An enzyme which catalyzes the catabolism of S-ADENOSYLHOMOCYSTEINE to ADENOSINE and HOMOCYSTEINE. It may play a role in regulating the concentration of intracellular adenosylhomocysteine.
The systematic identification and quantitation of all the metabolic products of a cell, tissue, organ, or organism under varying conditions. The METABOLOME of a cell or organism is a dynamic collection of metabolites which represent its net response to current conditions.
The largest country in North America, comprising 10 provinces and three territories. Its capital is Ottawa.
A province of western Canada, lying between the provinces of British Columbia and Saskatchewan. Its capital is Edmonton. It was named in honor of Princess Louise Caroline Alberta, the fourth daughter of Queen Victoria. (From Webster's New Geographical Dictionary, 1988, p26 & Room, Brewer's Dictionary of Names, 1992, p12)
A province of Canada on the Pacific coast. Its capital is Victoria. The name given in 1858 derives from the Columbia River which was named by the American captain Robert Gray for his ship Columbia which in turn was named for Columbus. (From Webster's New Geographical Dictionary, 1988, p178 & Room, Brewer's Dictionary of Names, 1992, p81-2)
The systematic study of the complete DNA sequences (GENOME) of organisms.
Works containing information articles on subjects in every field of knowledge, usually arranged in alphabetical order, or a similar work limited to a special field or subject. (From The ALA Glossary of Library and Information Science, 1983)
Enzymes that catalyze reversibly the formation of an epoxide or arene oxide from a glycol or aromatic diol, respectively.
The major metabolite in neutrophil polymorphonuclear leukocytes. It stimulates polymorphonuclear cell function (degranulation, formation of oxygen-centered free radicals, arachidonic acid release, and metabolism). (From Dictionary of Prostaglandins and Related Compounds, 1990)
A class of cell surface leukotriene receptors with a preference for leukotriene B4. Leukotriene B4 receptor activation influences chemotaxis, chemokinesis, adherence, enzyme release, oxidative bursts, and degranulation in polymorphonuclear leukocytes. There are at least two subtypes of these receptors. Some actions are mediated through the inositol phosphate and diacylglycerol second messenger systems.
(2S-(2 alpha,3 beta(1E,3E,5Z,8Z)))-3-(1,3,5,8-Tetradecatetraenyl)oxiranebutanoic acid. An unstable allylic epoxide, formed from the immediate precursor 5-HPETE via the stereospecific removal of a proton at C-10 and dehydration. Its biological actions are determined primarily by its metabolites, i.e., LEUKOTRIENE B4 and cysteinyl-leukotrienes. Alternatively, leukotriene A4 is converted into LEUKOTRIENE C4 by glutathione-S-transferase or into 5,6-di-HETE by the epoxide-hydrolase. (From Dictionary of Prostaglandins and Related Compounds, 1990)
An unsaturated, essential fatty acid. It is found in animal and human fat as well as in the liver, brain, and glandular organs, and is a constituent of animal phosphatides. It is formed by the synthesis from dietary linoleic acid and is a precursor in the biosynthesis of prostaglandins, thromboxanes, and leukotrienes.
A class of compounds named after and generally derived from C20 fatty acids (EICOSANOIC ACIDS) that includes PROSTAGLANDINS; LEUKOTRIENES; THROMBOXANES, and HYDROXYEICOSATETRAENOIC ACIDS. They have hormone-like effects mediated by specialized receptors (RECEPTORS, EICOSANOID).
The addition of descriptive information about the function or structure of a molecular sequence to its MOLECULAR SEQUENCE DATA record.
Databases containing information about PROTEINS such as AMINO ACID SEQUENCE; PROTEIN CONFORMATION; and other properties.
A process that includes the determination of AMINO ACID SEQUENCE of a protein (or peptide, oligopeptide or peptide fragment) and the information analysis of the sequence.
Sequential operating programs and data which instruct the functioning of a digital computer.
A loose confederation of computer communication networks around the world. The networks that make up the Internet are connected through several backbone networks. The Internet grew out of the US Government ARPAnet project and was designed to facilitate information exchange.
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
Linear POLYPEPTIDES that are synthesized on RIBOSOMES and may be further modified, crosslinked, cleaved, or assembled into complex proteins with several subunits. The specific sequence of AMINO ACIDS determines the shape the polypeptide will take, during PROTEIN FOLDING, and the function of the protein.
An essential amino acid. It is often added to animal feed.
Experimentation on STEM CELLS and on the use of stem cells.
Any of various enzymatically catalyzed post-translational modifications of PEPTIDES or PROTEINS in the cell of origin. These modifications include carboxylation; HYDROXYLATION; ACETYLATION; PHOSPHORYLATION; METHYLATION; GLYCOSYLATION; ubiquitination; oxidation; proteolysis; and crosslinking and result in changes in molecular weight and electrophoretic motility.
The addition of an organic acid radical into a molecule.
Short-chain fatty acids of up to six carbon atoms in length. They are the major end products of microbial fermentation in the ruminant digestive tract and have also been implicated in the causation of neurological diseases in humans.
A family of gram-negative aerobic bacteria in the class BETA PROTEOBACTERIA, encompassing the acidovorans rRNA complex. Some species are pathogenic for PLANTS.
A plant genus of the family CUCURBITACEAE known for the edible fruit.
A plant species of the family CUCURBITACEAE, order Violales, subclass Dilleniidae known for the melon fruits with reticulated (net) surface including cantaloupes, honeydew, casaba, and Persian melons.
The degree of 3-dimensional shape similarity between proteins. It can be an indication of distant AMINO ACID SEQUENCE HOMOLOGY and used for rational DRUG DESIGN.
The portion of an interactive computer program that issues messages to and receives commands from a user.
The process of pictorial communication, between human and computers, in which the computer input and output have the form of charts, drawings, or other appropriate pictorial representation.
5'-S-(3-Amino-3-carboxypropyl)-5'-thioadenosine. Formed from S-adenosylmethionine after transmethylation reactions.
Molecule produced in plant leaves that acts like a hormone by inducing flowering in the shoot apical meristem of buds and growing tips.
Inorganic or organic compounds derived from phosphine (PH3) by the replacement of H atoms. (From Grant & Hackh's Chemical Dictionary, 5th ed)
NATIONAL LIBRARY OF MEDICINE service for health professionals and consumers. It links extensive information from the National Institutes of Health and other reviewed sources of information on specific diseases and conditions.
Longitudinal patient-maintained records of individual health history and tools that allow individual control of access.
A sulfur-containing essential L-amino acid that is important in many body functions.
Substituted thioglucosides. They are found in rapeseed (Brassica campestris) products and related cruciferae. They are metabolized to a variety of toxic products which are most likely the cause of hepatocytic necrosis in animals and humans.
A flammable, poisonous gas with a characteristic odor of rotten eggs. It is used in the manufacture of chemicals, in metallurgy, and as an analytical reagent. (From Merck Index, 11th ed)
Physiologic methyl radical donor involved in enzymatic transmethylation reactions and present in all living organisms. It possesses anti-inflammatory activity and has been used in treatment of chronic liver disease. (From Merck, 11th ed)
A thiol-containing non-essential amino acid that is oxidized to form CYSTINE.
Nucleosides in which the base moiety is substituted with one or more sulfur atoms.

S-adenosylmethionine synthetase is overexpressed in murine neuroblastoma cells resistant to nucleoside analogue inhibitors of S-adenosylhomocysteine hydrolase: a novel mechanism of drug resistance. (1/196)

S-Adenosylmethionine (AdoMet) synthetase (EC, which catalyzes the synthesis of AdoMet from methionine and ATP, is the major methyl donor for transmethylation reactions and propylamino donor for the biosynthesis of polyamines in biological systems. We have reported previously that wild-type C-1300 murine neuroblastoma (wMNB) cells, made resistant to the nucleoside analogue (Z)-5'-fluoro-4',5'-didehydro-5'-deoxyadenosine (MDL 28,842), an irreversible inhibitor of S-adenosylhomocysteine (AdoHcy) hydrolase (EC, express increased AdoMet synthetase activity (M. R. Hamre et al., Oncol. Res., 7: 487-492, 1995). In the present study, immunoblot analyses of AdoMet Synthetase with isoform-specific (MATII) antibodies demonstrated an elevation in the AdoMet synthetase immunoprotein in nucleoside analogue-resistant MNB cells (rMNB-MDL) when compared to wild-type, nonresistant MNB cells. An increase of 2.1-fold was observed in the alpha2/alpha2' catalytic subunit, which differed significantly from the much smaller increment in the noncatalytic beta-subunit of AdoMet synthetase. Densitometric analyses revealed that an increased expression of AdoMet synthetase in rMNB-MDL cells was due to overexpression of the alpha2 (Mr 53,000; 2.6-fold) and alpha2' (Mr 51,000; 1.8-fold) subunits. AdoMet synthetase mRNA expression in rMNB-MDL cells was remarkably greater than wMNB cells, as determined by quantitative competitive reverse transcription-PCR (QC-PCR) analysis. DNA (cytosine) methyl transferase expression, measured by reverse transcription-PCR analysis, was also elevated significantly in rMNB-MDL cells. In contrast, Western blot analyses demonstrated down-regulation (1.6-fold) of AdoMet synthetase in doxorubicin-resistant human leukemia cells (HL-60-R) expressing multidrug resistance protein when compared with wild-type, nonresistant HL-60 cells. The resistance of rMNB-MDL cells to nucleoside analogue inhibitors of S-adenosylhomocysteine hydrolase correlates directly with overexpression of the alpha2/alpha2' subunits of AdoMet synthetase. Cellular adaptation allows sufficient AdoMet to be synthesized, so that viability of the MNB cells can be maintained even in the presence of high AdoHcy concentrations. This novel mechanism of drug resistance does not appear to require multidrug resistance protein (P-glycoprotein) overexpression.  (+info)

3-deazaadenosine, a S-adenosylhomocysteine hydrolase inhibitor, has dual effects on NF-kappaB regulation. Inhibition of NF-kappaB transcriptional activity and promotion of IkappaBalpha degradation. (2/196)

Previously we reported that 3-deazaadenosine (DZA), a potent inhibitor and substrate for S-adenosylhomocysteine hydrolase inhibits bacterial lipopolysaccharide-induced transcription of tumor necrosis factor-alpha and interleukin-1beta in mouse macrophage RAW 264.7 cells. In this study, we demonstrate the effects of DZA on nuclear factor-kappaB (NF-kappaB) regulation. DZA inhibits the transcriptional activity of NF-kappaB through the hindrance of p65 (Rel-A) phosphorylation without reduction of its nuclear translocation and DNA binding activity. The inhibitory effect of DZA on NF-kappaB transcriptional activity is potentiated by the addition of homocysteine. Taken together, DZA promotes the proteolytic degradation of IkappaBalpha, but not IkappaBbeta, resulting in an increase of DNA binding activity of NF-kappaB in the nucleus in the absence of its transcriptional activity in RAW 264.7 cells. The reduction of IkappaBalpha by DZA is neither involved in IkappaB kinase complex activation nor modulated by the addition of homocysteine. This study strongly suggests that DZA may be a potent drug for the treatment of diseases in which NF-kappaB plays a central pathogenic role, as well as a useful tool for studying the regulation and physiological functions of NF-kappaB.  (+info)

Nuclear accumulation of S-adenosylhomocysteine hydrolase in transcriptionally active cells during development of Xenopus laevis. (3/196)

The oocyte nuclear antigen of the monoclonal antibody 32-5B6 of Xenopus laevis is subject to regulated nuclear translocation during embryogenesis. It is distributed in the cytoplasm during oocyte maturation, where it remains during cleavage and blastula stages, before it gradually reaccumulates in the nuclei during gastrulation. We have now identified this antigen to be the enzyme S-adenosylhomocysteine hydrolase (SAHH). SAHH is the only enzyme that cleaves S-adenosylhomocysteine, a reaction product and an inhibitor of all S-adenosylmethionine-dependent methylation reactions. We have compared the spatial and temporal patterns of nuclear localization of SAHH and of nuclear methyltransferase activities during embryogenesis and in tissue culture cells. Nuclear localization of Xenopus SAHH did not temporally correlate with DNA methylation. However, we found that SAHH nuclear localization coincides with high rates of mRNA synthesis, a subpopulation colocalizes with RNA polymerase II, and inhibitors of SAHH reduce both methylation and synthesis of poly(A)(+) RNA. We therefore propose that accumulation of SAHH in the nucleus may be required for efficient cap methylation in transcriptionally active cells. Mutation analysis revealed that the C terminus and the N terminus are both required for efficient nuclear translocation in tissue culture cells, indicating that more than one interacting domain contributes to nuclear accumulation of Xenopus SAHH.  (+info)

UV light selectively coinduces supply pathways from primary metabolism and flavonoid secondary product formation in parsley. (4/196)

The UV light-induced synthesis of UV-protective flavonoids diverts substantial amounts of substrates from primary metabolism into secondary product formation and thus causes major perturbations of the cellular homeostasis. Results from this study show that the mRNAs encoding representative enzymes from various supply pathways are coinduced in UV-irradiated parsley cells (Petroselinum crispum) with two mRNAs of flavonoid glycoside biosynthesis, encoding phenylalanine ammonia-lyase and chalcone synthase. Strong induction was observed for mRNAs encoding glucose 6-phosphate dehydrogenase (carbohydrate metabolism, providing substrates for the shikimate pathway), 3-deoxyarabinoheptulosonate 7-phosphate synthase (shikimate pathway, yielding phenylalanine), and acyl-CoA oxidase (fatty acid degradation, yielding acetyl-CoA), and moderate induction for an mRNA encoding S-adenosyl-homocysteine hydrolase (activated methyl cycle, yielding S-adenosyl-methionine for B-ring methylation). Ten arbitrarily selected mRNAs representing various unrelated metabolic activities remained unaffected. Comparative analysis of acyl-CoA oxidase and chalcone synthase with respect to mRNA expression modes and gene promoter structure and function revealed close similarities. These results indicate a fine-tuned regulatory network integrating those functionally related pathways of primary and secondary metabolism that are specifically required for protective adaptation to UV irradiation. Although the response of parsley cells to UV light is considerably broader than previously assumed, it contrasts greatly with the extensive metabolic reprogramming observed previously in elicitor-treated or fungus-infected cells.  (+info)

Simple and sensitive binding assay for measurement of adenosine using reduced S-adenosylhomocysteine hydrolase. (5/196)

BACKGROUND: Adenosine has been suggested to play an important role in the regulation of renal function. We developed a simple and sensitive binding assay for the detection of adenosine based on the displacement of [(3)H]adenosine from S-adenosylhomocysteine (SAH) hydrolase in its reduced form. METHODS: SAH hydrolase was purified to apparent homogeneity from bovine kidney by standard chromatographic methods. SAH hydrolase was converted in its reduced form, which had the advantage that the SAH hydrolase is enzymatically inactive. This reduced enzyme retains its ability to bind adenosine with high affinity. To determine adenosine in urine or tissues, samples must be deproteinized (e.g., with 10 g/L sulfosalicylic acid or 0.6 mol/L perchloric acid). RESULTS: The reduced SAH hydrolase bound adenosine with a dissociation constant of 33.0 +/- 2 nmol/L. Displacement of adenosine binding by the adenine 5'-nucleotides, adenine and hypoxanthine, required >1000-fold higher concentrations than adenosine itself. The intra- and interassay imprecision (CV) was <3.9% and 7.8%, respectively, and the values obtained showed acceptable correlation with those by HPLC. CONCLUSIONS: The highly sensitive adenosine-binding protein assay is a simple test that allows detection of adenosine in samples with small volumes without purification, and is in this respect superior to HPLC.  (+info)

Synthesis of S-adenosyl-L-homocysteine hydrolase inhibitors and their biological activities. (6/196)

Several nucleosides have been prepared as a possible inhibitor of human S-adenosyl-L-homocysteine (SAH) hydrolase for the development of anti-viral agents. Recently, SAH hydrolase has been considered as an attractive target for parasite chemotherapy for malaria. We report synthesis of several nucleosides including carbocyclic nucleosides and their inhibitory activities against recombinant malaria and human SAH hydrolases.  (+info)

Identification and characterization of three differentially expressed genes, encoding S-adenosylhomocysteine hydrolase, methionine aminopeptidase, and a histone-like protein, in the toxic dinoflagellate Alexandrium fundyense. (7/196)

Genes showing differential expression related to the early G(1) phase of the cell cycle during synchronized circadian growth of the toxic dinoflagellate Alexandrium fundyense were identified and characterized by differential display (DD). The determination in our previous work that toxin production in Alexandrium is relegated to a narrow time frame in early G(1) led to the hypothesis that transcriptionally up- or downregulated genes during this subphase of the cell cycle might be related to toxin biosynthesis. Three genes, encoding S-adenosylhomocysteine hydrolase (Sahh), methionine aminopeptidase (Map), and a histone-like protein (HAf), were isolated. Sahh was downregulated, while Map and HAf were upregulated, during the early G(1) phase of the cell cycle. Sahh and Map encoded amino acid sequences with about 90 and 70% similarity to those encoded by several eukaryotic and prokaryotic Sahh and Map genes, respectively. The partial Map sequence also contained three cobalt binding motifs characteristic of all Map genes. HAf encoded an amino acid sequence with 60% similarity to those of two histone-like proteins from the dinoflagellate Crypthecodinium cohnii Biecheler. This study documents the potential of applying DD to the identification of genes that are related to physiological processes or cell cycle events in phytoplankton under conditions where small sample volumes represent an experimental constraint. The identification of an additional 21 genes with various cell cycle-related DD patterns also provides evidence for the importance of pretranslational or transcriptional regulation in dinoflagellates, contrary to previous reports suggesting the possibility that translational mechanisms are the primary means of circadian regulation in this group of organisms.  (+info)

The use of enzyme therapy to regulate the metabolic and phenotypic consequences of adenosine deaminase deficiency in mice. Differential impact on pulmonary and immunologic abnormalities. (8/196)

Adenosine deaminase (ADA) deficiency results in a combined immunodeficiency brought about by the immunotoxic properties of elevated ADA substrates. Additional non-lymphoid abnormalities are associated with ADA deficiency, however, little is known about how these relate to the metabolic consequences of ADA deficiency. ADA-deficient mice develop a combined immunodeficiency as well as severe pulmonary insufficiency. ADA enzyme therapy was used to examine the relative impact of ADA substrate elevations on these phenotypes. A "low-dose" enzyme therapy protocol prevented the pulmonary phenotype seen in ADA-deficient mice, but did little to improve their immune status. This treatment protocol reduced metabolic disturbances in the circulation and lung, but not in the thymus and spleen. A "high-dose" enzyme therapy protocol resulted in decreased metabolic disturbances in the thymus and spleen and was associated with improvement in immune status. These findings suggest that the pulmonary and immune phenotypes are separable and are related to the severity of metabolic disturbances in these tissues. This model will be useful in examining the efficacy of ADA enzyme therapy and studying the mechanisms underlying the immunodeficiency and pulmonary phenotypes associated with ADA deficiency.  (+info)

Looking for online definition of S-adenosylhomocysteine hydrolase deficiency in the Medical Dictionary? S-adenosylhomocysteine hydrolase deficiency explanation free. What is S-adenosylhomocysteine hydrolase deficiency? Meaning of S-adenosylhomocysteine hydrolase deficiency medical term. What does S-adenosylhomocysteine hydrolase deficiency mean?
Accepted name: adenosylhomocysteinase. Reaction: S-adenosyl-L-homocysteine + H2O = L-homocysteine + adenosine. For diagram click here.. Other name(s): S-adenosylhomocysteine synthase; S-adenosylhomocysteine hydrolase; adenosylhomocysteine hydrolase (ambiguous); S-adenosylhomocysteinase; SAHase; AdoHcyase. Systematic name: S-adenosyl-L-homocysteine hydrolase. Comments: The enzyme contains one tightly bound NAD+ per subunit. This appears to bring about a transient oxidation at C-3 of the 5-deoxyadenosine residue, thus labilizing the thioether bond [2] (for mechanism click here), cf. EC, inositol-3-phosphate synthase.. Links to other databases: BRENDA, EXPASY, GTD, KEGG, Metacyc, PDB, CAS registry number: 9025-54-1. References:. 1. de la Haba, G. and Cantoni, G.L. The enzymatic synthesis of S-adenosyl-L-homocysteine from adenosine and homocysteine. J. Biol. Chem. 234 (1959) 603-608. [PMID: 13641268] 2. Palmer, J.L. and Abeles, R.H. The mechanism of action of S-adenosylhomocysteinase. J. ...
FIG. 1. The SAHH gene is a Myc target gene. (A) P493-6 cells were incubated with doxycycline (Dox) to inhibit exogenous Myc expression or vehicle control (veh). Rat1A fibroblasts, primary MEFs, and IMECs were infected with retroviruses to express vector control, MycWT, or MycΔMBII, and pools of cells were drug selected. Primary murine T cells were incubated with IL-2, IL-7, and IL-15 for 24 h. Rat1A cells were incubated with a control siRNA (con si; cyclophilin B siRNA) or an siRNA directed against Myc (Myc si) for 24 h. Western blotting was performed to detect SAHH, Myc, β-tubulin, or POLR2A expression, as loading controls. (B) RNA was extracted from the cell lines indicated, and RT-PCR was performed to detect SAHH mRNA levels relative to GAPDH (or 18S rRNA for P493-6). Prim., primary. (C) In the IMEC lines indicated, SAHH mRNA was detected by RT-PCR (black bars) and m7G (cap-methylated) SAHH mRNA was detected by anti-m7G IP followed by RT-PCR (gray bars). (D) Rat fibroblasts expressing the ...
As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
Background and aims S-Adenosyl-l-homocysteine hydrolase (SAHH) is a highly conserved ubiquitous enzyme that catalyses the hydrolysis of S-adenosyl-l-homocysteine (SAH) to adenosine (Ado) and homocysteine (Hcy) in eukaryotic cells. The reversible type III SAHH inhibitor DZ2002 has been found to have an immunomodulatory function and to alleviate disease in several inflammatory and autoimmune animal models, with greatly reduced cytotoxicity. This study was aim to examine the therapeutic effects and underlying mechanisms of DZ2002 on lupus-prone female NZB/W F1 mice. ...
TY - JOUR. T1 - Design, synthesis, and molecular modeling studies of 5′-deoxy-5′-ureidoadenosine. T2 - 5′-ureido group as multiple hydrogen bonding donor in the active site of S-adenosylhomocysteine hydrolase. AU - Wang, Ting. AU - Lee, Hyun Joo. AU - Tosh, Dilip K.. AU - Kim, Hea Ok. AU - Pal, Shantanu. AU - Choi, Sun. AU - Lee, Yoonji. AU - Moon, Hyung Ryong. AU - Zhao, Long Xuan. AU - Lee, Kang Man. AU - Jeong, Lak Shin. N1 - Funding Information: This work was supported by grants from the Korea Research Foundation (KRF-2005-005-J01502) and the National Core Research Center (NCRC) program (No. R15-2006-020) of the Ministry of Science and Technology (MOST) and the Korea Science and Engineering Foundation (KOSEF) through the Center for Cell Signaling & Drug Discovery Research at Ewha Womans University.. PY - 2007/8/15. Y1 - 2007/8/15. N2 - 5′-Deoxy-5′-ureidoadenosine was designed and synthesized as a potent inhibitor of S-adenosylhomocysteine hydrolase (SAH), in which 5′-ureido group ...
Ioan Andricioaei - University of Michigan, Ann Arbor. 10:35am - 11:10am - Break. 11:10am - 11:45am - Hinge-Bending Motion in S-adenosyl-L-homocysteine Hydrolase: Mutagenesis, Fluorescence and Modeling Studies [PDF ...
9-β-d-Arabinofuranosyladenine (ara-A), 9-β-d-arabinofuranosyladenine 5′-monophosphate, and 9-β-d-arabinofuranosyladenine 5′-triphosphate competitively inhibit both the synthesis and hydrolysis of S-adenosylhomocysteine catalyzed by S-adenosylhomocysteinase [S-adenosylhomocysteine hydrolase (EC] from mouse liver, and the inhibitor constants were 5.0 × 10-6, 1.1 × 10-4, and 1.0 × 10-3 m, respectively. A time-dependent inactivation of the enzyme was observed when the enzyme was preincubation with ara-A, 9-β-d-arabinofuranosyladenine 5′-monophosphate, or 9-β-d-arabinofuranosyladenine 5′-triphosphate. ara-A was the most potent inactivator. The inactivation with ara-A was less pronounced in the presence of adenosine, S-adenosylhomocysteine, adenine, adenosine 5′-monophosphate, or adenosine 5′-diphosphate, showed first-order kinetics, saturability, and irreversibility. The rate of inactivation was half-maximal at 5 × 10-6 m ara-A, and the rate constant of inactivation was ...
Methionine metabolism is critical for the maintenance of embryonic stem cells (ESCs) and induced pluripotent stem cells (iPSCs) pluripotency. However, little is known about the regulation of the methionine cycle to sustain ESC pluripotency. Here, we show that adenosylhomocysteinase (AHCY), an important enzyme in the methionine cycle, is critical for the maintenance and differentiation of mouse embryonic stem cells (mESCs). We show that mESCs exhibit high levels of methionine metabolism, whereas decreasing methionine metabolism via depletion of AHCY promotes mESCs to differentiate into the three germ layers. AHCY is posttranslationally modified with an O-linked β-N-acetylglucosamine sugar (O-GlcNAcylation), which is rapidly removed upon differentiation. O-GlcNAcylation of threonine 136 on AHCY increases its activity and is important for the maintenance of trimethylation of histone H3 lysine 4 (H3K4me3) to sustain mESC pluripotency. Blocking glycosylation of AHCY decreases the ratio of ...
FUNCTION: [Summary is not available for the mouse gene. This summary is for the human ortholog.] S-adenosylhomocysteine hydrolase belongs to the adenosylhomocysteinase family. It catalyzes the reversible hydrolysis of S-adenosylhomocysteine (AdoHcy) to adenosine (Ado) and L-homocysteine (Hcy). Thus, it regulates the intracellular S-adenosylhomocysteine (SAH) concentration thought to be important for transmethylation reactions. Deficiency in this protein is one of the different causes of hypermethioninemia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2009 ...
Ahcy - Model 8032 C57BL/6 from Taconics GEM Collection. Genetically engineered mouse models for research. See the specs for these mice & start an order today.
DZNep was previously reported to be a selective inhibitor of H3K27 and H4K20 trimethylation (13). However, that study focused only on the methylation of H3K27, H3K9, and H4K20, whereas we have expanded the study to include other histone methylation modifications. Our extended study shows that DZNep is not a selective inhibitor of H3K27me3 and H4K20me3 as previously reported (13). Instead DZNep was found to globally inhibit both repressive and active histone methylation marks. In addition, we tested other AdoHcy hydrolase and global methyltransferase inhibitors and found that EZH2 inhibition is not specific to DZNep. However, DZNep may have more clinical potential than many of these other inhibitors due to the known limitations of other AdoHcy hydrolase inhibitors. For example, adenosine dialdehyde, which is less potent than DZNep, may not metabolically survive because of the two labile aldehyde groups. In addition, other AdoHcy inhibitors such as neplanocin A are toxic because neplanocin A is ...
We followed the mitotic transmission of an experimentally induced hypomethylated state of several tobacco repetitive sequences in callus culture and plants. The initial hypomethylation was induced by a hypomethylation drug, dihydroxypropyladenine (DHPA), the competitive inhibitor of cellular S-adenosylhomocysteine hydrolase, which is known to preferentially inhibit methylation at CNG and non-symmetrical motifs while having a negligible effect on methylation at CG motifs. The deprivation of this drug resulted in an almost immediate remethylation of cytosines at CNG motifs (MspI and EcoRII sites) leading us to conclude that, the hypomethylation effect of dihydroxypropyladenine is rather transient and differs from that of 5-azacytidine which often induces heritable changes in methylation patterns. The results suggest that de novo methylation of CNG motifs is a rapid and meiotically independent process on DNA sequences with pre-existing CG methylation ...
Growth of a disruption mutant of S-adenosylhomocysteine hydrolase (Δ SAH1) in S.cerevisiae is severely defective. A prolonged lag precedes log growth, the rate of log growth is 6.7-fold less than WT, and the number of cells ...
CP000529.PE483 Location/Qualifiers FT CDS 516348..517784 FT /codon_start=1 FT /transl_table=11 FT /locus_tag=Pnap_0489 FT /product=adenosylhomocysteinase FT /EC_number= FT /note=KEGG: pol:Bpro_4132 adenosylhomocysteinase; TIGRFAM: FT adenosylhomocysteinase; PFAM: S-adenosyl-L-homocysteine FT hydrolase; TrkA-N domain protein FT /db_xref=EnsemblGenomes-Gn:Pnap_0489 FT /db_xref=EnsemblGenomes-Tr:ABM35810 FT /db_xref=GOA:A1VJI2 FT /db_xref=InterPro:IPR000043 FT /db_xref=InterPro:IPR015878 FT /db_xref=InterPro:IPR020082 FT /db_xref=InterPro:IPR036291 FT /db_xref=InterPro:IPR042172 FT /db_xref=UniProtKB/TrEMBL:A1VJI2 FT /protein_id=ABM35810.1 FT /translation=MNIALKTMLNTDHIIADLTLAAWGRKELKIAETEMPGLMAIRQEF FT AAAQPLKGARITGSLHMTIQTGVLIETLQALGAEVRWASCNIFSTQDHAAAAIAAEGTP FT VFAVKGETLADYWDYTHRIFEFTGAKGTPEEGPNMILDDGGDATLLMHLGARAETDASL FT LEYPASEEETCLFGAIKAKLAQDPTWYSRRLANIIGVTEETTTGVLRLNEMSAKGTLAF FT RAINVNDSVTKSKFDNLYGCRESLVDAIKRATDVMIAGKVAVVAGYGDVGKGCAQALRA FT ...
In the present study, LCM-assisted tissue specimen preparation was combined with cDNA microarray and LongSAGE analysis for the rapid identification and validation of tumor-associated genes in colon cancer. Combined analyses revealed significant upregulation of 30 genes and downregulation of 73 genes in colon carcinoma. Upregulation of FERMT1, AHCY, SCRN1, and SAC3D1 expression and downregulation of IgJ and MALL expression in colon cancer were confirmed by RT-PCR. Upregulated FERMT1 protein expression in colon carcinoma was associated with significantly poorer DFS and OS and was confirmed as an independent prognostic factor for DFS.. The FERMT1 protein is expressed predominantly in skin, intestine, and kidney. It localizes to cell junctions and regulates integrin function to facilitate the linkage of cell adhesion structures to the actin cytoskeleton (38). As a crucial connector between cytoskeletal structures and the extracellular matrix, FERMT1 may also be involved in the assembly and ...
The protein encoded by this gene interacts with inositol 1,4,5-trisphosphate receptor, type 1 and may be involved in the conversion of S-adenosyl-L-homocysteine to L-homocysteine and adenosine. Several transcript variants encoding two different isoforms have been found for this gene ...
iframe src= ...
Multi-disciplinary facility where composers and researchers use computer-based technology as an artistic medium and as a research tool.
S-adenosyl-L-methionine + a [histone H3]-N(6),N(6)-dimethyl-L-lysine(36) S-adenosyl-L-homocysteine + a [histone H3]-N(6),N(6),N(6)-trimethyl-L-lysine(36 ...
S-Adenosyl-L-methionine + Peptide 2-[3-carboxy-3-(methylammonio)propyl]-L-histidine ,=> S-Adenosyl-L-homocysteine + Peptide 2-[3-carboxy-3-(dimethylammonio)propyl]-L- ...
16S rRNA (cytosine1402-N4)-methyltransferaseS-adenosyl-L-methionine + cytosine1402 in 16S rRNA = S-adenosyl-L-homocysteine + N4-methylcytosine1402 in 16S rRNA ...
16S rRNA (cytidine1402-2-O)-methyltransferaseS-adenosyl-L-methionine + cytidine1402 in 16S rRNA = S-adenosyl-L-homocysteine + 2-O-methylcytidine1402 in 16S rRNA ...
Human AHCYL1 full-length ORF ( NP_006612.2, 1 a.a. - 530 a.a.) recombinant protein with GST-tag at N-terminal. (H00010768-P01) - Products - Abnova
Fumie TAKAHASHI, Kyoko MORITA, Kanako KATAI, Hiroko SEGAWA, Ai FUJIOKA, Tomoko KOUDA, Sawako TATSUMI, Tomoko NII, Yutaka TAKETANI, Hiromi HAGA, Setsuji HISANO, Yoshihiro FUKUI, Ken-ichi MIYAMOTO, Eiji TAKEDA ...
Ravi Shankar Mishra, Subhabrata Basu, Yaping Gu, Xiu Luo, Wen-Quan Zou, Richa Mishra, Ruliang Li, Shu G. Chen, Pierluigi Gambetti, Hisashi Fujioka and Neena Singh ...
Eye cancer | Eyeball removal (enucleation). Ophthalmology: Treatment in Marburg, Germany ✈. Prices on - booking treatment online!
Home » S-adenosylhomocysteine deaminase. S-adenosylhomocysteine deaminase (Science: enzyme) From streptomyces flocculus; deaminating enzyme responsible for the conversion of s-adenosylhomocysteine to s-inosylhomocysteine Registry number: EC 3.5.4.- Synonym: adohcy deaminase ...
Home » S-adenosylhomocysteine. s-adenosylhomocysteine (Science: chemical) 5-s-(3-amino-3-carboxypropyl)-5-thioadenosine. Formed from s-adenosylmethionine after transmethylation reactions. Chemical name: L-Homocysteine, S-(5-deoxyadenosin-5-yl)- ...
OMIM® : 57 Deficiency of pyrimidine 5-prime nucleotidase, also called uridine 5-prime monophosphate hydrolase, causes an autosomal recessive hemolytic anemia characterized by marked basophilic stippling and the accumulation of high concentrations of pyrimidine nucleotides within the erythrocyte. The enzyme is implicated in the anemia of lead poisoning and is possibly associated with learning difficulties. Hirono et al. (1988) suggested that this deficiency is the third most common RBC enzymopathy--after G6PD (300908) and pyruvate kinase (see 266200) deficiencies--causing hemolysis (summary by Marinaki et al., 2001). (266120) (Updated 05-Mar-2021) ...
S-Adenosyl-L-homocysteine United States Pharmacopeia (USP) Reference Standard; CAS Number: 979-92-0; Synonym: S-(5′-Adenosyl)-L-homocysteine, 5′-Deoxy-S-adenosyl-L-homocysteine, AdoHcy, S-(5′-Deoxyadenosine-5′)-L-homocysteine; Linear Formula: C14H20N6O5S; find USP-1012112 MSDS, related peer-reviewed papers, technical documents, similar products & more at Sigma-Aldrich.
We recently reported the existence of a trans-acling factor (SPB) in Rhodobacter sphaeroides that repressed the expression of the puf operon during illumination. SPB was somewhat homologous to HvrA of Rhodobacter capsulatus, but these proteins appear to have functionally different properties. We now report an analysis of the flanking region of spb in the genome of R. sphaeroides, and we show that spb is a positional counterpart of hvrA of R. capsulatus. The region directly downstream of spb was found to contain three genes, two of which were highly homologous to orf5 and ahcY in R. capsulatus. However, a gene corresponding to hvrB, which controls the expression of orf5 and ahcY in R. capsulatus, was absent in R. sphaeroides. The level of the transcript of ahcY did not change in cells grown under photosynthetic and by respiratory conditions. By contrast, orf5 was transcribed at a higher rate in photosynthetically grown cells under high-intensity light than under low-intensity light, indicating ...
The inactivation of S-adenosylhomocysteine (AdoHcy) hydrolase (EC in isolated rat hepatocytes by 9-β-d-arabinofuranosyladenine (ara-A) was associated with tight binding of ara-A to the enzyme and showed an initial phase obeying first-order kinetics characterized by K1 (concentration of half-maximal rate of inactivation) of 12 µm for ara-A and a maximal rate of inactivation of 0.7 min-1. Two to 3% of the enzyme in rat hepatocytes was not available for inactivation. Similar results were obtained with some cultured cells, including mouse plasmacytoma cells (MPC-11), mouse fibroblasts (L-929), and human chronic myelogenic leukemia cells (K-562). In a cellular medium devoid of adenosine deaminase, inhibitors of this enzyme did not affect the inactivation process in rat hepatocytes and only slightly enhanced this process in the cultured cells (at low concentrations of ara-A). Inactivation of AdoHcy hydrolase in rat hepatocytes was associated with a massive build-up of AdoHcy (from 75 to ...
BioAssay record AID 98939 submitted by ChEMBL: Tested for the ability to traverse cell membranes and to alter ratio of AdoMet to S-adenosyl-homocysteine (AdoHcy) in L1210 murine lymphocytic leukemia cells.
COMMUNICATIONS The molecular packing characteristics in this class of bolaamphiphilic materials is currently under investigation for a wide range of chain lengths.[25] Received: Septemberl4,1995 [Z 7313 IE] German version: Angew. Chem. 1995, 107, 707 Keywords: bolaamphiphiles . structure elucidation . thin films [l] A bolaamphiphile contains a hydrophobic chain with hydrophilic groups at both ends. See G. H. Escamilla, G. R. Newkome, Angew. Chem. 1995, 106, 2016; Angew. Chem. Int. Ed. Engl. 1995, 33, 1937. [2] R. Popovitz-Biro, J. Majewski, L. Margulis, S. Cohen, L. Leiserowitz, M. Lahav, J. Phys. Chem. 1995, 98,4970. (31 R. Popovitz-Biro, J. Majewski, L. Margulis, S . Cohen, L. Leiserowitz, M. Lahav, Adv. Muter. 1995, 6, 956. [4] a) S. Weinbach, K. Kjaer, W. G. Bouwman, G . Griibel, G. Legrand, J. AlsNielsen, M. Lahav, L. Leiserowitz, Science 1995,264,1566; b) S. Weinbach, K. Kjaer, J. Als-Nielsen, M. Lahav, L. Leiserowitz, J. Phys. Chem. 1993, 97, 5200. [5] J. Als-Nielsen, K. Kjaer in ...
malonyl-[ACP] + S-adenosyl-L-methionine = malonyl-[ACP] methyl ester + S-adenosyl-L-homocysteine Last modified: 2020-05-27. Chemically balanced: yes. ...
S)-laudanine + H(+) + S-adenosyl-L-homocysteine =, (S)-reticuline + S-adenosyl-L-methionine Last modified: 2018-01-25. Chemically balanced: yes. ...
2-[3-carboxy-3-(methylammonio)propyl]-L-histidine + H(+) + S-adenosyl-L-homocysteine =, 2-(3-amino-3-carboxypropyl)-L-histidine + S-adenosyl-L-methionine Last modified: 2018-01-25. Chemically balanced: yes. ...
Human methyltransferase tRNA (transfer ribonucleic acid) complex. Human methyltransferase (blue, yellow) complexed with tRNA3(Lys) (red) and S-adenosyl-L-homocysteine (buried inside). - Stock Image C035/6264
Tamura K, Makino A, Hullin-Matsuda F, Kobayashi T, Furihata M, Chung S, Ashida S, Miki T, Fujioka T, Shuin T, Nakamura Y, Nakagawa ...
FUJIOKA SUSUMU , MIZUMOTO KIYOSHI , OKADA KAZUO Surgery today : the Japanese journal of surgery 30(10), 871-874, 2000-10-01 参考文献14件 ...
Fujioka, Masayuki; Nakano, Takafumi; Hayakawa, Kazuhide; Irie, Keiichi; Akitake, Yoshiharu; Sakamoto, Yuya; Mishima, Kenichi; Muroi, Carl; Yonekawa, Yasuhiro; Banno, Fumiaki; Kokame, Koichi; Miyata, Toshiyuki; Nishio, Kenji; Okuchi, Kazuo; Iwasaki, Katsunori; Fujiwara, Michihiro; Siesjö, Bo K. ...
Use Bio-Rads PrimePCR assays, controls, templates for your target gene. Every primer pair is optimized, experimentally validated, and performance guaranteed.
Początki Polski. Zagadki i tajemnice. Jak za pomocą urządzenia mobilnego zarządzać domem. 9 sprytnych zastosowań folii aluminiowej. Jak skutecznie wyczyścić
PubMed journal article S-adenosylhomocysteine and polyunsaturated fatty acid metabolism in predementia syndromes and Alzheimers diseas were found in PRIME PubMed. Download Prime PubMed App to iPhone or iPad.
Reagents. AdoHcy hydrolase inhibitor DZ2002 was synthesized at Diazyme Laboratories (San Diego, CA). OVA (grade V), dimethyl sulfoxide (DMSO), acetonitrile, AdoHcy, Ado, Hcy, Ado deaminase inhibitor erythro-9-(2-hydroxy-3-nonyl)-adenine hydrochloride, and 3,3′,5,5′-tetramethylbenzidine were supplied by Sigma-Aldrich (St. Louis, MO). Complete Freunds adjuvant (CFA) was purchased from Difco (Detroit, MI). RPMI 1640 medium was purchased from Gibco BRL/Life Technologies Inc. (Gaithersburg, MD), and fetal calf serum (FCS) was obtained from Hyclone Laboratories (Logan, UT). [3H]Thymidine was provided by The Shanghai Institute of Applied Physics, Chinese Academy of Sciences (Shanghai, Peoples Republic of China). ELISA kits for IL-2, IFN-γ, and IL-4 were purchased from BD PharMingen (San Diego, CA). Rabbit anti-mouse IgG, IgG1, IgG2a, or IgG3 antibodies labeled with horseradish peroxidase were purchased from Bio-Rad (Hercules, CA).. Animals. Male C57BL/6 mice, aged 6 to 8 weeks, were purchased ...
In BR biosynthesis, Fujioka and Sakurai (1997b) have demonstrated that there are at least two branched biochemical pathways to the end product BL (Figure 1; Fujioka and Sakurai, 1997a, 1997b; Sakurai and Fujioka, 1997). Depending on the oxidation state of C-6, they are referred to as the early or late C-6 oxidation pathways. In the early pathway, the C-6 is oxidized to a ketone at campestanol (CN), whereas in the late pathway it is oxidized at 6-deoxocastasterone (6-deoxoCS). Otherwise, the two pathways share equivalent reactions. Our results from the experiments with the available BR intermediates clearly demonstrate that dwf4 is defective in the 22α-hydroxylation steps in each of the pathways. Application of all 22α-hydroxylated intermediates in these pathways, such as CT and 6-deoxoCT, cause dramatic elongation of dwf4 plants, but compounds not hydroxylated at C-22 had no effect. This result also suggests that DWF4 recognizes at least two substrates: CN and 6-oxoCN. It seems reasonable to ...
SWISS-MODEL Repository entry for A1TUG3 (SAHH_ACIAC), Adenosylhomocysteinase. Acidovorax citrulli (strain AAC00-1) (Acidovorax avenae subsp citrulli)
Catalysis of the reaction: S-adenosyl-L-methionine + protein L-beta-aspartate = S-adenosyl-L-homocysteine + protein L-beta-aspartate methyl ester.
|p|3-Deazaneplanocin A (DZNep) hydrochloride is a selective inhibitor of ENZ2 inhibitor with IC50 value of 0.08-0.24 μM [1].|br /|ENZ2 is a sub-unit of PRC2 and plays an important role in regulating cell proliferation and cell-cycle progression. It has
Furthermore, we propose that the beat-induced periodic EEG response identified in the present study may constitute a direct correlate of the actual mechanism through which attentional and perceptual processes are dynamically modulated as a function of time. Indeed, the responsiveness of the neuronal population that is entrained to the beat may be expected to vary according to the phase of the beat-induced cycle. Most importantly, this hypothesis would account for the previous observations that event-related potentials elicited at different time points relative to the beat or meter cycle exhibit differences in amplitude (Brochard et al., 2003; Snyder and Large, 2005; Pablos Martin et al., 2007; Grube and Griffiths, 2009; Iversen et al., 2009; Fujioka et al., 2010; Schaefer et al., 2011). Indeed, several electrophysiological studies in primates including humans have suggested that when the activity of a neuronal population synchronizes at a given frequency, the phase of the induced oscillations ...
Kon, S., Ishibashi, K., Katoh, H., Kitamoto, S., Shirai, T., Tanaka, S., Kajita, M., Ishikawa, S., Yamauchi, H., Yako, Y., Kamasaki, T., Matsumoto, T., Watanabe, H., Egami, R., Sasaki, A., Nishikawa, A., Kameda, I., Maruyama, T., Narumi, R., Morita, T. および19人, Sasaki, Y., Enoki, R., Honma, S., Imamura, H., Oshima, M., Soga, T., Miyazaki, J. I., Duchen, M. R., Nam, J. M., Onodera, Y., Yoshioka, S., Kikuta, J., Ishii, M., Imajo, M., Nishida, E., Fujioka, Y., Ohba, Y., Sato, T. & Fujita, Y., 2017 5 1, : : Nature Cell Biology. 19, 5, p. 530-541 12 p.. 研究成果: Article ...
Do rýchleho výstražného systému pre nepotravinárske výrobky RAPEX nahlásili nebezpečné výrobky v Španielsku a Taliansku. Môžu sa nachádzať aj na Slovensku.. Ide o dva výrobky. Prvým je šumivá bomba do kúpeľa Bomba de Bańo Efervescente y Karité, značka Deunapieza. Výrobok pripomína potravinu, čo je v rozpore s európskym nariadením.. Ďalším je farba na tetovanie Strong black značky Biotek. Vo výrobku sa zistilo prekročené povolené množstvo látok benzo(a)pyrene a polycyklických aromatických uhľovodíkov.. ...
Pri používaní tejto stránky dochádza k spracovaniu cookies, ktoré nám pomáhajú zvyšovať kvalitu služieb. Spracovaniu cookies zabránite zmenou nastavenia v internetovom prehliadači ...
Adenosylhomocysteinase cysteine. Methionine can be regenerated from homocysteine via (4) methionine synthase in a reaction that ...
This enzyme belongs to the family of hydrolases, specifically those acting on ether bonds (ether hydrolases). The systematic name of this enzyme class is (7E,9E,11Z,14Z)-(5S,6S)-5,6-epoxyicosa-7,9,11,14-tetraenoate hydrolase. Other names in common use include LTA4 hydrolase, LTA4H, and leukotriene A4 hydrolase. This enzyme participates in arachidonic acid metabolism. ...
Guranowski, Andrzej; Pawelkiewicz, Jerzy (1977). "Adenosylhomocysteinase from Yellow Lupin Seeds. Purification and Properties ...
Adenosylhomocysteinase converts SAH into homocysteine and adenosine. Finkelstein, J. D. (2000). "Pathways and regulation of ...
Putative adenosylhomocysteinase 2 is an enzyme that in humans is encoded by the AHCYL1 gene. AHCYL1 has been shown to interact ...
... may refer to: Adenosylhomocysteinase, an enzyme Adenosylhomocysteine nucleosidase, an enzyme ...
... adenosylhomocysteinase EC adenosylmethionine hydrolase EC now EC EC isochorismatase EC 3.3 ...
... at the US National Library of Medicine Medical Subject Headings (MeSH) Biology portal. ... Palmer JL, Abeles RH (February 1979). "The mechanism of action of S-adenosylhomocysteinase". The Journal of Biological ... Adenosylhomocysteinase (EC, S-adenosylhomocysteine synthase, S-adenosylhomocysteine hydrolase, adenosylhomocysteine ... hydrolase, S-adenosylhomocysteinase, SAHase, AdoHcyase) is an enzyme that converts S-adenosylhomocysteine to homocysteine and ...
Adenosylhomocysteinase. *regeneration of methionine: Methionine synthase/Homocysteine methyltransferase. *Betaine-homocysteine ...
Adenosylhomocysteinase. *regeneration of methionine: Methionine synthase/Homocysteine methyltransferase. *Betaine-homocysteine ...
Adenosylhomocysteinase. *regeneration of methionine: Methionine synthase/Homocysteine methyltransferase. *Betaine-homocysteine ...
Adenosylhomocysteinase. *regeneration of methionine: Methionine synthase/Homocysteine methyltransferase. *Betaine-homocysteine ...
Adenosylhomocysteinase. *regeneration of methionine: Methionine synthase/Homocysteine methyltransferase. *Betaine-homocysteine ...
Adenosylhomocysteinase. *regeneration of methionine: Methionine synthase/Homocysteine methyltransferase. *Betaine-homocysteine ...
Adenosylhomocysteinase at the US National Library of Medicine Medical Subject Headings (MeSH) Biology portal. ... Palmer JL, Abeles RH (February 1979). "The mechanism of action of S-adenosylhomocysteinase". The Journal of Biological ... Adenosylhomocysteinase (EC, S-adenosylhomocysteine synthase, S-adenosylhomocysteine hydrolase, adenosylhomocysteine ... hydrolase, S-adenosylhomocysteinase, SAHase, AdoHcyase) is an enzyme that converts S-adenosylhomocysteine to homocysteine and ...
Adenosylhomocysteinase. P23526. Details. Drug Relations. Drug Relations. DrugBank ID. Name. Drug group. Pharmacological action? ... Adenosylhomocysteinase. Kind. protein. Organism. Humans. Protein. Name. UniProt ID. ...
Compare adenosylhomocysteinase like 1 ELISA Kits from leading suppliers on Biocompare. View specifications, prices, citations, ... adenosylhomocysteinase like 1 ELISA Kits. The ELISA (enzyme-linked immunosorbent assay) is a well-established antibody-based ... Your search returned 5 adenosylhomocysteinase like 1 ELISA ELISA Kit across 4 suppliers. ...
Putative adenosylhomocysteinase 3. Putative adenosylhomocysteinase 3, AdoHcyase 3, EC (Long-IRBIT) (S-adenosyl-L- ... Putative adenosylhomocysteinase 3Imported. ,p>Information which has been imported from another database using automatic ... tr,H3BLA5,H3BLA5_MOUSE Putative adenosylhomocysteinase 3 (Fragment) OS=Mus musculus OX=10090 GN=Ahcyl2 PE=1 SV=1 ...
Putative adenosylhomocysteinase 3. Putative adenosylhomocysteinase 3, AdoHcyase 3, EC (Long-IRBIT) (S-adenosyl-L- ... IPR000043 Adenosylhomocysteinase-like. IPR015878 Ado_hCys_hydrolase_NAD-bd. IPR036291 NAD(P)-bd_dom_sf. IPR020082 S-Ado-L- ... IPR000043 Adenosylhomocysteinase-like. IPR015878 Ado_hCys_hydrolase_NAD-bd. IPR036291 NAD(P)-bd_dom_sf. IPR020082 S-Ado-L- ... Putative adenosylhomocysteinase 3Imported. ,p>Information which has been imported from another database using automatic ...
Rabbit Polyclonal Anti-Adenosylhomocysteinase/AHCY Antibody. Validated: WB, ICC/IF, IHC, IHC-P. Tested Reactivity: Human, Mouse ... Blogs on Adenosylhomocysteinase/AHCY. There are no specific blogs for Adenosylhomocysteinase/AHCY, but you can read our latest ... Additional Adenosylhomocysteinase/AHCY Products. Array NBP2-48817 * Adenosylhomocysteinase/AHCY Antibodies. * ... Reviews for Adenosylhomocysteinase/AHCY Antibody (NBP2-48817) (0) There are no reviews for Adenosylhomocysteinase/AHCY Antibody ...
ENCODES a protein that exhibits adenosylhomocysteinase activity (inferred); identical protein binding (inferred); INVOLVED IN ... adenosylhomocysteinase activity enables. IEA. InterPro:IPR020082. 13508589. InterPro. GO_REF:0000002. identical protein binding ... Ahcyl1 (adenosylhomocysteinase like 1). Transitive Ortholog Pipeline. Transitive Ortholog Pipeline. Sus scrofa (pig):. AHCYL1 ( ... adenosylhomocysteinase activity NOT,enables. IBA. PANTHER:PTN000602759, PANTHER:PTN001158976. 13508589. PMID:21873635. GO_ ...
... ase S adenosyl homocysteine hydrolase SAHH - - Product ... ACHY, NT (Adenosylhomocysteinase, AdoHcyase, S-adenosyl-L-homocysteine hydrolase, SAHH) Suppplier: MyBioSource. Price: 727.81 ... ACHY, CT (Adenosylhomocysteinase, AdoHcyase, S-adenosyl-L-homocysteine hydrolase, SAHH) Suppplier: MyBioSource. Price: 727.81 ... AHCY Adenosylhomocysteinase AdoHcyase S adenosyl homocysteine hydrolase SAHH Suppplier: MBS Monoclonals. Price: 684.68 USD ...
AHCY adenosylhomocysteinase [ Homo sapiens ]. Synonyms:. AHCY; adenosylhomocysteinase; SAHH; S-adenosylhomocysteine hydrolase; ... Recombinant Human Adenosylhomocysteinase, His-tagged. Download Datasheet See All AHCY Products. Bring this labeled protein ... AHCY, also known as adenosylhomocysteinase, is an enzyme that catalyzes the reversible hydrolysis of S-adenosylhomocysteine ( ...
Human AHCY(Adenosylhomocysteinase) ELISA Kit quantity. Add to cart. This item is made to order and will take 10-12 business ...
This enzyme belongs to the family of hydrolases, specifically those acting on ether bonds (ether hydrolases). The systematic name of this enzyme class is (7E,9E,11Z,14Z)-(5S,6S)-5,6-epoxyicosa-7,9,11,14-tetraenoate hydrolase. Other names in common use include LTA4 hydrolase, LTA4H, and leukotriene A4 hydrolase. This enzyme participates in arachidonic acid metabolism. ...
AHCY: adenosylhomocysteinase. *AHDC1: AT-hook DNA binding motif containing 1. *AIP: aryl hydrocarbon receptor interacting ...
Adenosylhomocysteinase. Bradyrhizobium elkanii. Loading... A0M5W6 Adenosylhomocysteinase. Gramella forsetii (strain KT0803). ...
Adenosylhomocysteinase-like The name of this superfamily has been modified since the most recent official CATH+ release (v4_2_0 ... Adenosylhomocysteinase. [EC:] S-adenosyl-L-homocysteine + H(2)O = L-homocysteine + adenosine. ...
Adenosylhomocysteinase-like The name of this superfamily has been modified since the most recent official CATH+ release (v4_2_0 ... Superfamily: Adenosylhomocysteinase-like. Structural domains comprising this superfamily share the structure of the enzyme ... adenosylhomocysteinase (S-adenosyl-L-homocysteine hydrolase, AdoHcyase), which is formed in methylation and catalyses the ...
... cerevisiae Adenosylhomocysteinase Protein 100μg enQuireBio™ Recombinant S. cerevisiae Adenosylhomocysteinase... ... enQuireBio™ Recombinant S. cerevisiae Adenosylhomocysteinase Protein A DNA sequence encoding the Saccharomyces cerevisiae ( ... strain ATCC 204508 / S288c) (Bakers yeast) Adenosylhomocysteinase, was expressed in the hosts and tags indicated. ...
Adenosylhomocysteinase. Mycobacterium tuberculosis variant bovis BCG str Mexico ... Adenosylhomocysteinase UniProtKBInterProInteractive Modelling. 495 aa; Sequence (Fasta) 12 identical sequences 12 identical ... Adenosylhomocysteinase-like. IPR000043PF05221. 253-415. S-adenosyl-L-homocysteine hydrolase, NAD binding domain. IPR015878 ...
Adenosylhomocysteinase. Liver (Hg). [37]. Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial. Liver ...
K186 of adenosylhomocysteinase; K147 of ALDOA; K171 of glucose-6-phosphate 1-dehydrogenase; and K147 of glutamate dehydrogenase ...
Adenosylhomocysteinase. Acidovorax citrulli (strain AAC00-1) (Acidovorax avenae subsp citrulli) ... Adenosylhomocysteinase-like. IPR000043PF05221. 235-394. S-adenosyl-L-homocysteine hydrolase, NAD binding domain. IPR015878 ...
... adenosylhomocysteinase-like 1; MTR, 5-methyltetrahydrofolate-homocysteine methyltransferase; DNMT1, DNA (cytosine-5-)- ...
Adenosylhomocysteinase A (AHC1). 0.001. Unigene0038147. 5-Methyltetrahydropteroyltriglutamate-homocysteine methyltransferase ( ... In contrast, in the biosynthesis of ET, a series of genes corresponding to the met family, including adenosylhomocysteinase ( ...
S-Adenosylhomocysteine (AdoHcy) hydrolase regulates all adenosylmethionine-(AdoMet) dependent transmethylations by hydrolyzing the potent feedback inhibitor AdoHcy to homocysteine and adenosine. The crystallographic structure determination of a selenomethionyl-incorporated AdoHcy hydrolase inhibitor …
... adenosylhomocysteinase; MTR, 5-methyltetrahydrofolate-homocysteine methyltransferase; CBS, cystathionine-beta-synthase; CTH, ...
adenosylhomocysteinase 2. SD. standard deviation. SRPK. serine/arginine-rich protein kinase. SRSF1. serine/arginine-rich ... NIHSS: National Institutes of Health stroke scale; SBP: systolic blood pressure; SAHH2: adenosylhomocysteinase-2. Statistically ... adenosylhomocysteinase-2; Z-SRSF1: standardized values for serine/arginine-rich splicing factor-1. Statistically significant ... C with rabbit primary antibodies diluted in blocking buffer against adenosylhomocysteinase-2 (SAHH2 or AHCYL1, cat.#: ab178693 ...
Adenosylhomocysteinase cysteine. Methionine can be regenerated from homocysteine via (4) methionine synthase in a reaction that ...
... "adenosylhomocysteinase" FT /EC_number="" FT /note="KEGG: pol:Bpro_4132 adenosylhomocysteinase; TIGRFAM: FT ... adenosylhomocysteinase; PFAM: S-adenosyl-L-homocysteine FT hydrolase; TrkA-N domain protein" FT /db_xref="EnsemblGenomes-Gn: ...
YER043C SAH1; adenosylhomocysteinase YER170W ADK2; adenylate kinase ADK2 YDR226W ADK1; adenylate kinase ADK1 YML022W APT1; ... adenosylhomocysteinase [EC:] K00939 adk; adenylate kinase [EC:] K00939 adk; adenylate kinase [EC:] K00759 ...
AHCY: adenosylhomocysteinase. *AHDC1: AT-hook DNA binding motif containing 1. *AIP: aryl hydrocarbon receptor interacting ...
AHCYL2; adenosylhomocysteinase like 2 [KO:K01251] [EC:]. 10768 AHCYL1; adenosylhomocysteinase like 1 [KO:K01251] [EC:3.3 ... AHCY; adenosylhomocysteinase [KO:K01251] [EC:]. 587 BCAT2; branched chain amino acid transaminase 2 [KO:K00826] [EC:2.6. ...
  • Western Blot: Adenosylhomocysteinase/AHCY Antibody [NBP2-48817] - Analysis using Anti-AHCY antibody NBP2-48817 (A) shows similar pattern to independent antibody NBP2-48731 (B). (
  • Immunocytochemistry/ Immunofluorescence: Adenosylhomocysteinase/AHCY Antibody [NBP2-48817] - Staining of human cell line CACO-2 shows localization to cytosol. (
  • Immunohistochemistry-Paraffin: Adenosylhomocysteinase/AHCY Antibody [NBP2-48817] - Staining of human kidney shows strong cytoplasmic and nuclear positivity in cells in tubules. (
  • Specificity of human Adenosylhomocysteinase/AHCY antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. (
  • AHCY, also known as adenosylhomocysteinase, is an enzyme that catalyzes the reversible hydrolysis of S-adenosylhomocysteine (AdoHcy) to adenosine (Ado) and L-homocysteine (Hcy). (
  • Here, we show that adenosylhomocysteinase (AHCY), an important enzyme in the methionine cycle, is critical for the maintenance and differentiation of mouse embryonic stem cells (mESCs). (
  • Among 30 upregulated and 73 downregulated genes, upregulation of fermitin family member 1 ( FERMT1 ), adenosylhomocysteinase ( AHCY ), secernin 1 ( SCRN1 ), and SAC3 domain-containing protein 1 ( SAC3D1 ) expression and downregulation of IgJ and MALL expression in colon cancer were confirmed by quantitative PCR. (
  • Pan troglodytes adenosylhomocysteinase like 1 (AHCYL1), transcript variant X1, mRNA. (
  • Canis lupus familiaris adenosylhomocysteinase like 1 (AHCYL1), transcript variant X1, mRNA. (
  • Adenosylhomocysteinase (EC, S-adenosylhomocysteine synthase, S-adenosylhomocysteine hydrolase, adenosylhomocysteine hydrolase, S-adenosylhomocysteinase, SAHase, AdoHcyase) is an enzyme that converts S-adenosylhomocysteine to homocysteine and adenosine. (
  • Structural domains comprising this superfamily share the structure of the enzyme adenosylhomocysteinase (S-adenosyl-L-homocysteine hydrolase, AdoHcyase), which is formed in methylation and catalyses the reversible hydration of S-adenosyl-L-homocysteine into adenosine and homocysteine. (
  • S-adenosylhomocysteine hydrolase belongs to the adenosylhomocysteinase family. (
  • 9-β- d -Arabinofuranosyladenine (ara-A), 9-β- d -arabinofuranosyladenine 5′-monophosphate, and 9-β- d -arabinofuranosyladenine 5′-triphosphate competitively inhibit both the synthesis and hydrolysis of S -adenosylhomocysteine catalyzed by S -adenosylhomocysteinase [ S -adenosylhomocysteine hydrolase (EC (
  • Your search returned 5 adenosylhomocysteinase like 1 ELISA ELISA Kit across 4 suppliers. (
  • A study on the sequestration of adenosine and its conversion to adenine by the cyclic AMP-adenosine binding protein/S-adenosylhomocysteinase from mouse liver. (
  • Conclusion: Compared to controls, methionine metabolism including S -adenosylhomocysteinase gene expression is persistently different in the tx-j mice with consequent alterations in global DNA methylation in more advanced stages of liver disease. (
  • The inhibitory effect of copper accumulation on S -adenosylhomocysteinase expression is associated with progressively abnormal methionine metabolism and decreased methylation capacity and DNA global methylation. (
  • A DNA sequence encoding the Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Adenosylhomocysteinase, was expressed in the hosts and tags indicated. (
  • 3) adenosylhomocysteinase converts SAH to homocysteine . (
  • S -adenosylhomocysteinase transcript levels were significantly lower at all time points, except at three weeks, correlating negatively with copper levels and with consequent changes in the SAM:SAH methylation ratio and global DNA methylation. (