared with the control, the incorporation of precursor into RNA in all subcellular fractions other than the nuclear one, restores incorporation of labelled putrescine into polyamines, enhances ornithine decarboxylase and S-adenosylmethionine decarboxylase activities and causes a 12-fold increase in cytoplasmic Mn2+-dependent polyadenylate polymerase activity. After treatment with noradrenaline the increase in radioactivity was found solely in AMP after hydrolysis of microsomal RNA to nucleoside monophosphates. ...
AMD1 - AMD1 (Myc-DDK-tagged)-Human adenosylmethionine decarboxylase 1 (AMD1), transcript variant 1 available for purchase from OriGene - Your Gene Company.
Buy or Rent Biochemical and Pharmacological Roles of Adenosylmethionine and the Central Nervous System as an eTextbook and get instant access.
The effects of Prozyme knockout on blood form T. brucei.(A) Cell growth curves. Log cell number versus days in culture. Triangle, Flag-tagged prozyme Expressed
Learn more about S-Adenosylmethionine (SAMe) at Portsmouth Regional Hospital Supplement Forms/Alternate Names Ademetionine S-Adenosylmethionine SAM Uses Principal...
Learn more about S-Adenosylmethionine (SAMe) at Memorial Hospital Supplement Forms/Alternate Names Ademetionine S-Adenosylmethionine SAM Uses Principal Proposed...
S-adenosylmethionine (also known as SAMe) is a manmade form of a chemical that occurs naturally in the body. SAMe has been used in alternative medicine as a likely effective aid in reducing the symptoms of depression, and in treating osteoarthritis. SAMe is possibly effective in treating liver disease during pregnancy...
The amazing people in our crew are friendly, passionate, hardworking pet owners. Each brings something to this family of stores and makes us who we are!
Polyamine/Methionine cycle (red: analyzed compound; involved enzymes: 1) S-adenosylmethionine synthetase [EC:2.5.1.6]; 2) S-adenosylmethionine decarboxylase [EC
Learn more about S-Adenosylmethionine (SAMe) at LewisGale Regional Health System Supplement Forms/Alternate Names Ademetionine S-Adenosylmethionine SAM Uses Principal...
Learn more about S-Adenosylmethionine (SAMe) at Medical Center of Aurora Supplement Forms/Alternate Names Ademetionine S-Adenosylmethionine SAM Uses Principal...
Research & Development is the foundation of the continued success of an enterprise henceforth. 24 Hours High Speed Organic Fertilizer Fermentation System. Closed Environment - No Secondary Pollution Temperature, water content and pH are kept at...
24 High Speed Organic Fermentation Fertilizer Machine We are a manufcturer of organic fertilizer in Malaysia. Technology and consultation provider. Research & Development is the foundation of the continued success of an enterprise henceforth.
Buy high quality 6-[[2-(tert-Butyldimethylsilyloxy)ethyl]methylamino]pyridin-3-ol 326496-02-0 from toronto research chemicals Inc.
10561-01-0 - UQDJZHBCEVUVNR-OWBHPGMISA-N - 3,5-Pyrazolidinedione, 4-(3-chloro-2-butenyl)-1,2-diphenyl- - Similar structures search, synonyms, formulas, resource links, and other chemical information.
TY - JOUR. T1 - Effects of growth hormone and glucagon on ornithine decarboxylase activity and adenosine 3,5-Monophosphate levels in isolated rat hepatocytes. AU - Klingensmith, Mark R.. AU - Freifeld, Alison G.. AU - Pegg, Anthony E.. AU - Jefferson, Leonard S.. PY - 1980/1. Y1 - 1980/1. N2 - l-Ornithine decarboxylase (l-ornithine carboxylase; E.C. 4.1.1.17) activity was studied in isolated rat hepatocytes maintained as suspensions of free cells. Activity in freshly prepared hepatocytes was reduced to approximately 10% of the amount found in the intact liver. Activity increased to the same level as that found in the intact liver when the cells were incubated for 4 h in medium containing a mixture of 20 amino acids at concentrations 10 times those found in normal rat plasma. The increase in activity between 2 and 4 h of incubation was substantially augmented when the medium also contained 25 μg/ml of a crude preparation of bovine GH (bGH; NIH-GHB18). The increase in activity and the hormone ...
PubMed Central Canada (PMC Canada) provides free access to a stable and permanent online digital archive of full-text, peer-reviewed health and life sciences research publications. It builds on PubMed Central (PMC), the U.S. National Institutes of Health (NIH) free digital archive of biomedical and life sciences journal literature and is a member of the broader PMC International (PMCI) network of e-repositories.
S-adenosylmethionine, also known as AdoMet or SAMe, is a biochemical intermediate involved in methyl group transfers. S-adenosylmethionine is formed from from adenosine triphosphate (ATP) and methionine, catalyzed by the enzyme methionine adenosyltransferase. S-adeosylmethionine is sold as a supplement under the common names SAM, SAMe, and SAM-e. A synthesized form of SAM-e is considered a supplement in the U.S., but SAM-e has been sold as a prescription drug in parts of Europe for decades. As a supplement, SAMe has been used to treat osteoarthritis, depression, fibromyalgia, and other conditions. Scientific studies are conflicted on the benefits of SAMe as a supplement.
Klepacki et al. (Clin Chim Acta. 2013 Jun 5;421:91-7. doi: 10.1016/j.cca.2013.03.003) developed reliable methodology to measure adenosylmethionine (SAM) and S-adenosylhomocysteine (SAH) levels via LC-MS/MS. The found SAH concentrations to be elevated in kidney transplant patients associated with acute rejection and nephrotoxicity events compared to healthy controls and transplant patients without transplant dysfunction. This brings up interesting questions about the role of metabolism […]. ...
Semantic Scholar extracted view of Radical S-adenosylmethionine enzymes: mechanism, control and function. by Martin R. Challand et al.
Boc Sciences is the worlds leading provider for special chemicals. We offer qualified products for 2212-32-0(2-((2-(dimethylamino)ethyl)methylamino)-ethanol,),please inquire us for 2212-32-0(2-((2-(dimethylamino)ethyl)methylamino)-ethanol,).
Structure, properties, spectra, suppliers and links for: 4-{(1S)-1-Hydroxy-2-[(|sup>2|/sup>H|sub>3|/sub>)methylamino]ethyl}-1,2-benzenediol.
Benzoic acid,2-[[(1,1-dimethylethoxy)carbonyl]methylamino]-/ACM141871025 can be provided in Alfa Chemistry. We are dedicated to provide our customers the best products and services.
This page contains information on the chemical Benzeneacetic acid, alpha-hydroxy-alpha-phenyl-, 2-(2-hydroxy-1,4-dioxo-4-phenyl-2-butenyl) hydrazide, (Z)- including: 2 synonyms/identifiers.
Learn more about SSRIs at Grand Strand Medical Center SAMe (S-Adenosylmethionine) and 5-HTP -Possible Harmful Interaction ...
Peptide sequence-dependent ribosomal stalling, as occurs after translation of uORF2, has been observed in other eukaryotic and bacterial systems (21, 36, 47). Our results raise the question of whether release factors play a role in other uORF-mediated ribosomal stalling events. The S-adenosylmethionine decarboxylase uORF codes for a sequence-dependent polyamine-responsive peptide that, like uORF2, causes ribosomal stalling specifically at the termination codon and results in accumulation of the uORF peptidyl-tRNA (30, 40). While the critical sequences of this uORF do not include the carboxy-terminal residue, the penultimate and antepenultimate residues have been implicated (35). Thus, it is possible that eRF1 acts in concert with the polyamine effector and the nascent peptide to inhibit the termination reaction. Regulation of the bacterial tryptophanase operon gene tnaC also has intriguing similarities to the uORF2 mechanism (22-24). Toeprinting assays show that ribosomes translating tnaC stall ...
A total of 764 fresh clinical isolates were used to test a rapid method for determining lysine, arginine, and ornithine decarboxylase activity as well as arginine dihydrolase activity. The conventional Møller decarboxylase broth was tested in parallel with the rapid method on 234 Enterobacteriaceae and 140 non-fermentative Gram-negative rods. The 0·3% agar method was tested in parallel on 245 Enterobacteriaceae and 146 non-fermentors. All media were checked at half-hour or hourly intervals for up to eight hours, with the final reading taken after incubation for 24 hours at 37°C. The rapid method detected 17 positive decarboxylase or dihydrolase reactions that were not detected by the Møller broth and 16 more than the agar medium when testing Enterobacteriaceae. The corresponding figures for the nonfermentative Gram-negative rods were three and two respectively. Lysine and ornithine decarboxylase were generally detected by the rapid broth in two to four hours incubation while the arginine ...
Alfa Aesar™ 4-(Methylamino)phenol sulfate, ACS, 99.0-101.5% 50g Alfa Aesar™ 4-(Methylamino)phenol sulfate, ACS, 99.0-101.5% Mercaptoe to Methoxya...
TY - JOUR. T1 - Structural studies of the S-adenosyl-L-methionine binding proteins. AU - Raju, Deepa K.M.. AU - Ajees, A. Abdul. PY - 2017/1/1. Y1 - 2017/1/1. N2 - The post-genomic era produces an overwhelming amount of experimental data, but majority of such data lacks the characterization of its functions. Structure based approaches are useful to understand and characterize the functional aspects of proteins. Given the burgeoning requirement of understanding the functional aspects of various enzymes, we report a systematic structure based study of methyltransferases bound with S-adenosyl-L-methionine (SAM). Through this work, we identified the conserved amino acids of methyltransferase, which are interacting with SAM.. AB - The post-genomic era produces an overwhelming amount of experimental data, but majority of such data lacks the characterization of its functions. Structure based approaches are useful to understand and characterize the functional aspects of proteins. Given the burgeoning ...
1P7L: Crystal structure of the s-adenosylmethionine synthetase ternary complex: a novel catalytic mechanism of s-adenosylmethionine synthesis from ATP and MET.
1MXC: Structure and function of S-adenosylmethionine synthetase: crystal structures of S-adenosylmethionine synthetase with ADP, BrADP, and PPi at 28 angstroms resolution.
Structure, properties, spectra, suppliers and links for: S-Adenosyl-L-methionine, Ademetionine, S-Adenosyl methionine, 29908-03-0.
Buy high quality N-[3-Amino-4-(methylamino)benzoyl]-N-2-pyridinyl-β-alanine-d3 Ethyl Ester from toronto research chemicals Inc.
2-[[2-(2-Hydroxyethoxy)ethyl]methylamino]ethanol/ACM68213989 can be provided in Alfa Chemistry. We are dedicated to provide our customers the best products and services.
38171-97-0 - FFQXRZVINHANAL-QPJJXVBHSA-N - 1-Methyl-4-(1-methyl-2-butenyl)naphthalene - Similar structures search, synonyms, formulas, resource links, and other chemical information.
This page contains information on the chemical Barbituric acid, 5-(2-butenyl)-5-(1-methylbutyl)-, sodium salt including: 4 synonyms/identifiers.
Learn more about SSRIs at Sky Ridge Medical Center SAMe (S-Adenosylmethionine) and 5-HTP -Possible Harmful Interaction ...
Make no contact with the spilled material. ELIMINATE all ignition sources and ground all equipment. Stop leak if you can do it without risk. A vapor suppressing foam may be used to reduce vapors. Absorb or cover with dry earth, sand or other non-combustible material and transfer to containers. Use clean non-sparking tools to collect absorbed material ...
MDASLEKIADPTLAEMGKNLKEAVKMLEDSQRRTEEENGKKLISGDIPGPLQGSGQDMVSILQLVQNLMH 1 - 70 GDEDEEPQSPRIQNIGEQGHMALLGHSLGAYISTLDKEKLRKLTTRILSDTTLWLCRIFRYENGCAYFHE 71 - 140 EEREGLAKICRLAIHSRYEDFVVDGFNVLYNKKPVIYLSAAARPGLGQYLCNQLGLPFPCLCRVPCNTVF 141 - 210 GSQHQMDVAFLEKLIKDDIERGRLPLLLVANAGTAAVGHTDKIGRLKELCEQYGIWLHVEGVNLATLALG 211 - 280 YVSSSVLAAAKCDSMTMTPGPWLGLPAVPAVTLYKHDDPALTLVAGLTSNKPTDKLRALPLWLSLQYLGL 281 - 350 DGFVERIKHACQLSQRLQESLKKVNYIKILVEDELSSPVVVFRFFQELPGSDPVFKAVPVPNMTPSGVGR 351 - 420 ERHSCDALNRWLGEQLKQLVPASGLTVMDLEAEGTCLRFSPLMTAAVLGTRGEDVDQLVACIESKLPVLC 421 - 490 CTLQLREEFKQEVEATAGLLYVDDPNWSGIGVVRYEHANDDKSSLKSDPEGENIHAGLLKKLNELESDLT 491 - 560 FKIGPEYKSMKSCLYVGMASDNVDAAELVETIAATAREIEENSRLLENMTEVVRKGIQEAQVELQKASEE 561 - 630 RLLEEGVLRQIPVVGSVLNWFSPVQALQKGRTFNLTAGSLESTEPIYVYKAQGAGVTLPPTPSGSRTKQR 631 - 700 LPGQKPFKRSLRGSDALSETSSVSHIEDLEKVERLSSGPEQITLEASSTEGHPGAPSPQHTDQTEAFQKG 701 - 770 VPHPEDDHSQVEGPESLR 771 - 788 ...
Humboldt-Universitaet zu Berlin , Department of Biology , Structural Biology / Biochemistry , Publications , 4-Hydroxyphenylacetate decarboxylase activating enzyme catalyses a classical S-adenosylmethionine reductive cleavage reaction ...
(2S)-2-(methylamino)-3-phenylpropanoic acid 2566-30-5 NMR spectrum, (2S)-2-(methylamino)-3-phenylpropanoic acid H-NMR spectral analysis, (2S)-2-(methylamino)-3-phenylpropanoic acid C-NMR spectral analysis ect.
Die Universität zu Köln ist eine Exzellenzuniversität mit dem klassischen Fächerspektrum einer Volluniversität. Als eine der größen Hochschulen Europas arbeitet sie in Forschung und Lehre auch international auf höchstem Niveau.
Ono, M., Inoue, H., Suzuki, F. and Takeda, Y. (1972). "Studies on ornithine decarboxylase from the liver of thioacetamide-treated rats. Purification and some properties". Biochim. Biophys. Acta 284: 285-297. PMID 5073764. ...
2-amino-6-(methylamino)hexanoic acid,hydrochloride 7622-29-9 NMR spectrum, 2-amino-6-(methylamino)hexanoic acid,hydrochloride H-NMR spectral analysis, 2-amino-6-(methylamino)hexanoic acid,hydrochloride C-NMR spectral analysis ect.
A proenzyme (or zymogen) is an inactivate form of an enzyme (enzyme precursor) which requires a biochemical change in order to become active ...
MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminthreonine-phosphate decarboxylase (TIGR01140; EC 4.1.1.81; HMM-score: 95.1) ...
MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminthreonine-phosphate decarboxylase (TIGR01140; EC 4.1.1.81; HMM-score: 95.1) ...
The role of polyamines in macromolecular synthesis has been studied using the synthesis of Semliki-Forest virus (SF virus) in normal and alpha-difluoromethylornithine-treated baby-hamster kidney (BHK21) cells as a model system. The activities of ornithine decarboxylase and S-adenosylmethionine decarboxylase, the rate-limiting enzymes in polyamine biosynthesis, decreased rapidly in mock- and SF-virus-infected cells, indicating that virus production in BHK21 cells was not dependent on polyamines formed after infection. A prolonged treatment of BHK21 cells with alpha-difluoro-methylornithine, a specific inhibitor of polyamine synthesis, resulted in a marked inhibition of the initial rate of virus production, which appeared 72 h after the beginning of the treatment. This inhibition was reversed by putrescine, spermidine and spermine, and at last partially by several other diamines and polyamine homologues. Polyamine-depletion also markedly reduced viral RNA polymerase activity in SF-virus infected ...
Ornithine decarboxylase (ODC), the rate-limiting enzyme of the polyamine biosynthetic pathway, plays an important role in cell cycle, tumor promotion and anti-apoptosis. In our previous studies, overexpression of ODC prevented apoptosis induced by tumor necrosis factor-alpha and methotrexate. We further investigated the apoptotic mechanisms of the cancer chemotherapeutic drugs, including etoposide (VP-16), paclitaxel (TAX) and cisplatin (CDDP), and the influences of ODC on apoptosis and cell cycle. Our results showed that the investigated drugs induced caspase-dependent apoptosis, the generation of reactive oxygen species (ROS) and the disruption of mitochondrial membrane potential (Delta psi(m)) in HL-60 cells, all of which were reversed by putrescine, glutathione or N-acetyl-L-Cysteine. Overexpression of ODC prevented the cancer chemotherapeutic drugs-induced apoptosis, ROS generation and the disruption of Delta psi(m). After drug administrations, the decline of Bcl-2, cytochrome c release and ...
When the South African Medical and Dental Council (SAMDC) along with the support of the Medical Association of South Africa (MASA), declined to discipline the district surgeons in Bikos death, two groups of physicians filed separate formal complaints with the SAMDC regarding the lack of professionalism shown by Bikos doctors. Both cases made their way to the South African Supreme Court in an attempt to force the SAMDC to conduct a formal inquiry into the medical ethics of Lang and Tucker. One case was filed by Ames, along with Trefor Jenkins and Phillip Tobias of the University of the Witwatersrand; a second case was filed by Dumisani Mzana, Yosuf Veriava of Coronationville Hospital, and Tim Wilson of Alexandra Health Centre.[14][15] As Ames and the small group of physicians pursued an inquiry into members of their own profession, Ames was called a whistleblower.[14] Her position at the university was threatened by her superiors and her colleagues asked her to drop the case.[16] By pursuing ...
You are viewing an interactive 3D depiction of the molecule 4-[[(2R,3S,4R,5R)-5-[6-amino-8-[(3,4-dichlorophenyl)methylamino]purine-1,3,7-triium-9-yl]-3,4-dihydroxy-tetrahydrofuran-2-yl]methoxymethyl]benzonitrile (C25H23Cl2N7O4) from the PQR.
You are viewing an interactive 3D depiction of the molecule 1-((2-(6,11-dihydrodibenz[b,e]oxepin-11-yl)ethyl)methylamino)-3-phenoxy-2-propanol (C26H29NO3) from the PQR.
Inhibition of polyamine biosynthesis and/or the perturbation of polyamine functionality have been exploited with success against parasitic diseases such as Trypanosoma infections. However, when the classical polyamine biosynthesis inhibitor, α-difluoromethylornithine, is used against the human malaria parasite, Plasmodium falciparum, it results in only a cytostatic growth arrest. Polyamine metabolism in this parasite has unique properties not shared by any other organism. These include the bifunctional arrangement of the catalytic decarboxylases and an apparent absence of the typical polyamine interconversion pathways implying different mechanisms for the regulation of polyamine homeostasis that includes the uptake of exogenous polyamines at least in vitro. These properties make polyamine metabolism an enticing drug target in P. falciparum provided that the physiological and functional consequences of polyamine metabolism perturbation are understood. This review highlights our current ...
TY - CHAP. T1 - Investigating ornithine decarboxylase posttranscriptional regulation via a pulldown assay using biotinylated transcripts. AU - Mai, Anh. AU - Nowotarski, Shannon L.. PY - 2018/1/1. Y1 - 2018/1/1. N2 - Ornithine decarboxylase (ODC) is the first rate-limiting enzyme in the polyamine biosynthetic pathway. It has been well documented that ODC is tightly regulated at the levels of transcription, posttranscriptional changes in RNA, and protein degradation during normal conditions and that these processes are dysregulated during tumorigenesis. Moreover, it has been recently shown that ODC is posttranscriptionally regulated by RNA binding proteins (RBPs) which can bind to the ODC mRNA transcript and alter its stability and translation. Using a mouse skin cancer model, we show that the RBP human antigen R (HuR) is able to bind to synthetic mRNA transcripts through a pulldown assay which utilizes a biotin-labeled ODC 30-untranslated region (UTR). The details of this method are described ...
Plant aminopropyltransferases consist of a group of enzymes that transfer aminopropyl groups derived from decarboxylated S-adenosyl-methionine (dcAdoMet or dcSAM) to propylamine acceptors to produce polyamines, ubiquitous metabolites with positive charge at physiological pH. Spermidine synthase (SPDS) uses putrescine as amino acceptor to form spermidine, whereas spermine synthase (SPMS) and thermospermine synthase (TSPMS) use spermidine as acceptor to synthesize the isomers spermine and thermospermine respectively. In previous work it was shown that both SPDS1 and SPDS2 can physically interact with SPMS although no data concerning the subcellular localization was reported. Here we study the subcellular localization of these enzymes and their protein dimer complexes with gateway-based Bimolecular Fluorescence Complementation (BiFC) binary vectors. In addition, we have characterized the molecular weight of the enzyme complexes by gel filtration chromatography with in vitro assembled recombinant ...
Spermine synthase Proteins available through Novus Biologicals. Browse our Spermine synthase Protein catalog backed by our Guarantee+.
Shop Arginine decarboxylase ELISA Kit, Recombinant Protein and Arginine decarboxylase Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
ODC1 [ENSP00000234111]. Ornithine decarboxylase 1; Catalyzes the first and rate-limiting step of polyamine biosynthesis that converts ornithine into putrescine, which is the precursor for the polyamines, spermidine and spermine. Polyamines are essential for cell proliferation and are implicated in cellular processes, ranging from DNA replication to apoptosis; Belongs to the Orn/Lys/Arg decarboxylase class-II family.. Synonyms: ODC1, ODC1p, hODC1, C9JG30, P11926 .... Linkouts: STRING Pharos UniProt OMIM ...
Aminoethylcysteine ketimine decarboxylated dimer is a natural sulfur-containing compound detected in human plasma and urine, in mammalian brain and in many common edible vegetables. Over the past decade many studies have been undertaken to identify its metabolic role. Attention has been focused on its antioxidant properties and on its reactivity against oxygen and nitrogen reactive species. These properties have been studied in different model systems starting from plasma lipoproteins to specific cellular lines. All these studies report that aminoethylcysteine ketimine decarboxylated dimer is able to interact both with reactive oxygen and nitrogen species (hydrogen peroxide, superoxide anion, hydroxyl radical, peroxynitrite and its derivatives). Its antioxidant activity is similar to that of Vitamin E while higher than other hydrophilic antioxidants, such as trolox and N-acetylcysteine.
ID PFLA_STAAB Reviewed; 251 AA. AC Q2YV52; DT 09-JAN-2007, integrated into UniProtKB/Swiss-Prot. DT 20-DEC-2005, sequence version 1. DT 22-NOV-2017, entry version 83. DE RecName: Full=Pyruvate formate-lyase-activating enzyme; DE Short=PFL-activating enzyme; DE EC=1.97.1.4; GN Name=pflA; OrderedLocusNames=SAB0165; OS Staphylococcus aureus (strain bovine RF122 / ET3-1). OC Bacteria; Firmicutes; Bacilli; Bacillales; Staphylococcaceae; OC Staphylococcus. OX NCBI_TaxID=273036; RN [1] RP NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. RC STRAIN=bovine RF122 / ET3-1; RX PubMed=17971880; DOI=10.1371/journal.pone.0001120; RA Herron-Olson L., Fitzgerald J.R., Musser J.M., Kapur V.; RT "Molecular correlates of host specialization in Staphylococcus RT aureus."; RL PLoS ONE 2:E1120-E1120(2007). CC -!- FUNCTION: Activation of pyruvate formate-lyase under anaerobic CC conditions by generation of an organic free radical, using S- CC adenosylmethionine and reduced flavodoxin as cosubstrates to CC produce ...
Thank you for your interest in spreading the word about Biochemical Society Transactions.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
ethyl 2-(methylamino)acetate | C5H11NO2 | CID 95849 - structure, chemical names, physical and chemical properties, classification, patents, literature, biological activities, safety/hazards/toxicity information, supplier lists, and more.
The objective of this project was to synthesize a protected spermidine derivative, which is a polyamine derivative. The spermidine that was to be synthesised is a N8 protected spermidine derivative.
Ebeid, 360в365. Quan d co-substrate S-Adenosylmethionine Any consideration of methyltransferases must begin with an understanding of the nature of the co-substrate AdoMet. Castrini G, Pappalardo G Our experience in the surgical treatment of achalasia.
TY - JOUR. T1 - Inhibition of osteoblastic cell proliferation and ornithine decarboxylase activity by ethanol. AU - Klein, Robert F.. AU - Carlos, Amy S.. PY - 1995/8. Y1 - 1995/8. N2 - Low bone mass and an increased prevalence of skeletal fractures are evident in the alcoholic population. Histomorphometric analysis of skeletal tissue from alcoholic patients reveals reduced osteoblast number and suppressed bone formation activity, with relative sparing of resorptive indexes. The decreased number of osteoblasts observed in alcoholic subjects results from either impaired proliferation or accelerated senescence. Polyamines and ornithine decarboxylase (ODC), the rate-limiting enzyme for polyamine synthesis, are essential for cell proliferation in a variety of cell types. To determine whether the consequences of ethanol on osteoblast number involve the modulation of polyamine biosynthesis, we examined the effect of ethanol on parameters of cell growth and ODC activity in a rat osteoblast-like ...
TY - JOUR. T1 - Growth arrest- and polyamine-dependent expression of spermidine/spermine N1-acetyltransferase in human tumor cells. AU - Ignatenko, Natalia. AU - Gerner, Eugene W.. PY - 1996/4. Y1 - 1996/4. N2 - Polyamines are essential for optimal cell growth. The regulation of polyamine biosynthetic, but not catabolic, enzymes has been studied in detail. Because intracellular polyamine contents depend on both synthesis and catabolism, we studied the regulation of spermidine/spermine N1- acetyltransferase (N1SSAT), the first enzyme in polyamine catabolism. Steady-state RNA levels of N1SSAT increased 3-5 fold as human colon tumor- derived HCT116 cells traversed the log phase and entered the plateau phase. Depletion of cellular polyamines, using α-difluoromethylornithine, caused a decrease in the steady-state levels of both the 1.3-kb N1SSAT transcript and its 3.5-kb precursor, without affecting the stability of either RNA. N1SSAT enzyme activity was low in cells with normal polyamine contents ...
In the present communication, an experimental approach is utilized that facilitates the study of biochemical processes induced in B cells after their interaction with Th cells. In this approach, Th cell clones are stimulated for 18 h upon anti-CD3-coated plates, fixed with paraformaldehyde, and added at a 2 to 3:1 ratio to small, resting B cells (isolated from Percoll gradients). Th cells not stimulated on anti-CD3-coated plates, but fixed with paraformaldehyde, serve as controls for these experiments. The activated, fixed Th cells induce a transient, sixfold increase in B cell levels of cAMP, as well as an increase in B cell expression of ornithine decarboxylase (ODC) activity. This enzyme initiates the synthesis of polyamines and has been shown to be increased as cells enter the growth phase. In addition, previous studies have shown that the cellular levels of ODC activity are controlled by a multi-tiered regulatory cascade. To examine this aspect, polyclonally stimulated B cells were studied. ...
Alpert J E, Papakostas G, Mischoulon D, Worthington J J, Petersen T, Mahal Y, et al. S-adenosyl-L-methionine (SAMe) as an adjunct for resistant major depressive disorder: an open trial following partial or nonresponse to selective serotonin reuptake inhibitors or venlafaxine. J Clin Psychopharmacol. 2004;24(6):661-4.. Bottiglieri T. Folate, Vitamin B12, and S-Adenosylmethionine. Psychiatric Clinics of North America. W.B. Saunders Company. 2013:36(1).. Chavez M. SAMe: S-Adenosylmethionine. Am J Health Syst Pharm. 2000;57(2):119-23.. Delle Chiaie R, Pancheri P, Scapicchio P. Efficacy and tolerability of oral and intramuscular S-adenosyl-L- methionine 1,4-butanedisulfonate (SAMe) in the treatment of major depression: comparison with imipramine in 2 multicenter studies. Am J Clin Nutr. 2002;76(5):1172S-6S.. Dey A, Caro AA, Cederbaum AL. S-adenosyl methionine protects ob/ob mice from CYP2E1-mediated liver injury. Am J Physiol Gastrointest Liver Physiol. 2007;293(1):G91-103.. Fetrow CW, Avila JR. ...
Alpert J E, Papakostas G, Mischoulon D, Worthington J J, Petersen T, Mahal Y, et al. S-adenosyl-L-methionine (SAMe) as an adjunct for resistant major depressive disorder: an open trial following partial or nonresponse to selective serotonin reuptake inhibitors or venlafaxine. J Clin Psychopharmacol. 2004;24(6):661-4.. Bottiglieri T. Folate, Vitamin B12, and S-Adenosylmethionine. Psychiatric Clinics of North America. W.B. Saunders Company. 2013:36(1).. Chavez M. SAMe: S-Adenosylmethionine. Am J Health Syst Pharm. 2000;57(2):119-23.. Delle Chiaie R, Pancheri P, Scapicchio P. Efficacy and tolerability of oral and intramuscular S-adenosyl-L- methionine 1,4-butanedisulfonate (SAMe) in the treatment of major depression: comparison with imipramine in 2 multicenter studies. Am J Clin Nutr. 2002;76(5):1172S-6S.. Dey A, Caro AA, Cederbaum AL. S-adenosyl methionine protects ob/ob mice from CYP2E1-mediated liver injury. Am J Physiol Gastrointest Liver Physiol. 2007;293(1):G91-103.. Fetrow CW, Avila JR. ...
Epidemiological studies suggest that increased risk of breast cancer is associated with exposures to electromagnetic fields (EMFs). EMFs have been demonstrated to increase Ornithine decarboxylase (ODC) activity in a variety of experimental systems. ODC, the rate limiting enzyme in polyamine synthesis, has been associated with chemical carcinogenesis. Very few if any studies have examined the effec
BACKGROUND S-Adenosylmethionine (AdoMet) is a major methyl donor for transmethylation reactions and propylamine donor for the biosynthesis of polyamines in biological systems, and therefore may play a role in lung cancer development. We hypothesized that AdoMet levels were elevated in patients with lung cancer and may prove useful as a biomarker for early lung cancer. METHODS High-performance liquid chromatography was used to analyze plasma AdoMet levels in triplicate samples from 68 patients. This included 13 patients with lung cancer, 33 smokers with benign lung disease, and 22 healthy nonsmokers. The three groups of subjects were compared with respect to the distribution of demographic and disease characteristics and AdoMet levels. Distributions were examined using summary statistics and box plots, and nonparametric analysis of variance procedures. RESULTS Serum AdoMet levels were elevated in patients with lung cancer as compared to smokers with benign lung disorders and healthy nonsmokers. There
Findings from human patients, yeast and a mouse model imply that defects in polyamine pathway play a role in Parkinsons disease pathogenesis, suggesting that existing drugs may be able to slow progression of the disease, according to a study published Sept. 13 in an early online edition of Proceedings of the National Academy of Sciences.
Sulphur (S) is an essential element for all living organisms. The uptake, assimilation and metabolism of S in plants are well studied. However, the regulation of S homeostasis remains largely unknown. Here, we report on the identification and characterisation of the more sulphur accumulation1 (msa1-1) mutant. The MSA1 protein is localized to the nucleus and is required for both S adenosylmethionine (SAM) production and DNA methylation. Loss of function of the nuclear localised MSA1 leads to a reduction in SAM in roots and a strong S-deficiency response even at ample S supply, causing an over- accumulation of sulphate, sulphite, cysteine and glutathione. Supplementation with SAM suppresses this high S phenotype. Furthermore, mutation of MSA1 affects genome-wide DNA methylation, including the methylation of S-deficiency responsive genes. Elevated S accumulation in msa1-1 requires the increased expression of the sulphate transporter genes SULTR1;1 and SULTR1;2 which are also differentially ...
Biodistribution and metabolism of oligonucleotides were determined using a 3H-labeled 20-nucleotide phosphodiester and its phosphorothioate analog. The oligonucleotides were radiolabeled by 3H-methylation of an internal deoxyctidine with HhaI methylase and S- [3H]adenosylmethionine. Biodistribution studies were conducted after intravenous injection of 6 mg/kg (5 muCi) oligonucleotide. Metabolism of the oligonucleotides was determined by paired-ion high performance liquid chromatography. After phosphodiester injections, radiolabel rapidly cleared the blood. Relative initial concentrations were as follows: kidney , blood , heart , liver , lung , spleen. Radiolabel in spleen peaked at 1 hr and remained elevated for 24 hr. At 2 hr the concentration in all organs, except spleen, was equal to that in blood. High performance liquid chromatographic analysis of the kidney, liver, and spleen extracts and urine indicated extremely rapid metabolism to monomer. Results of studies after the injection of ...
Ability of the Ca2+ ionophores A23187 and ionomycin to mimic some of the effects of the tumor promoter 12-O-tetradecanoylphorbol-13-acetate on hydroperoxide production, ornithine decarboxylase activity, and DNA synthesis in mouse epidermis in vivo. Cancer Res. 1990 Sep 15;50(18):5806-12. To Reference ...
1,3-Diphenyl-2-(methylamino)propanol | C16H19NO | CID 584311 - structure, chemical names, physical and chemical properties, classification, patents, literature, biological activities, safety/hazards/toxicity information, supplier lists, and more.
The enzyme is most active with L-methionine. It participates in the L-methionine salvage pathway from S-methyl-5-thioadenosine, a by-product of polyamine biosynthesis. T
Formula: C14H24N2O7MW: 332. 35Salt: 2HClCAS: 22189-32-8TNP NUMBER: TNP00199MDL NUMBER: MFCD00058104IUPAC: (8S,11S,13S,14S,3R,6R,10R,12R)-12,14-bis(methylamino)-3,11,13-trihydroxy-6-met hyl-2,7,9-trioxatricyclo[8....
Semiotica fines anthropologicos magni momenti habere saepe videtur; exempli gratia, Humbertus Eco proponit omne culturae phaenomenon ut communicatio investigari posse.[5] Nonnulli autem semiotici logicales scientiae dimensiones attendunt, regiones investigantes quae ad scientiam vitae pertinent-sicut quomodo organismi res praedicunt et sese ad eorum locum proprium in mundo accommodant (vide semiosis). Rationes semioticae generatim signa vel rationes signorum pro re studii accipiunt: communicatio rerum ab organismis vivis in biosemiotica tractatur, zoosemiotica non exclusa. Syntactica est pars semioticae quae formales signorum et symbolorum proprietates tractat.[6] Syntactica accuratius "regulas" tractat "quae moderantur quomodo verba ad phrases et sententias formandas temperentur."[7][8] Carolus W. Morris ait semanticam tractare coniunctionem signorum cum eorum designatis, et res quae ea denotent vel denotare possint; ac pragmaticam semiosis aspectus bioticos tractat; hoc est, cum omnibus ...
Adenosylmethionine decarboxylase Spermidine synthase Spermine synthase Thermospermine synthase (ACAULIS5) Takahashi, Taku; ... S-Adenosylmethioninamine (decarboxylated S-adenosyl methionine) is a substrate that is involved in the biosynthesis of ...
"Adenovirus-mediated expression of both antisense ornithine decarboxylase and S-adenosylmethionine decarboxylase inhibits lung ... Antizyme inhibitor 2 (AzI2) also known as arginine decarboxylase (ADC) is an enzyme that in humans is encoded by the AZIN2 gene ... "Entrez Gene: ADC arginine decarboxylase". Human AZI2 genome location and AZI2 gene details page in the UCSC Genome Browser. ... Zhu MY, Iyo A, Piletz JE, Regunathan S (2004). "Expression of human arginine decarboxylase, the biosynthetic enzyme for ...
... especially decarboxylases such as S-adenosylmethionine decarboxylase (SAMDC) that exploit the electron-withdrawing power of the ...
... adenosylmethionine decarboxylase MeSH D08.811.520.224.125.100 --- aromatic-L-amino-acid decarboxylase MeSH D08.811.520.224. ... 125.100.500 --- dopa decarboxylase MeSH D08.811.520.224.125.250 --- glutamate decarboxylase MeSH D08.811.520.224.125.300 --- ... ornithine decarboxylase MeSH D08.811.520.224.125.450 --- orotidine-5'-phosphate decarboxylase MeSH D08.811.520.224.125.500 --- ... tyrosine decarboxylase MeSH D08.811.520.224.125.900 --- uroporphyrinogen decarboxylase MeSH D08.811.520.224.187 --- ...
Spermine synthase Adenosylmethionine decarboxylase Ikeguchi Y, Bewley MC, Pegg AE (January 2006). "Aminopropyltransferases: ... No known spermidine synthase can use S-adenosyl methionine. This is prevented by a conserved aspartatyl residue in the active ... The putrescine-N-methyl transferase whose substrates are putrescine and S-adenosyl methionine and which is evolutionary related ... site, which is thought to repel the carboxyl moiety of S-adenosyl methionine. ...
... is an enzyme that catalyzes the conversion of S-adenosyl methionine to S- ... S-adenosylmethionine decarboxylase (AdoMetDC) plays an essential regulatory role in the polyamine biosynthetic pathway by ... Pegg AE, Xiong H, Feith DJ, Shantz LM (November 1998). "S-adenosylmethionine decarboxylase: structure, function and regulation ... Unlike many amino acid decarboxylases AdoMetDC uses a covalently bound pyruvate residue as a cofactor rather than the more ...
"Comparison of androgen regulation of ornithine decarboxylase and S-adenosylmethionine decarboxylase gene expression in rodent ... Ornithine decarboxylase at herkules.oulu.fi Ornithine decarboxylase at the US National Library of Medicine Medical Subject ... The enzyme ornithine decarboxylase (ODC) catalyzes the decarboxylation of ornithine (a product of the urea cycle) to form ... Therefore, ornithine decarboxylase is an essential enzyme for cell growth, producing the polyamines necessary to stabilize ...
Here, SAM-e is decarboxylated by adenosylmethionine decarboxylase (EC 4.1.1.50) to form S-adenosylmethioninamine. This compound ... S-Adenosyl methionine is a common cosubstrate involved in methyl group transfers, transsulfuration, and aminopropylation. ... Chiang P, Gordon R, Tal J, Zeng G, Doctor B, Pardhasaradhi K, McCann P (1996). "S-Adenosylmethionine and methylation". FASEB J ... Najm WI, Reinsch S, Hoehler F, Tobis JS, Harvey PW (February 2004). "S-Adenosyl methionine (SAMe) versus celecoxib for the ...
Acetoacetate decarboxylase. *Adenosylmethionine decarboxylase. *Arginine decarboxylase. *Aromatic L-amino acid decarboxylase. * ...
Adenosylmethionine decarboxylase. *Adenylosuccinate synthase. *AdoMet MTase. *Adrenocorticotropic hormone. *AFTPH. *AGCS family ...
Acetoacetate decarboxylase. *Adenosylmethionine decarboxylase. *Arginine decarboxylase. *Aromatic L-amino acid decarboxylase. * ... Glutamate decarboxylase or glutamic acid decarboxylase (GAD) is an enzyme that catalyzes the decarboxylation of glutamate to ... Role of glutamate decarboxylase in Citrus[edit]. It is also believed that the control of glutamate decarboxylase has the ... Ueno H (October 2000). "Enzymatic and structural aspects on glutamate decarboxylase". Journal of Molecular Catalysis B: ...
In one pathway, arginine is converted into agmatine, with a reaction catalyzed by the enzyme arginine decarboxylase (ADC); then ... Spermidine synthase uses putrescine and S-adenosylmethioninamine (decarboxylated S-adenosyl methionine) to produce spermidine. ... Putrescine is synthesized in small quantities by healthy living cells by the action of ornithine decarboxylase. Putrescine is ... arginine is converted into ornithine and then ornithine is converted into putrescine by ornithine decarboxylase (ODC). The ...
A decarboxylase with cofactor pyridoxal phosphate (PLP) removes CO2 from 5-hydroxy-L-tryptophan to produce 5-hydroxytryptamine ... N-acetylserotonin is methylated at the hydroxyl position by S-adenosyl methionine (SAM) to produce S-adenosyl homocysteine (SAH ... Hydroxyindole O-methyltransferase and S-adenosyl methionine convert N-acetylserotonin into melatonin through methylation of the ... This intermediate (5-HTP) is decarboxylated by pyridoxal phosphate and 5-hydroxytryptophan decarboxylase to produce serotonin. ...
... adenosylmethionine decarboxylase EC 4.1.1.51: 3-hydroxy-2-methylpyridine-4,5-dicarboxylate 4-decarboxylase EC 4.1.1.52: 6- ... EC 4.1.1.1: pyruvate decarboxylase EC 4.1.1.2: oxalate decarboxylase EC 4.1.1.3: oxaloacetate decarboxylase EC 4.1.1.4: ... aspartate 1-decarboxylase EC 4.1.1.12: aspartate 4-decarboxylase EC 4.1.1.13: deleted EC 4.1.1.14: valine decarboxylase EC 4.1. ... aconitate decarboxylase EC 4.1.1.7: benzoylformate decarboxylase EC 4.1.1.8: oxalyl-CoA decarboxylase EC 4.1.1.9: malonyl-CoA ...
When given with an inhibitor of dopa decarboxylase (carbidopa or benserazide), levodopa is optimally saved. This "triple ... which is donated by S-adenosyl methionine (SAM). Any compound having a catechol structure, like catecholestrogens and catechol- ...
"Lack of enhancement of dimethyltryptamine formation in rat brain and rabbit lung in vivo by methionine or S-adenosylmethionine ... the biosynthesis begins with its decarboxylation by an aromatic amino acid decarboxylase (AADC) enzyme (step 1). The resulting ... catalyzes the transfer of a methyl group from cofactor S-adenosyl-methionine (SAM), via nucleophilic attack, to tryptamine. ...
Guidotti A, Ruzicka W, Grayson DR, Veldic M, Pinna G, Davis JM, Costa E (Jan 2007). "S-adenosyl methionine and DNA ... "GABAergic dysfunction in schizophrenia and mood disorders as reflected by decreased levels of glutamic acid decarboxylase 65 ... As one study shows, S-adenosyl methionine (SAM) concentration in patients' prefrontal cortex is twice as high as in the ... "Histone hyperacetylation induces demethylation of reelin and 67-kDa glutamic acid decarboxylase promoters". Proceedings of the ...
2005). "Evidence for a second class of S-adenosylmethionine riboswitches and other regulatory RNA motifs in alpha- ... the majority of species analysed it is located in the leader of an operon containing the speF gene an ornithine decarboxylase ...
Finally, DAP decarboxylase LysA mediates the last step of the lysine synthesis and is common for all studied bacterial species ... On the other hand, PurR, a protein which plays a role in purine synthesis and S-adeno-sylmethionine are known to down regulate ... The major donor of activated methyl groups is S-adenosylmethionine, which is synthesized by the transfer of an adenosyl group ... The repressor protein MetJ, in cooperation with the corepressor protein S-adenosyl-methionine, mediates the repression of ...
Ornithine and S-adenosylmethionine are precursors of polyamines. Aspartate, glycine, and glutamine are precursors of ... and eflornithine drug that inhibits ornithine decarboxylase and used in the treatment of sleeping sickness. Since 2001, 40 non- ... is formed through the transsulfuration pathway or by the demethylation of methionine via the intermediate metabolite S-adenosyl methionine ...
Phosphatidylserine decarboxylase is the enzyme that is used to decarboxylate phosphatidylserine in the first pathway. The ... S-Adenosyl methionine can subsequently methylate the amine of phosphatidylethanolamines to yield phosphatidylcholines. It can ...
Aromatic-L-amino-acid decarboxylase (EC 4.1.1.28) RubisCO (EC 4.1.1.39) Category:EC 4.1.2 Fructose-bisphosphate aldolase (EC ... EC 3.3 Adenosylmethionine hydrolase S-adenosyl-L-homocysteine hydrolase Alkenylglycerophosphocholine hydrolase ... EC 4.1.1 Ornithine decarboxylase (EC 4.1.1.17) Uridine monophosphate synthetase (EC 4.1.1.23) ...
... but still use three Cys residues as ligands to a 4Fe4S cluster and produce a radical from S-adenosylmethionine. These include ... cytosylglucuronic acid decarboxylase - blasticidin S biosynthesis BtrN - butirosin biosynthesis pathway oxidoreductase ( ...
BCKA decarboxylase and relative activities of α-keto acid substrates The BCKA decarboxylase enzyme is composed of two subunits ... S-adenosyl-methionine donates a methyl group to the double bond of oleic acid. This methylation reaction forms the intermediate ... All of these factors may affect chain length, and HSFs have been demonstrated to alter the specificity of BCKA decarboxylase ... Decarboxylation of the primer precursors occurs through the branched-chain α-keto acid decarboxylase (BCKA) enzyme. Elongation ...
A methyl donor, adenosylmethionine, in depression. Folia Neuropsychiat. 16(4), 1973. *↑ Block W. Depression and arthritis. Life ... L-5-hydroxytryptophan alone and in combination with a peripheral decarboxylase inhibitor in the treatment of depression. ... S-adenosylmethionine (SAM-e) for the treatment of depression in people living with HIV/AIDS. BMC Psychiatry. 4:38, 2004. ... S-Adenosyl-Methionine improves depression in patients with Parkinson's disease in an open-label clinical trial. Mov Disord. 15( ...
A decarboxylase with cofactor pyridoxal phosphate (PLP) removes CO2 from 5-hydroxy-L-tryptophan to produce 5-hydroxytryptamine. ... Hydroxyindole O-methyltransferase and S-adenosyl methionine convert N-acetylserotonin into melatonin through methylation of the ... N-acetylserotonin is methylated at the hydroxyl position by S-adenosyl methionine (SAM) to produce S-adenosyl homocysteine (SAH ... This intermediate (5-HTP) is decarboxylated by pyridoxal phosphate and 5-hydroxytryptophan decarboxylase to produce serotonin. ...
Acetoacetate decarboxylase. *Adenosylmethionine decarboxylase. *Arginine decarboxylase. *Aromatic L-amino acid decarboxylase. * ... Aromatic L-amino acid decarboxylase (AADC or AAAD), also known as DOPA decarboxylase (DDC), tryptophan decarboxylase, and 5- ... Scherer LJ, McPherson JD, Wasmuth JJ, Marsh JL (Jun 1992). "Human dopa decarboxylase: localization to human chromosome 7p11 and ... Aromatic-L-Amino-Acid+Decarboxylases at the US National Library of Medicine Medical Subject Headings (MeSH) ...
Adenosylmethionine decarboxylase is an enzyme that catalyzes the conversion of S-adenosyl methionine to S- ... S-adenosylmethionine decarboxylase (AdoMetDC) plays an essential regulatory role in the polyamine biosynthetic pathway by ... Pegg AE, Xiong H, Feith DJ, Shantz LM (November 1998). "S-adenosylmethionine decarboxylase: structure, function and regulation ... Unlike many amino acid decarboxylases AdoMetDC uses a covalently bound pyruvate residue as a cofactor rather than the more ...
S-adenosylmethionine decarboxylase proenzyme (C4B63_18g214), S-adenosylmethionine decarboxylase proenzyme (TcCL_ESM01038), S- ... S-adenosylmethionine decarboxylase beta chainBy similarityAdd BLAST. 85. ChainiPRO_0000029986. 86 - 370. S-adenosylmethionine ... adenosylmethionine decarboxylase proenzyme (C3747_28g21), S-adenosylmethionine decarboxylase proenzyme. This subpathway is part ... S-adenosylmethionine decarboxylase proenzyme (EC:4.1.1.50*Search proteins in UniProtKB for this EC number. ...
Decarboxylase Proenzyme Processing as Revealed by the Structure of the S68A Mutant. ... S-adenosylmethionine decarboxylase S-adenosylmethionine decarboxylase S-adenosylmethionine decarboxylase S-adenosylmethionine ... S-adenosylmethionine decarboxylase S-adenosylmethionine decarboxylase S-adenosylmethionine decarboxylase S-adenosylmethionine ... S-adenosylmethionine decarboxylase S-adenosylmethionine decarboxylase B. 1msvB00. Alpha Beta 4-Layer Sandwich S- ...
Impact of S-Adenosylmethionine Decarboxylase 1 on Pulmonary Vascular RemodelingCLINICAL PERSPECTIVE. Friederike Christine ... Microarray analysis from these mice revealed s-adenosylmethionine decarboxylase 1 (AMD-1) as one of the most downregulated ... Impact of S-Adenosylmethionine Decarboxylase 1 on Pulmonary Vascular RemodelingCLINICAL PERSPECTIVE ... Impact of S-Adenosylmethionine Decarboxylase 1 on Pulmonary Vascular RemodelingCLINICAL PERSPECTIVE ...
Four mutants were isolated from Saccharomyces cerevisiae that are deficient in S-adenosylmethionine decarboxylase (spe2). All ... Isolation and characterization of Saccharomyces cerevisiae mutants deficient in S-adenosylmethionine decarboxylase, spermidine ... Isolation and characterization of Saccharomyces cerevisiae mutants deficient in S-adenosylmethionine decarboxylase, spermidine ... Isolation and characterization of Saccharomyces cerevisiae mutants deficient in S-adenosylmethionine decarboxylase, spermidine ...
In vitro and in vivo anti-tumor action of the S-adenosylmethionine decarboxylase (SAMDC) inhibitor SAM486A in human breast ... In vitro and in vivo anti-tumor action of the S-adenosylmethionine decarboxylase (SAMDC) inhibitor SAM486A in human breast ... In vitro and in vivo anti-tumor action of the S-adenosylmethionine decarboxylase (SAMDC) inhibitor SAM486A in human breast ... In vitro and in vivo anti-tumor action of the S-adenosylmethionine decarboxylase (SAMDC) inhibitor SAM486A in human breast ...
Selective regulation of S-adenosylmethionine decarboxylase activity by the spermine analogue 6-spermyne. C W Porter, J McManis ... Selective regulation of S-adenosylmethionine decarboxylase activity by the spermine analogue 6-spermyne ... Selective regulation of S-adenosylmethionine decarboxylase activity by the spermine analogue 6-spermyne ... Selective regulation of S-adenosylmethionine decarboxylase activity by the spermine analogue 6-spermyne ...
4-Hydroxyphenylacetate decarboxylase activating enzyme catalyses a classical S-adenosylmethionine reductive cleavage reaction. ... 4-Hydroxyphenylacetate decarboxylase activating enzyme catalyses a classical S-adenosylmethionine reductive cleavage reaction ...
Solanumlycopersicum Male sterility Polyamines S-Adenosylmethionine decarboxylase RNAi Pollen development Electronic ... Song J, Nada K, Tachibana S (2001) The early increase of S-adenosylmethionine decarboxylase activity is essential for the ... RNAi silencing of three homologues of S-adenosylmethionine decarboxylase gene in tapetal tissue of tomato results in male ... In the present study, S-adenosylmethionine decarboxylase (SAMDC), a key gene involved in polyamine biosynthesis, has been ...
... is linked to the ornithine decarboxylase gene (Odc) on Chromosome 12 and is present in distantly related species of the genus ... "The functional intronless S-adenosylmethionine decarboxylase gene of the mouse (Amd-2) ... The functional intronless S-adenosylmethionine decarboxylase gene of the mouse (Amd-2) is linked to the ornithine decarboxylase ... The functional intronless S-adenosylmethionine decarboxylase gene of the mouse (Amd-2) is linked to the ornithine decarboxylase ...
Delineation of functional roles of parasite-specific inserts in the malarial S-adenosylmethionine decarboxylase / ornithine ... Delineation of functional roles of parasite-specific inserts in the malarial S-adenosylmethionine decarboxylase / ornithine ... Ornithine decarboxylase (ODC) and Sadenosylmethionine decarboxylase (AdoMetDC) are the rate-limiting enzymes in polyamine ... activity analysis thereof showed that these inserts are essential for the catalytic activities of both the decarboxylase ...
... namely ornithine decarboxylase (ODC) and S-adenosylmethionine decarboxylase (AdoMetDC). The AdoMetDC/ODC domains are assembled ... A phage display study of interacting peptide binding partners of malarial S-Adenosylmethionine decarboxylase/Ornithine ... A phage display study of interacting peptide binding partners of malarial S-Adenosylmethionine decarboxylase/Ornithine ... Inhibition of both decarboxylase activities is curative of murine malaria and indicates the viability of such strategies in ...
Analogues of S-adenosylmethionine that were designed as inhibitors of S-adenosylmethionine decarboxylase were tested for their ... N2 - Analogues of S-adenosylmethionine that were designed as inhibitors of S-adenosylmethionine decarboxylase were tested for ... AB - Analogues of S-adenosylmethionine that were designed as inhibitors of S-adenosylmethionine decarboxylase were tested for ... abstract = "Analogues of S-adenosylmethionine that were designed as inhibitors of S-adenosylmethionine decarboxylase were ...
S-Adenosylmethionine decarboxylase (SAMDC; EC 4.1.1.50) is a key rate-limiting enzyme located in the polyamine biosynthesis ... Hu, W.-W., Gong, H., Eng, C.P. (2005). The pivotal roles of the plant S-adenosylmethionine decarboxylase 5′ untranslated leader ... The pivotal roles of the plant S-adenosylmethionine decarboxylase 5′ untranslated leader sequence in regulation of gene ...
adenosylmethionine decarboxylase 1, pseudogene 1 LOC103691677 S-adenosylmethionine decarboxylase proenzyme pseudogene Data ... adenosylmethionine decarboxylase 1, pseudogene 1 AMDP1 S-adenosylmethionine decarboxylase (AMDP1) pseudogene Nomenclature ... AMDP1; LOC103691677; S-adenosylmethionine decarboxylase (AMDP1) pseudogene; S-adenosylmethionine decarboxylase proenzyme ... S-adenosylmethionine decarboxylase proenzyme pseudogene Symbol and Name status set to provisional. 70820. PROVISIONAL. ...
Wi, S. J., Kim, W. T., & Park, K. Y. (2006). Overexpression of carnation S-adenosylmethionine decarboxylase gene generates a ... Wi, SJ, Kim, WT & Park, KY 2006, Overexpression of carnation S-adenosylmethionine decarboxylase gene generates a broad- ... Sense construct of full-length cDNA for S-adenosylmethionine decarboxylase (SAMDC), a key enzyme in PA biosynthesis, from ... Sense construct of full-length cDNA for S-adenosylmethionine decarboxylase (SAMDC), a key enzyme in PA biosynthesis, from ...
Structural Basis for Putrescine Activation of Human S-Adenosylmethionine Decarboxylase. Journal Article Bale, Shridhar ; Lopez ... activates the autoprocessing and decarboxylation reactions of human S-adenosylmethionine decarboxylase (AdoMetDC), a critical ... 4-Hydroxyphenylacetate Decarboxylases: Properties of a Novel Subclass of Glycyl Radical Enzyme Systems † journal, August 2006 * ... p -Hydroxyphenylacetate decarboxylase from Clostridium difficile : A novel glycyl radical enzyme catalysing the formation of ...
Regulation of S-Adenosylmethionine Decarboxylase Colin Hanfrey. Pages 449-464 * Genetic Engineering of Polyamine Catabolism in ...
S-adenosylmethionine decarboxylase (IPR001985) Pfam signature: PF01536 Herpesvirus glycoprotein D/GG/GX domain (IPR002896) Pfam ... Orn/DAP/Arg decarboxylase 2, C-terminal (IPR022643) Pfam signature: PF00278 Proteinase inhibitor I13, potato inhibitor I ( ... S-adenosylmethionine synthetase, N-terminal (IPR022628) Pfam signature: PF00438 Bromodomain (IPR001487) Pfam signature: PF00439 ... Orotidine 5-phosphate decarboxylase domain (IPR001754) Pfam signature: PF00215 Histone-like DNA-binding protein (IPR000119) ...
Human S-adenosylmethionine decarboxylase (AdoMetDC) was expressed in high yield in Escherichia coli using the pIN-III(lppp-5) ... Purification of Human S-Adenosylmethionine Decarboxylase Expressed in Escherichia coli and Use of This Protein To Investigate ...
... dcSAM is synthesized by action of S-adenosylmethionine decarboxylase (AdoMetDC; EC 4.1.4.50) on S-adenosyl-methionine which in ... S-adenosylmethionine decarboxylase (EC 4.1.4.50); AIH: agmatine iminohydrolase (EC 3.5.3.12); CPA: N-carbamoylputrescine ... Figure 1: Polyamine biosynthetic pathway with special reference to plants. ADC: arginine decarboxylase (EC 4.1.1.9); AdoMetDC: ... I. Hummel, G. Gouesbet, A. El Amrani, A. Aïnouche, and I. Couée, "Characterization of the two arginine decarboxylase (polyamine ...
... into polyamine biosynthesis but not ethylene in tomato fruit engineered with yeast S-adenosylmethionine decarboxylase gene. S- ... Fruit metabolism, In vivo flux of metabolism, Plant growth regulators, SAM decarboxylase, Tomato, Transgenics ... adenosylmethionine (SAM), a major substrate in 1-C metabolism is a common precursor in the biosynthetic pathways of polyamines ...
... ornithine decarboxylase; PAO, polyamine oxidase; SAMDC, S-adenosylmethionine decarboxylase; SSAT, spermidine/spermine N1 ... Manni A., Wechter R., Gilmour S., Verderame M. F., Mauger D., Demers L. M. Ornithine decarboxylase over-expression stimulates ...
S adenosylmethionine decarboxylase 1 antibody. *S adenosylmethionine decarboxylase proenzyme antibody. *S-adenosylmethionine ...
  • We report X-ray structures of Trypanosoma brucei S -adenosylmethionine decarboxylase alone and in functional complex with its catalytically dead paralogous partner, prozyme. (elifesciences.org)
  • Inhibition of both decarboxylase activities is curative of murine malaria and indicates the viability of such strategies in malaria control. (up.ac.za)
  • These results are consistent with their bringing about an inhibition of S-adenosylmethionine decarboxylase activity in the cell which leads to a reduction in the synthesis of spermidine and spermine. (elsevier.com)
  • Inhibition by the drug depends, among other things, on the nature of the aliphatic amines that can serve as stimulators of rat prostate S -adenosylmethionine decarboxylase. (portlandpress.com)
  • Scalabrino G, Ferioli ME, Modena D, Puerari M, Luccarelli G: Degrees of malignancy in human primary CNS tumors: ODC levels as better indicators than adenosyl-methionine decarboxylase levels. (springer.com)
  • The severe reduction in levels of this essential biochemical substrate would be expected to compromise seriously metabolism and brain function in patients with Alzheimer's disease and may provide the basis for the observations of improved cognition in some Alzheimer's patients following S-adenosylmethionine therapy. (lifeextension.com)
  • Isolation and characterization of Saccharomyces cerevisiae mutants deficient in S-adenosylmethionine decarboxylase, spermidine, and spermine. (asm.org)
  • The independent removal of all three the PfAdoMetDC domain parasite-specific inserts and subsequent activity analysis thereof showed that these inserts are essential for the catalytic activities of both the decarboxylase domains. (up.ac.za)
  • The decarboxylated S-adenosylmethionine content rose substantially because the activity of S-adenosylmethionine decarboxylase was increased in response to the decline in spermidine. (nih.gov)