AnatomyOrganismsDiseasesChemicals and DrugsAnalytical, Diagnostic and Therapeutic Techniques and EquipmentDisciplines and OccupationsInformation ScienceHealth Care
Adenosine TriphosphatasesMagnesiumAdenosineAcid Anhydride HydrolasesReceptor, Adenosine A2ANucleoside-TriphosphataseReceptor, Adenosine A1Adenosine Deaminaserac GTP-Binding ProteinsReceptor, Adenosine A3GTP PhosphohydrolasesReceptor, Adenosine A2BAdenosine Kinasecdc42 GTP-Binding ProteinReceptors, Adenosine A2Adenosine A2 Receptor Agonistsrho GTP-Binding ProteinsAdenosine A2 Receptor AntagonistsReceptors, Purinergic P1Adenosine A1 Receptor Antagonistsrac1 GTP-Binding ProteinAdenosine A1 Receptor AgonistsNucleotidyltransferasesPurinergic P1 Receptor AntagonistsGuanine Nucleotide Exchange FactorsXanthinesPurinergic P1 Receptor AgonistsAdenosine MonophosphateHypertrophyAngiotensin IIMuscle, Smooth, VascularMyocytes, Smooth MuscleCells, CulturedSodium-Potassium-Exchanging ATPaseMuscle, SmoothGymnotiformesElectric FishElectric OrganCa(2+) Mg(2+)-ATPaseOuabainHistocytochemistryElectronic MailOligomycinsSubmitochondrial ParticlesProton-Translocating ATPasesAccounts Payable and ReceivableErythrocyte MembraneErythrocytesPeriodicals as TopicJournal Impact FactorPublishing
Adenosine Triphosphatases
A group of enzymes which catalyze the hydrolysis of ATP. The hydrolysis reaction is usually coupled with another function such as transporting Ca(2+) across a membrane. These enzymes may be dependent on Ca(2+), Mg(2+), anions, H+, or DNA.
Magnesium
A metallic element that has the atomic symbol Mg, atomic number 12, and atomic weight 24.31. It is important for the activity of many enzymes, especially those involved in OXIDATIVE PHOSPHORYLATION.
Adenosine
A nucleoside that is composed of ADENINE and D-RIBOSE. Adenosine or adenosine derivatives play many important biological roles in addition to being components of DNA and RNA. Adenosine itself is a neurotransmitter.
Acid Anhydride Hydrolases
A group of enzymes that catalyze the hydrolysis of diphosphate bonds in compounds such as nucleoside di- and tri-phosphates, and sulfonyl-containing anhydrides such as adenylylsulfate. (Enzyme Nomenclature, 1992) EC 3.6.
Receptor, Adenosine A2A
A subclass of adenosine A2 receptors found in LEUKOCYTES, the SPLEEN, the THYMUS and a variety of other tissues. It is generally considered to be a receptor for ADENOSINE that couples to the GS, STIMULATORY G-PROTEIN.
Nucleoside-Triphosphatase
An enzyme which catalyzes the hydrolysis of nucleoside triphosphates to nucleoside diphosphates. It may also catalyze the hydrolysis of nucleotide triphosphates, diphosphates, thiamine diphosphates and FAD. The nucleoside triphosphate phosphohydrolases I and II are subtypes of the enzyme which are found mostly in viruses.
Receptor, Adenosine A1
A subtype of ADENOSINE RECEPTOR that is found expressed in a variety of tissues including the BRAIN and DORSAL HORN NEURONS. The receptor is generally considered to be coupled to the GI, INHIBITORY G-PROTEIN which causes down regulation of CYCLIC AMP.
Adenosine Deaminase
An enzyme that catalyzes the hydrolysis of ADENOSINE to INOSINE with the elimination of AMMONIA.
rac GTP-Binding Proteins
A sub-family of RHO GTP-BINDING PROTEINS that is involved in regulating the organization of cytoskeletal filaments. This enzyme was formerly listed as EC 3.6.1.47.
Receptor, Adenosine A3
A subtype of ADENOSINE RECEPTOR that is found expressed in a variety of locations including the BRAIN and endocrine tissues. The receptor is generally considered to be coupled to the GI, INHIBITORY G-PROTEIN which causes down regulation of CYCLIC AMP.
GTP Phosphohydrolases
Enzymes that hydrolyze GTP to GDP. EC 3.6.1.-.
Receptor, Adenosine A2B
A subclass of adenosine A2 receptors found in the CECUM, the COLON, the BLADDER, and a variety of other tissues. It is generally considered to be a low affinity receptor for ADENOSINE that couples to the GS, STIMULATORY G-PROTEIN.
Adenosine Kinase
An enzyme that catalyzes the formation of ADP plus AMP from adenosine plus ATP. It can serve as a salvage mechanism for returning adenosine to nucleic acids. EC 2.7.1.20.
cdc42 GTP-Binding Protein
A member of the Rho family of MONOMERIC GTP-BINDING PROTEINS. It is associated with a diverse array of cellular functions including cytoskeletal changes, filopodia formation and transport through the GOLGI APPARATUS. This enzyme was formerly listed as EC 3.6.1.47.
Receptors, Adenosine A2
A subclass of ADENOSINE RECEPTORS that are generally considered to be coupled to the GS, STIMULATORY G-PROTEIN which causes up regulation of CYCLIC AMP.
Adenosine A2 Receptor Agonists
Compounds that selectively bind to and activate ADENOSINE A2 RECEPTORS.
rho GTP-Binding Proteins
A large family of MONOMERIC GTP-BINDING PROTEINS that are involved in regulation of actin organization, gene expression and cell cycle progression. This enzyme was formerly listed as EC 3.6.1.47.
Adenosine A2 Receptor Antagonists
Compounds that selectively bind to and block the activation of ADENOSINE A2 RECEPTORS.
Receptors, Purinergic P1
A class of cell surface receptors that prefer ADENOSINE to other endogenous PURINES. Purinergic P1 receptors are widespread in the body including the cardiovascular, respiratory, immune, and nervous systems. There are at least two pharmacologically distinguishable types (A1 and A2, or Ri and Ra).
Adenosine A1 Receptor Antagonists
Compounds that bind to and block the stimulation of ADENOSINE A1 RECEPTORS.
rac1 GTP-Binding Protein
A rac GTP-binding protein involved in regulating actin filaments at the plasma membrane. It controls the development of filopodia and lamellipodia in cells and thereby influences cellular motility and adhesion. It is also involved in activation of NADPH OXIDASE. This enzyme was formerly listed as EC 3.6.1.47.
Adenosine A1 Receptor Agonists
Compounds that bind to and stimulate ADENOSINE A1 RECEPTORS.
Nucleotidyltransferases
A class of enzymes that transfers nucleotidyl residues. EC 2.7.7.
Purinergic P1 Receptor Antagonists
Compounds that bind to and block the stimulation of PURINERGIC P1 RECEPTORS.
Guanine Nucleotide Exchange Factors
Protein factors that promote the exchange of GTP for GDP bound to GTP-BINDING PROTEINS.
Xanthines
Purine bases found in body tissues and fluids and in some plants.
Purinergic P1 Receptor Agonists
Compounds that bind to and stimulate PURINERGIC P1 RECEPTORS.
Adenosine Monophosphate
Adenine nucleotide containing one phosphate group esterified to the sugar moiety in the 2'-, 3'-, or 5'-position.
Hypertrophy
General increase in bulk of a part or organ due to CELL ENLARGEMENT and accumulation of FLUIDS AND SECRETIONS, not due to tumor formation, nor to an increase in the number of cells (HYPERPLASIA).
Angiotensin II
An octapeptide that is a potent but labile vasoconstrictor. It is produced from angiotensin I after the removal of two amino acids at the C-terminal by ANGIOTENSIN CONVERTING ENZYME. The amino acid in position 5 varies in different species. To block VASOCONSTRICTION and HYPERTENSION effect of angiotensin II, patients are often treated with ACE INHIBITORS or with ANGIOTENSIN II TYPE 1 RECEPTOR BLOCKERS.
Muscle, Smooth, Vascular
The nonstriated involuntary muscle tissue of blood vessels.
Myocytes, Smooth Muscle
Non-striated, elongated, spindle-shaped cells found lining the digestive tract, uterus, and blood vessels. They are derived from specialized myoblasts (MYOBLASTS, SMOOTH MUSCLE).
Cells, Cultured
Cells propagated in vitro in special media conducive to their growth. Cultured cells are used to study developmental, morphologic, metabolic, physiologic, and genetic processes, among others.
Sodium-Potassium-Exchanging ATPase
An enzyme that catalyzes the active transport system of sodium and potassium ions across the cell wall. Sodium and potassium ions are closely coupled with membrane ATPase which undergoes phosphorylation and dephosphorylation, thereby providing energy for transport of these ions against concentration gradients.
Muscle, Smooth
Unstriated and unstriped muscle, one of the muscles of the internal organs, blood vessels, hair follicles, etc. Contractile elements are elongated, usually spindle-shaped cells with centrally located nuclei. Smooth muscle fibers are bound together into sheets or bundles by reticular fibers and frequently elastic nets are also abundant. (From Stedman, 25th ed)
Gymnotiformes
An order of neotropical electric fish found chiefly in the waters of South America. They continually emit weak electric discharges, which they use in object location and communication. A most popular species of research interest is the electric eel, ELECTROPHORUS electricus.
Electric Fish
Fishes which generate an electric discharge. The voltage of the discharge varies from weak to strong in various groups of fish. The ELECTRIC ORGAN and electroplax are of prime interest in this group. They occur in more than one family.
Electric Organ
In about 250 species of electric fishes, modified muscle fibers forming disklike multinucleate plates arranged in stacks like batteries in series and embedded in a gelatinous matrix. A large torpedo ray may have half a million plates. Muscles in different parts of the body may be modified, i.e., the trunk and tail in the electric eel, the hyobranchial apparatus in the electric ray, and extrinsic eye muscles in the stargazers. Powerful electric organs emit pulses in brief bursts several times a second. They serve to stun prey and ward off predators. A large torpedo ray can produce of shock of more than 200 volts, capable of stunning a human. (Storer et al., General Zoology, 6th ed, p672)
Ca(2+) Mg(2+)-ATPase
Ouabain
A cardioactive glycoside consisting of rhamnose and ouabagenin, obtained from the seeds of Strophanthus gratus and other plants of the Apocynaceae; used like DIGITALIS. It is commonly used in cell biological studies as an inhibitor of the NA(+)-K(+)-EXCHANGING ATPASE.
Histocytochemistry
Study of intracellular distribution of chemicals, reaction sites, enzymes, etc., by means of staining reactions, radioactive isotope uptake, selective metal distribution in electron microscopy, or other methods.
Electronic Mail
Messages between computer users via COMPUTER COMMUNICATION NETWORKS. This feature duplicates most of the features of paper mail, such as forwarding, multiple copies, and attachments of images and other file types, but with a speed advantage. The term also refers to an individual message sent in this way.
Oligomycins
A closely related group of toxic substances elaborated by various strains of Streptomyces. They are 26-membered macrolides with lactone moieties and double bonds and inhibit various ATPases, causing uncoupling of phosphorylation from mitochondrial respiration. Used as tools in cytochemistry. Some specific oligomycins are RUTAMYCIN, peliomycin, and botrycidin (formerly venturicidin X).
Submitochondrial Particles
The various filaments, granules, tubules or other inclusions within mitochondria.
Proton-Translocating ATPases
Multisubunit enzymes that reversibly synthesize ADENOSINE TRIPHOSPHATE. They are coupled to the transport of protons across a membrane.
Accounts Payable and Receivable
Short-term debt obligations and assets occurring in the regular course of operational transactions.
Erythrocyte Membrane
The semi-permeable outer structure of a red blood cell. It is known as a red cell 'ghost' after HEMOLYSIS.
Erythrocytes
Red blood cells. Mature erythrocytes are non-nucleated, biconcave disks containing HEMOGLOBIN whose function is to transport OXYGEN.
Periodicals as Topic
A publication issued at stated, more or less regular, intervals.
Journal Impact Factor
A quantitative measure of the frequency on average with which articles in a journal have been cited in a given period of time.
Publishing
"The business or profession of the commercial production and issuance of literature" (Webster's 3d). It includes the publisher, publication processes, editing and editors. Production may be by conventional printing methods or by electronic publishing.

Membrane deinsertion of SecA underlying proton motive force-dependent stimulation of protein translocation. (1/12201)

The proton motive force (PMF) renders protein translocation across the Escherichia coli membrane highly efficient, although the underlying mechanism has not been clarified. The membrane insertion and deinsertion of SecA coupled to ATP binding and hydrolysis, respectively, are thought to drive the translocation. We report here that PMF significantly decreases the level of membrane-inserted SecA. The prlA4 mutation of SecY, which causes efficient protein translocation in the absence of PMF, was found to reduce the membrane-inserted SecA irrespective of the presence or absence of PMF. The PMF-dependent decrease in the membrane-inserted SecA caused an increase in the amount of SecA released into the extra-membrane milieu, indicating that PMF deinserts SecA from the membrane. The PMF-dependent deinsertion reduced the amount of SecA required for maximal translocation activity. Neither ATP hydrolysis nor exchange with external SecA was required for the PMF-dependent deinsertion of SecA. These results indicate that the SecA deinsertion is a limiting step of protein translocation and is accelerated by PMF, efficient protein translocation thereby being caused in the presence of PMF.  (+info)

Stable remodeling of tailless nucleosomes by the human SWI-SNF complex. (2/12201)

The histone N-terminal tails have been shown previously to be important for chromatin assembly, remodeling, and stability. We have tested the ability of human SWI-SNF (hSWI-SNF) to remodel nucleosomes whose tails have been cleaved through a limited trypsin digestion. We show that hSWI-SNF is able to remodel tailless mononucleosomes and nucleosomal arrays, although hSWI-SNF remodeling of tailless nucleosomes is less effective than remodeling of nucleosomes with tails. Analogous to previous observations with tailed nucleosomal templates, we show both (i) that hSWI-SNF-remodeled trypsinized mononucleosomes and arrays are stable for 30 min in the remodeled conformation after removal of ATP and (ii) that the remodeled tailless mononucleosome can be isolated on a nondenaturing acrylamide gel as a novel species. Thus, nucleosome remodeling by hSWI-SNF can occur via interactions with a tailless nucleosome core.  (+info)

Arginine methylation and binding of Hrp1p to the efficiency element for mRNA 3'-end formation. (3/12201)

Hrp1p is a heterogeneous ribonucleoprotein (hnRNP) from the yeast Saccharomyces cerevisiae that is involved in the cleavage and polyadenylation of the 3'-end of mRNAs and mRNA export. In addition, Hrplp is one of several RNA-binding proteins that are posttranslationally modified by methylation at arginine residues. By using functional recombinant Hrp1p, we have identified RNA sequences with specific high affinity binding sites. These sites correspond to the efficiency element for mRNA 3'-end formation, UAUAUA. To examine the effect of methylation on specific RNA binding, purified recombinant arginine methyltransferase (Hmt1p) was used to methylate Hrp1p. Methylated Hrp1p binds with the same affinity to UAUAUA-containing RNAs as unmethylated Hrpl p indicating that methylation does not affect specific RNA binding. However, RNA itself inhibits the methylation of Hrp1p and this inhibition is enhanced by RNAs that specifically bind Hrpl p. Taken together, these data support a model in which protein methylation occurs prior to protein-RNA binding in the nucleus.  (+info)

The Golgi apparatus plays a significant role in the maintenance of Ca2+ homeostasis in the vps33Delta vacuolar biogenesis mutant of Saccharomyces cerevisiae. (4/12201)

The vacuole is the major site of intracellular Ca2+ storage in yeast and functions to maintain cytosolic Ca2+ levels within a narrow physiological range. In this study, we examined how cellular Ca2+ homeostasis is maintained in a vps33Delta vacuolar biogenesis mutant. We found that growth of the vps33Delta strain was sensitive to high or low extracellular Ca2+. This strain could not properly regulate cytosolic Ca2+ levels and was able to retain only a small fraction of its total cellular Ca2+ in a nonexchangeable intracellular pool. Surprisingly, the vps33Delta strain contained more total cellular Ca2+ than the wild type strain. Because most cellular Ca2+ is normally found within the vacuole, this suggested that other intracellular compartments compensated for the reduced capacity to store Ca2+ within the vacuole of this strain. To test this hypothesis, we examined the contribution of the Golgi-localized Ca2+ ATPase Pmr1p in the maintenance of cellular Ca2+ homeostasis. We found that a vps33Delta/pmr1Delta strain was hypersensitive to high extracellular Ca2+. In addition, certain combinations of mutations effecting both vacuolar and Golgi Ca2+ transport resulted in synthetic lethality. These results indicate that the Golgi apparatus plays a significant role in maintaining Ca2+ homeostasis when vacuolar biogenesis is compromised.  (+info)

Deletion mutation analysis of the mutS gene in Escherichia coli. (5/12201)

The MutS protein is part of the dam-directed MutHLS mismatch repair pathway in Escherichia coli. We have constructed deletion derivatives in the mutS gene, which retain the P-loop coding region for ATP binding. The mutant proteins were assayed for ATP hydrolysis, heteroduplex DNA binding, heterodimer MutS formation, and the ability to interact with MutL. Dimerization was assayed by expressing His6-tagged wild-type and non-tagged deletion mutant proteins in the same cell and isolating the His6-tagged protein followed by MutS immunoblotting after SDS-polyacrylamide gel electrophoresis. MutS-MutL interaction was measured using the same technique except that the MutL protein carried the His6 tag. Our results indicate that DNA binding ability resides in the N-terminal end of MutS, and dimerization and MutL interactions are located in the C-terminal end. Given the extensive amino acid homology in the MutS family our results with E. coli should be applicable to MutS homologues in other prokaryotes and eukaryotes.  (+info)

Evolutionary dynamics of a mitochondrial rearrangement "hot spot" in the Hymenoptera. (6/12201)

The arrangement of tRNA genes at the junction of the cytochrome oxidase II and ATPase 8 genes was examined across a broad range of Hymenoptera. Seven distinct arrangements of tRNA genes were identified among a group of wasps that have diverged over the last 180 Myr (suborder Apocrita); many of the rearrangements represent evolutionarily independent events. Approximately equal proportions of local rearrangements, inversions, and translocations were observed, in contrast to vertebrate mitochondria, in which local rearrangements predominate. Surprisingly, homoplasy was evident among certain types of rearrangement; a reversal of the plesiomorphic gene order has arisen on three separate occasions in the Insecta, while the tRNA(H) gene has been translocated to this locus on two separate occasions. Phylogenetic analysis indicates that this gene translocation is real and is not an artifactual translocation resulting from the duplication of a resident tRNA gene followed by mutation of the anticodon. The nature of the intergenic sequences surrounding this region does not indicate that it should be especially prone to rearrangement; it does not generally have the tandem or inverted repeats that might facilitate this plasticity. Intriguingly, these findings are consistent with the view that during the evolution of the Hymenoptera, rearrangements increased at the same time that the rate of point mutations and compositional bias also increased. This association may direct investigations into mitochondrial genome plasticity in other invertebrate lineages.  (+info)

Characterisation of copper-binding to the second sub-domain of the Menkes protein ATPase (MNKr2). (7/12201)

The Menkes ATPase (MNK) has an essential role in the translocation of copper across cellular membranes. In a complementary manner, the intracellular concentration of copper regulates the activity and cellular location of the ATPase through its six homologous amino-terminal domains. The roles of the six amino-terminal domains in the activation and cellular trafficking processes are unknown. Understanding the role of these domains relies on the development of an understanding of their metal-binding properties and structural properties. The second conserved sub-domain of MNK was over-expressed, purified and its copper-binding properties characterised. Reconstitution studies demonstrate that copper binds to MNKr2 as Cu(I) with a stoichiometry of one copper per domain. This is the first direct evidence of copper-binding to the MNK amino-terminal repeats. Circular dichroism studies suggest that the binding or loss of copper to MNKr2 does not cause substantial changes to the secondary structure of the protein.  (+info)

The interaction of the human MutL homologues in hereditary nonpolyposis colon cancer. (8/12201)

Germline mutations in two human mismatch repair (MMR) genes, hMSH2 and hMLH1, appear to account for approximately 70% of the common cancer susceptibility syndrome hereditary nonpolyposis colorectal cancer (HNPCC). Although the hMLH1 protein has been found to copurify with another MMR protein hPMS2 as a heterodimer, their function in MMR is unknown. In this study, we have identified the physical interaction regions of both hMLH1 with hPMS2. We then examined the effects of hMLH1 missense alterations found in HNPCC kindreds for their interaction with hPMS2. Four of these missense alterations (L574P, K616Delta, R659P, and A681T) displayed >95% reduction in binding to hPMS2. Two additional missense alterations (K618A and K618T) displayed a >85% reduction in binding to hPMS2, whereas three missense alterations (S44F, V506A, and E578G) displayed 25-65% reduction in binding to hPMS2. Interestingly, two HNPCC missense alterations (Q542L and L582V) contained within the consensus interaction region displayed no effect on interaction with hPMS2, suggesting that they may affect other functions of hMLH1. These data confirm that functional deficiencies in the interaction of hMLH1 with hPMS2 are associated with HNPCC as well as suggest that other unknown functional alteration of the human MutL homologues may lead to tumorigenesis in HNPCC kindreds.  (+info)

Interactions of Phospholipids with Sodium-plus-Potassium Ion-Dependent Adenosine Triphosphatase | Biochemical Society...Interactions of Phospholipids with Sodium-plus-Potassium Ion-Dependent Adenosine Triphosphatase | Biochemical Society...
MARTA ISERN DE CALDENTEY, KENNETH P. WHEELER; Interactions of Phospholipids with Sodium-plus-Potassium Ion-Dependent Adenosine Triphosphatase. Biochem Soc Trans 1 February 1977; 5 (1): 107-108. doi: https://doi.org/10.1042/bst0050107. Download citation file:. ...
https://portlandpress.com/biochemsoctrans/article-abstract/5/1/107/89034/Interactions-of-Phospholipids-with-Sodium-plus?redirectedFrom=fulltext
Vectorial aspects of adenosine-triphosphatase activity in erythrocyte membranes | Biochemical JournalVectorial aspects of adenosine-triphosphatase activity in erythrocyte membranes | Biochemical Journal
Thank you for your interest in spreading the word about Biochemical Journal.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
http://www.biochemj.org/content/93/2/337
Phosphate binding by cerebral microsomes in relation to adenosine-triphosphatase activity | Biochemical JournalPhosphate binding by cerebral microsomes in relation to adenosine-triphosphatase activity | Biochemical Journal
Thank you for your interest in spreading the word about Biochemical Journal.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
http://www.biochemj.org/content/101/2/502
Browsing Annual Medical Student Research Forum by Subject Adenosine TriphosphatasesBrowsing Annual Medical Student Research Forum by Subject Adenosine Triphosphatases
BACKGROUND: Neurons can survive for decades via cell maintenance and protein degradation. This process includes the general protein endolysosomal degradation pathway, an integral part of which is the Rab GTPase proteins ...
https://utswmed-ir.tdl.org/handle/2152.5/1482/browse?type=subject&value=Adenosine+Triphosphatases
Sodium-potassium-activated adenosine triphosphatase activity as a meas by M Levental and B TabakoffSodium-potassium-activated adenosine triphosphatase activity as a meas by M Levental and B Tabakoff
Levental, M and Tabakoff, B, Sodium-potassium-activated adenosine triphosphatase activity as a measure of neuronal membrane characteristics in ethanol-tolerant mice. (1980). Subject Strain Bibliography 1980. 2608 ...
https://mouseion.jax.org/ssbb1980/2608/
Enhanced na+-k+-activated adenosine triphosphatase activity in trans- by L B. Kasarov and H FriedmanEnhanced na+-k+-activated adenosine triphosphatase activity in trans- by L B. Kasarov and H Friedman
Kasarov, L B. and Friedman, H, Enhanced na+-k+-activated adenosine triphosphatase activity in trans- formed fibroblasts. (1974). Subject Strain Bibliography 1974. 1678 ...
https://mouseion.jax.org/ssbb1974/1678/
A Fragment-Based Ligand Screen Against Part of a Large Protein Machine: The ND1 Domains of the AAA+ ATPase p97/VCP. | Sigma...A Fragment-Based Ligand Screen Against Part of a Large Protein Machine: The ND1 Domains of the AAA+ ATPase p97/VCP. | Sigma...
Sigma-Aldrich offers abstracts and full-text articles by [Michael S Chimenti, Stacie L Bulfer, R Jeffrey Neitz, Adam R Renslo, Matthew P Jacobson, Thomas L James, Michelle R Arkin, Mark J S Kelly].
https://www.sigmaaldrich.com/catalog/papers/25690569
Microtubule-severing protein Katanin regulates neuromuscular junction development and dendritic elaboration in Drosophila. |...Microtubule-severing protein Katanin regulates neuromuscular junction development and dendritic elaboration in Drosophila. |...
Sigma-Aldrich offers abstracts and full-text articles by [Chuan-Xi Mao, Ying Xiong, Zhaohuan Xiong, Qifu Wang, Yong Q Zhang, Shan Jin].
https://www.sigmaaldrich.com/catalog/papers/24550114
Atp13a5 - Probable cation-transporting ATPase 13A5 - Mus musculus (Mouse) - Atp13a5 gene & proteinAtp13a5 - Probable cation-transporting ATPase 13A5 - Mus musculus (Mouse) - Atp13a5 gene & protein
integral component of plasma membrane, intracellular membrane-bounded organelle, calcium-transporting ATPase activity, cellular calcium ion homeostasis
http://www.uniprot.org/uniprot/Q3TYU2
AID 299465 - Inhibition of MKLP1 assessed as inhibition ATP hydrolysis by ATPase assay at 20 uM - PubChemAID 299465 - Inhibition of MKLP1 assessed as inhibition ATP hydrolysis by ATPase assay at 20 uM - PubChem
BioAssay record AID 299465 submitted by ChEMBL: Inhibition of MKLP1 assessed as inhibition ATP hydrolysis by ATPase assay at 20 uM.
https://pubchem.ncbi.nlm.nih.gov/bioassay/299465
Razvoj metode za mjerenje aktivnosti ekto-ATPaze u serumu čovjeka | Repozitorij Farmaceutsko-biokemijskog fakulteta Sveučilišta...Razvoj metode za mjerenje aktivnosti ekto-ATPaze u serumu čovjeka | Repozitorij Farmaceutsko-biokemijskog fakulteta Sveučilišta...
Ecto-ATPase is an enzyme which belongs to the group of the E-NTPDases. Those enzymes are ectoenzymes, and that they participate in the metabolism of extracellular molecules. Ecto-ATPase participate in metabolism of nucleoside triphosphate and nucleoside diphosphate with higher affinity for the nucleoside triphosphate. The metabolism of extracellular molecules with the appropriate enzymes is one of the steps in purinergic signaling that mediates a variety of physiological and pathophysiological processes. Therefore it is considered that value of ecto-ATPase activity in human serum may be a potential factor in the diagnosis of diseases associated with purinergic signaling. Ecto-ATPase activity in the human serum was measured by Fiske-Subbarow method, and the average value of 13 healthy samples was 992.3±281.2 nmol/ml/h. Results showed that the most suitable sample volume for the measuring enzyme activity is 50 μL, incubation time on 37 °C is 60 min and that 100 μL 1.12 mol/L TCA is required ...
https://repozitorij.pharma.unizg.hr/islandora/object/pharma%3A47
Efecto antioxidante de nuevo esteroide sintético (4-cloro-17ð-acetoxi-4-pregnen-3,20-diona) en cerebro de ratas adultasEfecto antioxidante de nuevo esteroide sintético (4-cloro-17ð-acetoxi-4-pregnen-3,20-diona) en cerebro de ratas adultas
The aim of the present study was to evaluate the antioxidant effect of a new steroid (4-chloro-17α-acetoxy-4-pregnene-3,20-dione) in rat brain. Twelve adults rats of 500g were randomly distributed in groups of 6 that were treated with 4-chloro-17α-acetoxy-4-pregnene-3,20-dione (4 mg/kg/day), or vehicle, administered during 5 days. At the end of treatment all animals were sacrificed and the GSH levels in the brain were measured by fluorescence method, as well as lipid peroxidation (TBARS), Na+,K+-ATPase and total ATPase enzymatic activity by spectrophotometry methods. Na+,K+-ATPase and total ATPase activities increased, only the total ATPase activity increase was significant as compared to the control group ( ...
http://connection.ebscohost.com/c/articles/25576284/efecto-antioxidante-de-nuevo-esteroide-sint-tico-4-cloro-17-acetoxi-4-pregnen-3-20-diona-en-cerebro-de-ratas-adultas
CCNA1 protein (human) - STRING interaction networkCCNA1 protein (human) - STRING interaction network
DNA replication licensing factor MCM6; Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for once per cell cycle DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differential ...
https://string-db.org/network/9606.ENSP00000255465
VPS4A antibody | acris-antibodies.comVPS4A antibody | acris-antibodies.com
VPS4A is a member of the AAA protein family (ATPases associated with diverse cellular activities), and is the homolog of the yeast Vps4 protein. In…
https://www.acris-antibodies.com/target/vps4a-antibody.htm
ATPaza presecanja mikrotubula - Википедија, слободна енциклопедијаATPaza presecanja mikrotubula - Википедија, слободна енциклопедија
Hartman, J.J., Mahr, J., McNally, K., Okawa, K., Iwamatsu, A., Thomas, S., Cheesman, S., Heuser, J., Vale, R.D. and McNally, F.J. (1998). „Katanin, a microtubule-severing protein, is a novel AAA ATPase that targets to the centrosome using a WD40-containing subunit. Cell. 93: 277-287. PMID 9568719 ...
https://sr.wikipedia.org/wiki/ATPaza_presecanja_mikrotubula
RCSB PDB - Protein Feature View - Putative ATPase, AAA family - Q7V3J8 (Q7V3J8 PROMP)RCSB PDB - Protein Feature View - Putative ATPase, AAA family - Q7V3J8 (Q7V3J8 PROMP)
The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex assemblies. As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
http://www.rcsb.org/pdb/protein/Q7V3J8
The yeast secretory pathway is perturbed by mutations in PMR1, a member of a Ca2+ ATPase familyThe yeast secretory pathway is perturbed by mutations in PMR1, a member of a Ca2+ ATPase family
The genes for two new P-type ATPases, PMR1 and PMR2, have been identified in yeast. A comparison of the deduced sequences of the PMR proteins with other known ion pumps showed that both proteins are very similar to Ca2+ ATPases. PMR1 is identical to SSC1, a gene previously identified by its effect o …
https://pubmed.ncbi.nlm.nih.gov/2526682/?dopt=Abstract
anti-ATAD3A antibody | GeneTexanti-ATAD3A antibody | GeneTex
ATAD3A antibody (ATPase family, AAA domain containing 3A) for IHC-P, WB. Anti-ATAD3A pAb (GTX116301) is tested in Human samples. 100% Ab-Assurance.
http://www.genetex.com/ATAD3A-antibody-GTX116301.html
EMBL: CP001115.PARAEMBL: CP001115.PARA
CP001115.PARA Location/Qualifiers FT CDS_pept 204..965 FT /codon_start=1 FT /transl_table=11 FT /gene=parA FT /locus_tag=Deide_1p00010 FT /product=putative ATPase involved in plasmid/chromosome FT partitioning FT /db_xref=EnsemblGenomes-Gn:Deide_1p00010 FT /db_xref=EnsemblGenomes-Tr:ACO47390 FT /db_xref=InterPro:IPR025669 FT /db_xref=InterPro:IPR027417 FT /db_xref=UniProtKB/TrEMBL:C1D1V1 FT /protein_id=ACO47390.2 FT /translation=MITATVFNHAGGAGKTSIVRDVGYELARQGQRVLVVDLDPQANLT FT AWLGVVDVQMEQTVYQVATEGAELPEPVAVHGLHLIPSQVDLALAETGMLGVPGSQLFL FT QQALRTVQDRYDLVLVDSPPSVGQLAILGAAAADRLIVPVPTRTKGLNALPGLQKATNL FT YRRLRPELAMGLYVPTMYDARRTHDREVLALLRQHLSPLAEPVPERAAVWLDSTMAGEP FT VGVYKAGSPAHQDVLRLTDEVARSLGLKVNA atgatcacag cgaccgtgtt caaccacgcg ggtggtgcag gcaagaccag catcgtccgc 60 gacgtcggtt atgaattggc ccgccagggc cagcgcgttc tggtagtgga cctcgatcca 120 caggccaacc tcaccgcatg gctgggtgtg gttgacgtgc agatggagca gacggtgtat 180 caagtcgcca cagaaggtgc tgagcttcca gagcctgtcg ccgttcacgg acttcacctg 240 ...
http://pbil.univ-lyon1.fr/cgi-bin/acnuc-search-id?query=CP001115.PARA&db=EMBL&ident=ACNUC7421
Ubxn10 MGI Mouse Gene Detail - MGI:2443123 - UBX domain protein 10Ubxn10 MGI Mouse Gene Detail - MGI:2443123 - UBX domain protein 10
View mouse Ubxn10 Chr4:138709837-138737167 with: phenotypes, sequences, polymorphisms, proteins, references, function, expression
http://www.informatics.jax.org/marker/MGI:2443123
sodium:potassium-exchanging ATPase complex QuickView - Correlation Enginesodium:potassium-exchanging ATPase complex QuickView - Correlation Engine
Sodium:potassium-exchanging ATPases are tetrameric proteins, consisting of two large alpha subunits and two smaller beta subunits. The alpha subunits bear the active site and penetrate the membrane, while the beta subunits carry oligosaccharide groups and…
http://www.nextbio.com/b/search/ov/sodium:potassium-exchanging%20ATPase%20complex?id=34081&type=biogroup
Testing nucleotide-protein interaction - Biochemistry - BioForumTesting nucleotide-protein interaction - Biochemistry - BioForum
Testing nucleotide-protein interaction - posted in Biochemistry: Hi everybody I work with an intrinsically disordered protein with unknown function and no close homologs. Psi Blasts show some low degree of homology to ATPsaes, but with e-values above cutoff. Motif searches predict an incomplete Walker A motif. If so, only the GKS motif is conserved, but not the P-loop. The protein forms a stable complex with Ca-calmodulin. I tried atpase assays, but there was no activity. Upon addition...
http://www.protocol-online.org/forums/topic/29592-testing-nucleotide-protein-interaction/
SPAST DICDI » Spastin - Membranome databaseSPAST DICDI » Spastin - Membranome database
MLFDLINSFL KNGINNSNNN NNNNNNKNNF YNSLEDDDYL LNNQTTKVSL YLYFFIFAFM FLVVDLIMLY YKHRENIESR ETDLSLKLNK MLIDFENDNK IKSSPTTSTT TTTITPTTTS SSQLRQPSTP KTTTKTINSP PSTPKSPPPL PSLESKLLYK DDIKQQLSLN EAKSQIDSAK QLDESLKYNS CIKLYIDGIE KLMALFSSYN SKEYRDYIDF YLKRAEYLKN ELKKGTNLKS ITNFNNFSKE YQINYNNKIL EQQQQQQQQS SSTYRNSLNL SSSKSNSTIN NRHSISSLSS LNSTTATTTT PSNTSTITSP GNKYGLQKSL SSTTLSLKKS SNSTNFQQPS PPSMVIPDIK GIDKSMVTLI MNEIMDRKNP VKWDDVVGLD KVKQSLMESV ILPNLRPDVF TGLRAPPKGL LLFGPPGNGK TMIAKAVAYE SKVTFFSISS SSLTSKYVGD GEKLVRALFA VATHFQPSII FIDEIDSLLT ERSSNESEAS RRLKTEILVQ FDGARTNGDE RVLVMGATNR PEDLDDAALR RLVKRIYVGL PELETRLQII QHLLVGQRHS LTKQQINSLA EVTQGYSGFD LAALCKDAAY EPIRRLGIGI KDLELNEISL ISFKDFANSL KQIRPSVTSQ SLKSFEKWNQ KFGTI ...
http://membranome.org/protein.php?pdbid=SPAST_DICDI
View gene SPAST - SpainMDBView gene SPAST - SpainMDB
We have used all reasonable efforts to ensure that the information displayed on these pages and contained in the databases is of high quality. We make no warranty, express or implied, as to its accuracy or that the information is fit for a particular purpose, and will not be held responsible for any consequences arising out of any inaccuracies or omissions. Individuals, organisations and companies which use this database do so on the understanding that no liability whatsoever either direct or indirect shall rest upon the curator(s) or any of their employees or agents for the effects of any product, process or method that may be produced or adopted by any part, notwithstanding that the formulation of such product, process or method may be based upon information here provided ...
https://lovd3.isciii.es/genes/SPAST
Fluorescein Analogues Inhibit SecA ATPase: The First Sub-micromolar Inhibitor of Bacterial Protein Translocation - Huang - 2012...Fluorescein Analogues Inhibit SecA ATPase: The First Sub-micromolar Inhibitor of Bacterial Protein Translocation - Huang - 2012...
SecA is a central component of the general secretion system that is essential for bacterial growth and thus an ideal target for antimicrobial agents. A series of fluorescein analogues were first screened against the ATPase activity using the truncated unregulated SecA catalytic domain. Rose bengal (RB) and erythrosin B (EB) were found to be potent inhibitors SecA with IC50 values of 0.5 μM and 2 μM, respectively. RB and EB inhibit the catalytic SecA ATPase more effectively than the F1F0-proton ATPase. We used three assays to test the effect of these compounds on full-length SecA ATPase: in solution (intrinsic ATPase), in membrane preparation, and translocation ATPase. RB and EB show the following trend in terms of IC50 values: translocation ATPase,membrane ATPase,intrinsic ATPase. Very importantly, the potency of these fluorescein analogues in inhibiting the truncated SecA ATPase correlates with their ability to inhibit the biologically relevant protein translocation activity of SecA. The in ...
http://onlinelibrary.wiley.com/doi/10.1002/cmdc.201100594/full
Plus itPlus it
A cell surface-located nucleoside triphosphatase activity can be assayed in liver epithelial cultures in situ with the incubation of intact cells in a medium containing [γ-32P]adenosine triphosphate and correlated with the tumorigenicity of these cells in neonatal Wistar rats. The ectoenzyme activity of normal diploid cell lines is minimal, whereas a considerably high activity has been found in all tumorigenic cell lines tested. The optimum condition for the adenosinetriphosphatase activity is physiological with regard to osmolarity, ionic composition, pH, and substrate concentration in the medium. The enzyme is significantly stimulated by Ca2+, and its activation is controlled by Mg2+. Histochemical examinations indicate that glutaraldehyde-fixed cells of tumorigenic lines have Ca2+-stimulated adenosinetriphosphatase activity on the external surface. The isotopic assay of adenosine triphosphate hydrolysis by intact cells may provide a rapid method for screening oncogenesis in vitro of liver ...
http://cancerres.aacrjournals.org/content/36/12/4491
Dicyclohexylcarbodiimide sensitivity and the binding of mitochondrial adenosine triphosphatase to the inner mitochondrial...Dicyclohexylcarbodiimide sensitivity and the binding of mitochondrial adenosine triphosphatase to the inner mitochondrial...
Fingerprint Dive into the research topics of Dicyclohexylcarbodiimide sensitivity and the binding of mitochondrial adenosine triphosphatase to the inner mitochondrial membrane. Together they form a unique fingerprint. ...
https://experts.syr.edu/en/publications/dicyclohexylcarbodiimide-sensitivity-and-the-binding-of-mitochond/fingerprints/
LOCALIZATION OF (SODIUM ION, POTASSIUM ION)-ACTIVATED ADENOSINE TRIPHOSPHATASE ACTIVITY IN TELEOST CHLORIDE CELLS: ...LOCALIZATION OF (SODIUM ION, POTASSIUM ION)-ACTIVATED ADENOSINE TRIPHOSPHATASE ACTIVITY IN TELEOST CHLORIDE CELLS: ...
LOCALIZATION OF (SODIUM ION, POTASSIUM ION)-ACTIVATED ADENOSINE TRIPHOSPHATASE ACTIVITY IN TELEOST CHLORIDE CELLS: CYTOCHEMICAL AND CELLISOLATION STUDIES ON THE BRANCHIAL EPITHELIUM OF THE PINFISH, LAGODON ...
https://scholarship.rice.edu/handle/1911/15373
Ca <sup>2+</sup> ](i) and pH(in) homeostasis in Kaposi sarcoma cells ...Ca <sup>2+</sup> ](i) and pH(in) homeostasis in Kaposi sarcoma cells ...
TY - JOUR. T1 - [Ca 2+ ](i) and pH(in) homeostasis in Kaposi sarcoma cells AU - Martínez-Zaguilán, Raul. AU - Chinnock, Brian F.. AU - Wald-Hopkins, Sarah. AU - Bernas, Mike. AU - Way, Dennis. AU - Weinand, Martin. AU - Witte, Marlys H.. AU - Gillies, Robert J.. PY - 1996/1/1. Y1 - 1996/1/1. N2 - Changes in intracellular pH (pH(in)) and intracellular calcium concentration [Ca 2+ ](i) play a major role in signal transduction leading to cell growth, differentiation and transformation. In some tumor cell lines, vacuolar (V-type) H + -adenosine triphosphatases (ATPases) are important in pH(in) regulation. To clarify the neoplastic nature and endothelial origin of Kaposi sarcoma (KS), pH(in) and [Ca 2+ ](i) and the functional expression of V-type H + -ATPases were evaluated in cultured endothelial marker-positive KS cells derived from AIDS-KS skin lesions as compared to human umbilical vein endothelial cells (HUVEC). Human skin fibroblasts (HSF) were also examined. Cells were examined using ...
https://arizona.pure.elsevier.com/en/publications/ca-sup2sup-i-and-phin-homeostasis-in-kaposi-sarcoma-cells
Adenosine triphosphatase test synonyms, adenosine triphosphatase test antonyms - FreeThesaurus.comAdenosine triphosphatase test synonyms, adenosine triphosphatase test antonyms - FreeThesaurus.com
Synonyms for adenosine triphosphatase test in Free Thesaurus. Antonyms for adenosine triphosphatase test. 2 words related to adenosine: biochemistry, nucleoside. What are synonyms for adenosine triphosphatase test?
http://www.freethesaurus.com/adenosine+triphosphatase+test
Hsp70 - WikipediaHsp70 - Wikipedia
The Hsp70 system interacts with extended peptide segments of proteins as well as partially folded proteins to prevent aggregation, remodel folding pathways, and regulate activity[7] When not interacting with a substrate peptide, Hsp70 is usually in an ATP bound state. Hsp70 by itself is characterized by a very weak ATPase activity, such that spontaneous hydrolysis will not occur for many minutes. As newly synthesized proteins emerge from the ribosomes, the substrate binding domain of Hsp70 recognizes sequences of hydrophobic amino acid residues, and interacts with them. This spontaneous interaction is reversible, and in the ATP bound state Hsp70 may relatively freely bind and release peptides. However, the presence of a peptide in the binding domain stimulates the ATPase activity of Hsp70, increasing its normally slow rate of ATP hydrolysis. When ATP is hydrolyzed to ADP the binding pocket of Hsp70 closes, tightly binding the now-trapped peptide chain. Further speeding ATP hydrolysis are the ...
https://en.wikipedia.org/wiki/Hsp70
Circadian rhythm of adenosine triphosphatase activity and 32P content in Pliss lymphosarcomaCircadian rhythm of adenosine triphosphatase activity and 32P content in Pliss lymphosarcoma
Abstract: Within a daily period maximal activity of ATPases and content of 32P in Pliss lymphosarcoma tissue was found in the samples taken at 15 or 21 p.m. and 3 a.m. The radioactivity in the tumor was minimal between 9 and 12 a.m. and 18 or 24 p.m. The alterations in Mg2+-ATPase activity in their magnitude and circadian rhythm coincided completely with the daily variations in content of radiophosphorus. Activities of Na+, K+- and HCO(3-)-ATPases exhibited maximal values at 15 p.m. and, especially between 3 and 6 a.m., i.e. these alterations were of two-peak shape without the peak at 21 p.m ...
http://pbmc.ibmc.msk.ru/index.php/en/article/PBMC-1984-30-6-38-en
PLOS ONE: Spastins Microtubule-Binding Properties and Comparison to KataninPLOS ONE: Spastins Microtubule-Binding Properties and Comparison to Katanin
Spastin and katanin are ring-shaped hexameric AAA ATPases that sever microtubules, and thus crucially depend on a physical interaction with microtubules. For the first time, we report here the microtubule binding properties of spastin at the single-molecule level, and compare them to katanin. Microscopic fluorescence assays showed that human spastin bound to microtubules by ionic interactions, and diffused along microtubules with a diffusion coefficient comparable to katanin. The microscopic measurement of landing and dissociation rates demonstrated the ionic character of the interaction, which could be mapped to a patch of three lysine residues outside of the catalytic domain of human spastin. This motif is not conserved in Drosophila spastin or katanin, which also bound by non-catalytic parts of the protein. The binding affinities of spastin and katanin were nucleotide-sensitive, with the lowest affinities under ADP,, the highest under ATP-γS conditions. These changes correlated with the formation of
http://journals.plos.org/plosone/article/figure?id=10.1371/journal.pone.0050161.t002
ATPase-dependent cooperative binding of ORC and Cdc6 to origin DNAATPase-dependent cooperative binding of ORC and Cdc6 to origin DNA
Binding of Cdc6 to the origin recognition complex (ORC) is a key step in the assembly of a pre-replication complex (pre-RC) at origins of DNA replication. ORC recognizes specific origin DNA sequences in an ATP-dependent manner. Here we demonstrate cooperative binding of Saccharomyces cerevisiae Cdc6 …
https://pubmed.ncbi.nlm.nih.gov/16228006/
Effects of Chelators and Calcium Ions on the Response of Renal Adenosine Triphosphatase Activity to Hormones and Concanavalin A...Effects of Chelators and Calcium Ions on the Response of Renal Adenosine Triphosphatase Activity to Hormones and Concanavalin A...
Thank you for your interest in spreading the word about Biochemical Society Transactions.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
http://www.biochemsoctrans.org/content/6/5/952
RCSB PDB - 2IHY: Structure of the Staphylococcus aureus putative ATPase subunit of an ATP-binding cassette (ABC) transporterRCSB PDB - 2IHY: Structure of the Staphylococcus aureus putative ATPase subunit of an ATP-binding cassette (ABC) transporter
As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
https://www.rcsb.org/structure/2IHY
Actl6a - Actin-like protein 6A - Mus musculus (Mouse) - Actl6a gene & proteinActl6a - Actin-like protein 6A - Mus musculus (Mouse) - Actl6a gene & protein
Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. Required for maximal ATPase activity of SMARCA4/BRG1/BAF190A and for association of the SMARCA4/BRG1/BAF190A containing remodeling complex BAF with chromatin/nuclear matrix. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and is required for the proliferation of neural progenitors. During neural development a switch from a stem/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural
https://www.uniprot.org/uniprot/Q9Z2N8
Medizinische Universität Graz Austria/Österreich - Forschungsportal - Medical University of GrazMedizinische Universität Graz Austria/Österreich - Forschungsportal - Medical University of Graz
Hsp90 couples ATP hydrolysis to large conformational changes essential for activation of client proteins. The structural transitions involve dimerization of the N-terminal domains and formation of closed states involving the N-terminal and middle domains. Here, we used Hsp90 mutants that modulate ATPase activity and biological function as probes to address the importance of conformational cycling for Hsp90 activity. We found no correlation between the speed of ATP turnover and the in vivo activity of Hsp90: some mutants with almost normal ATPase activity were lethal, and some mutants with lower or undetectable ATPase activity were viable. Our analysis showed that it is crucial for Hsp90 to attain and spend time in certain conformational states: a certain dwell time in open states is required for optimal processing of client proteins, whereas a prolonged population of closed states has negative effects. Thus, the timing of conformational transitions is crucial for Hsp90 function and not cycle ...
https://forschung.medunigraz.at/fodok/suchen.publikationen_mug_autoren?sprache_in=de&menue_id_in=205&id_in=4030&publikation_id_in=156399
Regulation of Cytoplasmic Dynein ATPase by Lis1 | Journal of NeuroscienceRegulation of Cytoplasmic Dynein ATPase by Lis1 | Journal of Neuroscience
This work establishes Lis1 as a dynein regulatory protein and links its function to dynein enzymatic activity. The simplest interpretation of our data is that Lis1 acts specifically and directly on dynein. Although the increase in ATPase activity is modest at first glance, our determination that only one-third of the dynein molecules interacted with Lis1 suggests that there were two populations of motors present in the ATPase assay. The major population did not stably bind Lis1 and is not expected to have had any change in ATPase activity, whereas a smaller population binds Lis1, resulting in a boost in ATPase activity. In this scenario, the enzymatic activity of the dynein as a whole would have increased by only 40%, but the activity of Lis1-associated motors may have increased by ∼100%.. The finding that Lis1 can stimulate dynein in vitro supports our model that Lis1 has an activating influence on dynein in cells (Smith et al., 2000). In our previous work, we found that raising Lis1 ...
https://www.jneurosci.org/node/365882.full.print
Study of energy consumption by Na+/K+ ATPase using PercevalHRStudy of energy consumption by Na+/K+ ATPase using PercevalHR
Adenosine triphosphate (ATP) is an important macro molecule that is the prime supplier of energy to run cell metabolism and to regulate several physiological processes in a cell. Despite its central role, the number of non-invasive methods to study ATP on a single cell level in real time are limited. ATPases use energy derived from ATP hydrolysis to maintain cell membrane potential by regulating ion gradients across the plasma membrane. It is generally believed that the Na+/K+-ATPase (NKA) which belongs to the P-type ATPase superfamily represent the main energy consumer among the ATPases. In this study, we set out to quantify ATP consumption by NKA on a single cell level in human embryonic kidney cells (HEK293a) using PercevalHR, a genetically encoded fluorescent biosensor that reports changes in the ATP:ADP during live cell imaging. We demonstrate that ATP hydrolysis by NKA is faster at physiological temperatures (35 -37°C) compared to room temperature. K+ free KREBS pre-treatment increased ...
http://kth.diva-portal.org/smash/record.jsf?pid=diva2:1084467
KTN80 confers precision to microtubule severing by specific targeting of katanin complexes in plant cells | The EMBO JournalKTN80 confers precision to microtubule severing by specific targeting of katanin complexes in plant cells | The EMBO Journal
The microtubule (MT)‐severing enzyme katanin triggers dynamic reorientation of cortical MT arrays that play crucial functions during plant cell morphogenesis, such as cell elongation, cell wall biosynthesis, and hormonal signaling. MT severing specifically occurs at crossover or branching nucleation sites in living Arabidopsis cells. This differs from the random severing observed along the entire length of single MTs in vitro and strongly suggests that a precise control mechanism must exist in vivo. However, how katanin senses and cleaves at MT crossover and branching nucleation sites in vivo has remained unknown. Here, we show that the katanin p80 subunit KTN80 confers precision to MT severing by specific targeting of the katanin p60 subunit KTN1 to MT cleavage sites and that KTN1 is required for oligomerization of functional KTN80-KTN1 complexes that catalyze severing. Moreover, our findings suggest that the katanin complex in Arabidopsis is composed of a hexamer of KTN1-KTN80 heterodimers ...
http://emboj.embopress.org/content/36/23/3435
Difference between revisions of Biomolecular Breadboards:Preliminary Data - OpenWetWareDifference between revisions of Biomolecular Breadboards:Preliminary Data - OpenWetWare
Implementing protein degradation is integral to enabling the function of many dynamical circuits, such as oscillators or feed-forward loops. We have been exploring the overexpression of AAA ATPases ClpXP to selectively target proteins with degradation tags. Initial experiments indicate that ClpXP, when overexpressed, can accelerate degradation of purified eGFP-ssrA (Fig. 1). We will further characterize this AAA ATPase family, as well as try to demonstrate its use through an incoherent feed-forward loop. We have not been able to replicate the results by adding purified ClpXP protein. However, we intend to express ClpXP off of plasmids or to create custom extract with ClpXP already overexpressed to enable rapid protein degradation. ...
https://openwetware.org/wiki/?title=Biomolecular_Breadboards:Preliminary_Data&diff=698698&oldid=697645
Condensin complex subunit 1 (zebrafish) | Protein Target - PubChemCondensin complex subunit 1 (zebrafish) | Protein Target - PubChem
Protein target information for Condensin complex subunit 1 (zebrafish). Find diseases associated with this biological target and compounds tested against it in bioassay experiments.
https://pubchem.ncbi.nlm.nih.gov/protein/A0A0R4IRW7
Erythrocyte Sodium-plus-Potassium Ion-Activated Adenosine Triphosphatase in Depressive Patients | Biochemical Society...Erythrocyte Sodium-plus-Potassium Ion-Activated Adenosine Triphosphatase in Depressive Patients | Biochemical Society...
Thank you for your interest in spreading the word about Biochemical Society Transactions.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
http://www.biochemsoctrans.org/content/2/3/505
RPN12 (YFR052W) Result Summary | BioGRIDRPN12 (YFR052W) Result Summary | BioGRID
Subunit Of The 19S Regulatory Particle Of The 26S Proteasome Lid; Synthetically Lethal With RPT1, Which Is An ATPase Component Of The 19S Regulatory Particle; Physically Interacts With Nob1p And Rpn3p; Protein Abundance Increases In Response To DNA Replication Stress
https://thebiogrid.org/31210/network/saccharomyces-cerevisiae/rpn12.html
Gene Ontology ClassificationsGene Ontology Classifications
Predicted to have DNA clamp unloader activity. Involved in several processes, including B cell activation; intracellular signal transduction; and positive regulation of B cell activation. Localizes to nucleus. Is expressed in liver; metanephros; midbrain ventricular layer; renal cortex; and telencephalon ventricular layer. Orthologous to human ATAD5 (ATPase family AAA domain containing 5 ...
http://www.informatics.jax.org/go/marker/MGI:2442925
Sodium/potassium-transporting ATPase subunit alpha-3Sodium/potassium-transporting ATPase subunit alpha-3
The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes an alpha 3 subunit. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012 ...
https://pharos.nih.gov/idg/targets/P13637
Sydney Research Online: Browsing Sydney Research OnlineSydney Research Online: Browsing Sydney Research Online
Altered intracellular localization and valosin-containing protein (p97 VCP) interaction underlie ATP7A-related distal motor neuropathy, Human Molecular Genetics, vol.21, 8, 2012,pp 1794-1807 ...
https://sro.library.usyd.edu.au/browse?type=author&value=Kaler%2C+Stephen&value_lang=en_US
PDB 1gaj structure summary ‹ Protein Data Bank in Europe (PDBe) ‹ EMBL-EBIPDB 1gaj structure summary ‹ Protein Data Bank in Europe (PDBe) ‹ EMBL-EBI
1gaj: Crystal structures of the MJ1267 ATP binding cassette reveal an induced-fit effect at the ATPase active site of an ABC transporter.
http://www.ebi.ac.uk/pdbe/entry/pdb/1gaj
Histoenzymological study of myocardial ATPase activity in experimental infarction in the rat.Histoenzymological study of myocardial ATPase activity in experimental infarction in the rat.
Histoenzymological techniques were used to examine ATPase activity in rat heart muscle fibres after experimental infarction. 25 hours after coronary ligation, ATPase activity in all ventricular section fibres was high, homogeneous at pH 9.4, sections
http://www.biomedsearch.com/nih/Histoenzymological-study-myocardial-ATPase-activity/6460499.html
Studies of E. coli Min proteins - Lawrence RothfieldStudies of E. coli Min proteins - Lawrence Rothfield
The long-range goal of this project is to determine the mechanism used by bacteria to select the proper cell division site at midcell. The three Min proteins, M...
http://grantome.com/grant/NIH/R37-GM060632-14S1
The erythrocyte ATPase activities taken from normal rat | Open-iThe erythrocyte ATPase activities taken from normal rat | Open-i
The erythrocyte ATPase activities taken from normal rats when incubated in supernates of boiled plasma from control normotensive and experimental hypertensive r
https://openi.nlm.nih.gov/detailedresult.php?img=PMC4536719_kjim-1-2-185-9f2&req=4
ATAD2 Antibody (PCRP-ATAD2-1F12) - DSHBATAD2 Antibody (PCRP-ATAD2-1F12) - DSHB
Monoclonal antibody against ATPase family AAA domaining containg 2 expressed by ATAD2 for use in Immunoprecipitation, Microarray, Western Blot against Human
http://dshb.biology.uiowa.edu/PCRP-ATAD2-1F12
TCDB » SEARCHTCDB » SEARCH
TadABC complex; the Flp pilus assembly complex, consisting of one ATPase component, TadA or CpaF, and two membrane components, TadB (218 aas and 3 - 5 TMSs) and TadC (200 aas and 2 N- and C-terminal TMSs) (Bottacini et al. 2017 ...
http://tcdb.org/search/result.php?acc=B3DUC1&tc=9.A.47.2.2
Seca 374 Baby Scale with BMIFSeca 374 Baby Scale with BMIF
Seca 374 Baby Scale with BMIF - $479 No Tax - Buy Seca Baby Scale with Wireless Transmission to EMR Sytems. Easy online ordering from Cascade HealthCare Products Inc
https://www.1cascade.com/374-baby-scale-seca
CAF16 (YFL028C) Result Summary | BioGRIDCAF16 (YFL028C) Result Summary | BioGRID
Part Of Evolutionarily-conserved CCR4-NOT Regulatory Complex; Contains Single ABC-type ATPase Domain But No Transmembrane Domain; Interacts With Several Subunits Of Mediator
https://thebiogrid.org/31118/protein/saccharomyces-cerevisiae/caf16.html
Addgene: pCMV-Tag 3B/myc-M87L195VAddgene: pCMV-Tag 3B/myc-M87L195V
Plasmid pCMV-Tag 3B/myc-M87L195V from Dr. Peter Baass lab contains the insert SPAST and is published in Hum Mol Genet. 2010 Jul 15;19(14):2767-79. doi: 10.1093/hmg/ddq177. Epub 2010 Apr 29. This plasmid is available through Addgene.
https://www.addgene.org/87721/
ISW1-N抗体|Abcam中国|Anti-ISW1-N抗体ISW1-N抗体|Abcam中国|Anti-ISW1-N抗体
ISW1-N小鼠多克隆抗体(ab43434)可与酿酒酵母样本反应并经WB, IP, ICC/IF实验严格验证。中国75%以上现货，所有产品提供质保服务，可通过电话、电邮或微信获得本地专属技术支持。
http://www.abcam.cn/isw1-n-antibody-ab43434.html
ATPaseATPase
... s (EC 3.6.1.3, adenylpyrophosphatase, ATP monophosphatase, triphosphatase, SV40 T-antigen, adenosine 5'-triphosphatase, ... Kielley, WW (1961). "Myosin adenosine triphosphatase". In Boyer, P. D.; Lardy, H.; Myrbäck, K. The Enzymes. 5 (2nd ed.). New ... Martin SS, Senior AE (November 1980). "Membrane adenosine triphosphatase activities in rat pancreas". Biochimica et Biophysica ... adenosine triphosphatase) are a class of enzymes that catalyze the decomposition of ATP into ADP and a free phosphate ion. This ...
https://en.wikipedia.org/wiki/ATPase
Propionigenium modestumPropionigenium modestum
Mitchell, Peter D. (1974). "A chemiosmotic molecular mechanism for proton-translocating adenosine triphosphatases". FEBS Lett. ... Laubinger, Werner; Dimroth, Peter (1989). "The sodium ion translocating adenosine triphosphatase of Propionigenium modestum ...
https://en.wikipedia.org/wiki/Propionigenium_modestum
Machine perfusionMachine perfusion
Glynn IM (1968). "Membrane adenosine triphosphatase and cation transport". Br Med Bull. 24 (2): 165-169. doi:10.1093/ ...
https://en.wikipedia.org/wiki/Machine_perfusion
ATP synthaseATP synthase
8. Properties of a factor conferring oligomycin sensitivity on mitochondrial adenosine triphosphatase". The Journal of ... "Catalytic site cooperativity of beef heart mitochondrial F1 adenosine triphosphatase. Correlations of initial velocity, bound ... ATP synthase is a protein that catalyzes the formation of the energy storage molecule adenosine triphosphate (ATP) using ... adenosine diphosphate (ADP) and inorganic phosphate (Pi). It is classified under ligases as it changes ADP by the formation of ...
https://en.wikipedia.org/wiki/ATP_synthase
Discovery and development of proton pump inhibitorsDiscovery and development of proton pump inhibitors
"Gastric adenosine triphosphatases: A review of their possible role in HCl secretion". Gastroenterology. 73 (4 Pt 2): 921-6. doi ...
https://en.wikipedia.org/wiki/Discovery_and_development_of_proton_pump_inhibitors
Ian R. GibbonsIan R. Gibbons
Gibbons, Ian R.; Rowe, Arthur J. (23 July 1965). "Dynein: a protein with adenosine triphosphatase activity from cilia". Science ... Lindemann, Charles B.; Gibbons, Ian R. (1 April 1975). "Adenosine triphosphate-induced motility and sliding of filaments in ...
https://en.wikipedia.org/wiki/Ian_R._Gibbons
Đái Duy BanĐái Duy Ban
Dai Duy Ban: (Announcement in Japan in English): Adenosine Triphospha tases on Plasma. Membrane Surrounding Lipid Vacuoles in L ...
https://en.wikipedia.org/wiki/Đái_Duy_Ban
Brody myopathyBrody myopathy
"Exertional rhabdomyolysis in a patient with calcium adenosine triphosphatase deficiency". Journal of Neurology, Neurosurgery, ...
https://en.wikipedia.org/wiki/Brody_myopathy
Oxidative phosphorylationOxidative phosphorylation
I. Purification and properties of soluble dinitrophenol-stimulated adenosine triphosphatase". J. Biol. Chem. 235 (11): 3322-9. ... The ATP synthase uses the energy to transform adenosine diphosphate (ADP) into adenosine triphosphate, in a phosphorylation ... "Catalytic site cooperativity of beef heart mitochondrial F1 adenosine triphosphatase. Correlations of initial velocity, bound ... thereby releasing the chemical energy stored within the nutrients in order to produce adenosine triphosphate (ATP). In ...
https://en.wikipedia.org/wiki/Oxidative_phosphorylation
Fosforylacja oksydacyjna, wolna encyklopediaFosforylacja oksydacyjna, wolna encyklopedia
I. Purification and Properties of Soluble, Dinitrophenol-stimulated Adenosine Triphosphatase. „J. Biol. Chem.". 235 (11), s. ... Catalytic site cooperativity of beef heart mitochondrial F1 adenosine triphosphatase. Correlations of initial velocity, bound ...
https://pl.wikipedia.org/wiki/Fosforylacja_oksydacyjna
1957 in science1957 in science
February 1957). "The Influence of Some Cations on an Adenosine Triphosphatase from Peripheral Nerves". Biochimica et Biophysica ...
https://en.wikipedia.org/wiki/1957_in_science
Timeline of chemistryTimeline of chemistry
Skou, Jens (1957). "The influence of some cations on an adenosine triphosphatase from peripheral nerves". Biochim Biophys Acta ...
https://en.wikipedia.org/wiki/Timeline_of_chemistry
ATP5EATP5E
8. Properties of a factor conferring oligomycin sensitivity on mitochondrial adenosine triphosphatase". The Journal of ...
https://en.wikipedia.org/wiki/ATP5E
Alan HodgkinAlan Hodgkin
Skou, J. C. (1957). "The influence of some cations on an adenosine triphosphatase from peripheral nerves". Biochimica et ...
https://en.wikipedia.org/wiki/Alan_Hodgkin
Pirzada QasimPirzada Qasim
1(1): 41-49 (1979). The effect of preincubation on adenosine triphosphatase activity of human erythrocyte membranes. Nat. Sci. ... 4 (1977). Foreign (International) Effect of ouabain upon erythrocyte membrane adenosine triphosphatase in Duchenne muscular ...
https://en.wikipedia.org/wiki/Pirzada_Qasim
P-type ATPaseP-type ATPase
doi:10.1016/0968-0004(87)90071-5. SKOU JC (February 1957). "The influence of some cations on an adenosine triphosphatase from ... adenosine triphosphate (ATP). In addition, they all appear to interconvert between at least two different conformations, ...
https://en.wikipedia.org/wiki/P-type_ATPase
Action potentialAction potential
Skou JC (February 1957). "The influence of some cations on an adenosine triphosphatase from peripheral nerves". Biochimica et ...
https://en.wikipedia.org/wiki/Action_potential
Jens Christian SkouJens Christian Skou
Skou, J. C. (1989). "The influence of some cations on an adenosine triphosphatase from peripheral nerves. 1957". Biochimica et ... Post, RL; Merritt, CR; Kinsolving, CR; Albright, CD (June 1960). "Membrane adenosine triphosphatase as a participant in the ... Skou, JC (23 February 1957). "The influence of some cations on an adenosine triphosphatase from peripheral nerves". Biochimica ... The Influence of Some Cations on an Adenosine Triphosphatase from Peripheral Nerves'". Biochimica et Biophysica Acta. 1000: 435 ...
https://en.wikipedia.org/wiki/Jens_Christian_Skou
MT-ATP6MT-ATP6
8. Properties of a factor conferring oligomycin sensitivity on mitochondrial adenosine triphosphatase". The Journal of ... Another segment of the enzyme uses the energy created by this proton flow to convert a molecule called adenosine diphosphate ( ...
https://en.wikipedia.org/wiki/MT-ATP6
ATP5F1AATP5F1A
8. Properties of a factor conferring oligomycin sensitivity on mitochondrial adenosine triphosphatase". The Journal of ... Resveratrol inhibition of the F1 catalytic core increases adenosine monophosphate (AMP) levels, thereby activating the AMP- ...
https://en.wikipedia.org/wiki/ATP5F1A
Charcot-Marie-Tooth diseaseCharcot-Marie-Tooth disease
The standard for indicating fiber type is histoenzymatic adenosine triphosphatase (ATPase at pH 9.4).[21] ...
https://en.wikipedia.org/wiki/Charcot–Marie–Tooth_disease
Fosforilasi oksidatif bahasa Indonesia, ensiklopedia bebasFosforilasi oksidatif bahasa Indonesia, ensiklopedia bebas
"Catalytic site cooperativity of beef heart mitochondrial F1 adenosine triphosphatase. Correlations of initial velocity, bound ...
https://id.wikipedia.org/wiki/Fosforilasi_oksidatif
鈉鉀泵 - 维基百科，自由的百科全书鈉鉀泵 - 维基百科，自由的百科全书
Skou J. The influence of some cations on an adenosine triphosphatase from peripheral nerves.. Biochim Biophys Acta. 1957, 23 (2 ...
https://zh.wikipedia.org/wiki/Na+/K+_pump
Oxidative phosphorylationOxidative phosphorylation
I. Purification and properties of soluble dinitrophenol-stimulated adenosine triphosphatase". J. Biol. Chem. 235 (11): 3322-9. ... The ATP synthase uses the energy to transform adenosine diphosphate (ADP) into adenosine triphosphate, in a phosphorylation ... "Catalytic site cooperativity of beef heart mitochondrial F1 adenosine triphosphatase. Correlations of initial velocity, bound ... thereby releasing energy which is used to produce adenosine triphosphate (ATP). In most eukaryotes, this takes place inside ...
https://en.m.wikipedia.org/wiki/Oxidative_phosphorylation
Action potentialAction potential
Skou J (1957). "The influence of some cations on an adenosine triphosphatase from peripheral nerves". Biochim Biophys Acta. 23 ...
https://en.m.wikipedia.org/wiki/Action_potentials
Jens Christian SkouJens Christian Skou
Skou, J C (1989). "The influence of some cations on an adenosine triphosphatase from peripheral nerves. 1957". Biochim. Biophys ... "The influence of some cations on an adenosine triphosphatase from peripheral nerves" (PDF). Biochimica et Biophysica Acta. 23 ( ... The Influence of Some Cations on an Adenosine Triphosphatase from Peripheral Nerves'". Biochim. Biophys. Acta. 1000: 435-8. doi ... "Membrane adenosine triphosphatase as a participant in the active transport of sodium and potassium in the human erythrocyte". ...
https://en.m.wikipedia.org/wiki/Jens_Christian_Skou
Na+/K+-ATPaseNa+/K+-ATPase
Na⁺/K⁺-ATPase (sodium-potassium adenosine triphosphatase, also known as the Na⁺/K⁺ pump or sodium-potassium pump) is an enzyme ... Skou JC (February 1957). "The influence of some cations on an adenosine triphosphatase from peripheral nerves". Biochimica et ...
https://en.m.wikipedia.org/wiki/Na+/K+-ATPase
Jens Christian Skou Bahasa Melayu, ensiklopedia bebasJens Christian Skou Bahasa Melayu, ensiklopedia bebas
Skou, J C (1989). "The influence of some cations on an adenosine triphosphatase from peripheral nerves. 1957". Biochim. Biophys ... The Influence of Some Cations on an Adenosine Triphosphatase from Peripheral Nerves'". Biochim. Biophys. Acta. 1000: 435-8. doi ...
https://ms.wikipedia.org/wiki/Jens_Christian_Skou
Secretina, a enciclopedia libreSecretina, a enciclopedia libre
... adenosine triphosphatase". Gastroenterology 108 (3): 850-859. PMID 7875488. doi:10.1016/0016-5085(95)90460-3.. ...
https://gl.wikipedia.org/wiki/Secretina
SecretinSecretin
... adenosine triphosphatase". Gastroenterology. 108 (3): 850-9. doi:10.1016/0016-5085(95)90460-3. PMID 7875488.. ...
https://en.m.wikipedia.org/wiki/Secretin
ThiamineThiamine
Adenosine thiamine diphosphateEdit. Adenosine thiamine diphosphate (AThDP) or thiaminylated adenosine diphosphate exists in ... July 2003). "Thiamine triphosphate and thiamine triphosphatase activities: from bacteria to mammals". Cellular and Molecular ... Adenosine thiamine triphosphateEdit. Adenosine thiamine triphosphate (AThTP) or thiaminylated adenosine triphosphate has ... the recently discovered adenosine thiamine triphosphate (AThTP), and adenosine thiamine diphosphate (AThDP). While the coenzyme ...
https://en.m.wikipedia.org/wiki/Thiamin
Charcot-Marie-Tooth diseaseCharcot-Marie-Tooth disease
The standard for indicating fiber type is histoenzymatic adenosine triphosphatase (ATPase at pH 9.4).[20] ...
https://en.m.wikipedia.org/wiki/Charcot–Marie–Tooth_disease
DigoxinDigoxin
... 's primary mechanism of action involves inhibition of the sodium potassium adenosine triphosphatase (Na+/K+ ATPase), ...
https://en.m.wikipedia.org/wiki/Digoxin
Proton-pump inhibitorProton-pump inhibitor
Proton pump inhibitors act by irreversibly blocking the hydrogen/potassium adenosine triphosphatase enzyme system (the H+/K+ ...
https://en.wikipedia.org/wiki/Proton_Pump_Inhibitors
산화적 인산화 - 위키백과, 우리 모두의 백과사전산화적 인산화 - 위키백과, 우리 모두의 백과사전
I. Purification and properties of soluble dinitrophenol-stimulated adenosine triphosphatase". 《J. Biol. Chem.》 235 (11): 3322-9 ... "Catalytic site cooperativity of beef heart mitochondrial F1 adenosine triphosphatase. Correlations of initial velocity, bound ...
https://ko.m.wikipedia.org/wiki/산화적_인산화
Sintase ATPSintase ATP
... (Inggris: adenosine triphosphatase, ATP synthase, ATPase) ya iku enzim saka kulawarga permease arupa kumpulan ...
https://jv.wikipedia.org/wiki/Sintase_ATP
ഓക്സിഡേറ്റീവ് ഫോസ്ഫോറിലേഷൻ - വിക്കിപീഡിയഓക്സിഡേറ്റീവ് ഫോസ്ഫോറിലേഷൻ - വിക്കിപീഡിയ
I. Purification and properties of soluble dinitrophenol-stimulated adenosine triphosphatase". J. Biol. Chem. 235 (11): 3322-9. ... "Catalytic site cooperativity of beef heart mitochondrial F1 adenosine triphosphatase. Correlations of initial velocity, bound ... "Catalytic site cooperativity of beef heart mitochondrial F1 adenosine triphosphatase. Correlations of initial velocity, bound ...
https://ml.wikipedia.org/wiki/ഓക്സിഡേറ്റീവ്_ഫോസ്ഫോറിലേഷൻ
ATPase V, a enciclopedia libreATPase V, a enciclopedia libre
"Novel mutations in the a3 subunit of vacuolar H+-adenosine triphosphatase in a Japanese patient with infantile malignant ...
https://gl.wikipedia.org/wiki/ATPase_V
List of homing endonuclease cutting sitesList of homing endonuclease cutting sites
... translocating adenosine triphosphatase from vacuolar membranes of Saccharomyces cerevisiae". J Biol Chem. 265 (12): 6726-33. ... adenosine triphosphatase". Science. 250 (4981): 651-7. Bibcode:1990Sci...250..651K. doi:10.1126/science.2146742. PMID 2146742. ...
https://en.wikipedia.org/wiki/List_of_homing_endonuclease_cutting_sites
Lidia MannuzzuLidia Mannuzzu
Decreased Calcium Adenosine Triphosphatase, and Altered Membrane Proteins During Fava Bean Hemolysis in Glucose-6-Phosphate ...
https://en.wikipedia.org/wiki/Lidia_Mannuzzu
ProstasomesProstasomes
Ronquist G, Brody I, Gottfries A, Stegmayr B (1978). "An Mg2+ and Ca2+-stimulated adenosine triphosphatase in human prostatic ... Ronquist G, Brody I, Gottfries A, Stegmayr B (1978). "An Mg2+ and Ca2+-stimulated adenosine triphosphatase in human prostatic ... Ronquist G, Hedström M (August 1977). "Restoration of detergent-inactivated adenosine triphosphatase activity of human ... "Abnormal deficiency of both Mg2+ and Ca2+-dependent adenosine triphosphatase and secretory granules and vesicles in human ...
https://en.wikipedia.org/wiki/Prostasomes
Zygosaccharomyces bailiiZygosaccharomyces bailii
Another mechanism of Z. bailii to deal with acid challenge is that the yeast uses a plasma membrane H+-adenosine triphosphatase ...
https://en.wikipedia.org/wiki/Zygosaccharomyces_bailii
Mitochondrial fusionMitochondrial fusion
Fzo1 (P38297) and Mgm1 (P32266) are conserved guanosine triphosphatases that reside in the outer and inner membranes, ... This series of events causes problems with adenosine triphosphate (ATP) synthesis. The Mitochondrial Inner/Outer Membrane ...
https://en.wikipedia.org/wiki/Mitochondrial_fusion
FolliculinFolliculin
... in a lysosome-associated complex with Ragulator and vacuolar adenosine triphosphatase (v-ATPase) interact with mTORC1 in ...
https://en.wikipedia.org/wiki/Folliculin
Category:Adenosine triphosphatases - Wikimedia CommonsCategory:Adenosine triphosphatases - Wikimedia Commons
Media in category "Adenosine triphosphatases". The following 74 files are in this category, out of 74 total. ... Retrieved from "https://commons.wikimedia.org/w/index.php?title=Category:Adenosine_triphosphatases&oldid=131322728" ...
https://commons.wikimedia.org/wiki/Category:Adenosine_triphosphatases
Adenosine triphosphatase | enzyme | Britannica.comAdenosine triphosphatase | enzyme | Britannica.com
Other articles where Adenosine triphosphatase is discussed: cell: The sodium-potassium pump: An enzyme called sodium-potassium- ... www.britannica.com/science/adenosine-triphosphatase", "title": "Adenosine triphosphatase", "documentGroup": "TOPIC PAGINATED ... adenosine triphosphate (ATP)Adenosine triphosphate, or ATP, is the primary carrier of energy in cells. The water-mediated ...
https://www.britannica.com/science/adenosine-triphosphatase
Adenosine Triphosphatases | Harvard Catalyst Profiles | Harvard CatalystAdenosine Triphosphatases | Harvard Catalyst Profiles | Harvard Catalyst
"Adenosine Triphosphatases" by people in Harvard Catalyst Profiles by year, and whether "Adenosine Triphosphatases" was a major ... "Adenosine Triphosphatases" is a descriptor in the National Library of Medicines controlled vocabulary thesaurus, MeSH (Medical ... Below are the most recent publications written about "Adenosine Triphosphatases" by people in Profiles. ... Below are MeSH descriptors whose meaning is more general than "Adenosine Triphosphatases". ...
https://connects.catalyst.harvard.edu/Profiles/display/Concept/Adenosine%20Triphosphatases
Na+, K(+)-adenosine triphosphatase regulation in hypertrophied vascular smooth muscle cells. | HypertensionNa+, K(+)-adenosine triphosphatase regulation in hypertrophied vascular smooth muscle cells. | Hypertension
Na+, K(+)-adenosine triphosphatase regulation in hypertrophied vascular smooth muscle cells.. L M Krug, B C Berk ...
http://hyper.ahajournals.org/content/20/2/144
Subunit Interactions in Mitochondrial Adenosine Triphosphatase | Biochemical Society Transactions | Portland PressSubunit Interactions in Mitochondrial Adenosine Triphosphatase | Biochemical Society Transactions | Portland Press
JAN ROSING, D. A. HARRIS, A. KEMP, E. C. SLATER; Subunit Interactions in Mitochondrial Adenosine Triphosphatase. Biochem Soc ... Cross-Linking of Isolated Oligomycin-Insensitive Adenosine Triphosphatase from Ox Heart Mitochondria Biochem Soc Trans (October ... A Comparison of Platelet Membrane and Erythrocyte Membrane Adenosine Triphosphatase Specific Activities in Affective Disorders ... Evolutionary Temperature Adaptation of the Calcium-Dependent Adenosine Triphosphatase of Fish Sarcoplasmic Reticulum Biochem ...
https://portlandpress.com/biochemsoctrans/article-abstract/2/3/502/58147/Subunit-Interactions-in-Mitochondrial-Adenosine
Structural Aspects of Mitochondrial Adenosine Triphosphatase | Biochemical Society Transactions | Portland PressStructural Aspects of Mitochondrial Adenosine Triphosphatase | Biochemical Society Transactions | Portland Press
3. Mitochondrial adenosine triphosphatase and the adenosine triphosphate-adenosine diphosphate exchange Biochem J (July,1960) ... Structural Aspects of Mitochondrial Adenosine Triphosphatase R. B. BEECHEY R. B. BEECHEY ... The effect of magnesium and calcium ions on adenosine triphosphatase in the nervous and vascular tissues of the brain Biochem J ... R. B. BEECHEY; Structural Aspects of Mitochondrial Adenosine Triphosphatase. Biochem Soc Trans 1 June 1974; 2 (3): 466-471. doi ...
https://portlandpress.com/biochemsoctrans/article-abstract/2/3/466/58204/Structural-Aspects-of-Mitochondrial-Adenosine
Erythrocyte and plasma Ca2+, Mg2+ and cell membrane adenosine triphosphatase activity in patients with essential hypertension. ...Erythrocyte and plasma Ca2+, Mg2+ and cell membrane adenosine triphosphatase activity in patients with essential hypertension. ...
... To assess the relationships between plasma and intracellular Ca2+, Mg2+ and blood cell membrane adenosine triphosphatase ( ...
https://www.ncbi.nlm.nih.gov/pubmed/10374376
The cytochemical demonstration of NaK dependent adenosine triphosphatase at electrocyte level in Eigenmannia virescens ...The cytochemical demonstration of NaK dependent adenosine triphosphatase at electrocyte level in Eigenmannia virescens ...
Effect of adenosine triphosphatase hydrolysis by lead ion on the histochemical localization of adenosine triphosphatase ... Sodium potassium activated adenosine triphosphatase. VII. Concurent inhibition of Na+K+ adenosine triphosphatase and activation ... Denizot JP (1980) Adenosine triphosphatases (ATP-A) on sensory cell plasmic membranes of tuberous organs (electroreceptors) of ... Siegel GJ, Fogt SM (1977) Inhibition by lead ion of Electrophorus electroplax (Na+−K+)-adenosine triphosphatase and K+-p- ...
https://link.springer.com/article/10.1007/BF00495831
Electrophorus Adenosine Triphosphatase: Sodium-Activated Exchange after N-Ethyl Maleimide Treatment | ScienceElectrophorus Adenosine Triphosphatase: Sodium-Activated Exchange after N-Ethyl Maleimide Treatment | Science
Electrophorus Adenosine Triphosphatase: Sodium-Activated Exchange after N-Ethyl Maleimide Treatment. By Stanley Fahn, R. Wayne ... Electrophorus Adenosine Triphosphatase: Sodium-Activated Exchange after N-Ethyl Maleimide Treatment. By Stanley Fahn, R. Wayne ... Electrophorus Adenosine Triphosphatase: Sodium-Activated Exchange after N-Ethyl Maleimide Treatment Message Subject. (Your Name ... The same preparation catalyzes a Mg++-dependent transphosphorylation between adenosine triphosphate and adenosine diphosphate. ...
https://science.sciencemag.org/content/145/3629/283.abstract
Expression and distribution of renal vacuolar proton-translocating adenosine triphosphatase in response to chronic acid and...Expression and distribution of renal vacuolar proton-translocating adenosine triphosphatase in response to chronic acid and...
We examined the mechanism of adaptation by analyzing vacuolar proton-translocating adenosine triphosphatase (H+ ATPase) 31-kD ... Expression and distribution of renal vacuolar proton-translocating adenosine triphosphatase in response to chronic acid and ...
https://www.ncbi.nlm.nih.gov/pubmed/1829094?dopt=Abstract
Organization of Oligomycin-Sensitive Adenosine Triphosphatase | Biochemical Society TransactionsOrganization of Oligomycin-Sensitive Adenosine Triphosphatase | Biochemical Society Transactions
Organization of Oligomycin-Sensitive Adenosine Triphosphatase. M. D. PARTIS, E. BERTOLI, S. MASCARELLO, D. E. GRIFFITHS ... Organization of Oligomycin-Sensitive Adenosine Triphosphatase Message Subject (Your Name) has forwarded a page to you from ...
http://www.biochemsoctrans.org/content/4/1/88
Symptoms of Adenosine triphosphatase deficiency, anaemia due to - RightDiagnosis.comSymptoms of Adenosine triphosphatase deficiency, anaemia due to - RightDiagnosis.com
... and correct diagnosis for Adenosine triphosphatase deficiency, anaemia due to signs or Adenosine triphosphatase deficiency, ... anaemia due to including 12 medical symptoms and signs of Adenosine triphosphatase deficiency, anaemia due to, alternative ... Do I have Adenosine triphosphatase deficiency, anaemia due to? *Adenosine triphosphatase deficiency, anaemia due to: ... Research symptoms & diagnosis of Adenosine triphosphatase deficiency, anaemia due to: *Overview -- Adenosine triphosphatase ...
https://www.rightdiagnosis.com/a/adenosine_triphosphatase_deficiency_anaemia_due_to/symptoms.htm
JCI - DNA variation in the genes of the Na,K-adenosine triphosphatase and its relation with resting metabolic rate, respiratory...JCI - DNA variation in the genes of the Na,K-adenosine triphosphatase and its relation with resting metabolic rate, respiratory...
DNA variation in the genes of the Na,K-adenosine triphosphatase and its relation with resting metabolic rate, respiratory ... DNA variation in the genes of the Na,K-adenosine triphosphatase and its relation with resting metabolic rate, respiratory ...
https://www.jci.org/articles/view/117038/pdf
PRIME PubMed | Pathogenesis of post-thymectomy autoimmune gastritis. Identification of anti-H/K adenosine triphosphatase...PRIME PubMed | Pathogenesis of post-thymectomy autoimmune gastritis. Identification of anti-H/K adenosine triphosphatase...
Identification of anti-H/K adenosine triphosphatase-reactive T cell were found in PRIME PubMed. Download Prime PubMed App to ... Identification of anti-H/K adenosine triphosphatase-reactive T cells. Journal of Immunology (Baltimore, Md. : 1950), 157(4), pp ... Identification of anti-H/K Adenosine Triphosphatase-reactive T Cells." Journal of Immunology (Baltimore, Md. : 1950), vol. 157 ... Identification of anti-H/K adenosine triphosphatase-reactive T cells. AU - Suri-Payer,E, AU - Kehn,P J, AU - Cheever,A W, AU - ...
https://www.unboundmedicine.com/medline/citation/8759770/Pathogenesis_of_post_thymectomy_autoimmune_gastritis__Identification_of_anti_H/K_adenosine_triphosphatase_reactive_T_cells_
EMF-Portal | adenosine triphosphataseEMF-Portal | adenosine triphosphatase
Enzymology. A group of enzymes which catalyze the hydrolysis of ATP into ADP and phosphate coupled with another function such as transporting Ca2+ across a membrane and taking part in muscle contraction. These enzymes may be dependent on Ca2+, Mg2+, anions, H+, or DNA.. ...
https://www.emf-portal.org/en/glossary/1741
Vectorial aspects of adenosine-triphosphatase activity in erythrocyte membranes | Biochemical JournalVectorial aspects of adenosine-triphosphatase activity in erythrocyte membranes | Biochemical Journal
Vectorial aspects of adenosine-triphosphatase activity in erythrocyte membranes. R Whittam, ME Ager ... Vectorial aspects of adenosine-triphosphatase activity in erythrocyte membranes Message Subject (Your Name) has forwarded a ...
http://www.biochemj.org/content/93/2/337
Transient hypoxia-ischemia in rats: changes in diffusion-sensitive MR imaging findings, extracellular space, and Na+-K+ ...Transient hypoxia-ischemia in rats: changes in diffusion-sensitive MR imaging findings, extracellular space, and Na+-K+ ...
... adenosine triphosphatase and cytochrome oxidase activity Radiology. 2002 Apr;223(1):65-75. doi: 10.1148/radiol.2231010736. ... adenosine triphosphatase (ATPase) activity at various times during and after cerebral hypoxia-ischemia in neonatal and juvenile ...
https://pubmed.ncbi.nlm.nih.gov/11930049/?dopt=Abstract
Adenosine triphosphatase of rat liver mitochondria. Capacity of the homogeneous F1 component of the enzyme to restore ATP...Adenosine triphosphatase of rat liver mitochondria. Capacity of the homogeneous F1 component of the enzyme to restore ATP...
Adenosine triphosphatase of rat liver mitochondria. Capacity of the homogeneous F1 component of the enzyme to restore ATP ... Adenosine triphosphatase of rat liver mitochondria. Capacity of the homogeneous F1 component of the enzyme to restore ATP ...
https://pubmed.ncbi.nlm.nih.gov/147273/?itool=Email.EmailReport.Pubmed_ReportSelector.Pubmed_RVDocSum&ordinalpos=170
Purification and characterization of the membrane adenosine triphosphatase complex from the wild-type and N,N...Purification and characterization of the membrane adenosine triphosphatase complex from the wild-type and N,N'...
Both the DCCD-sensitive and the DCCD-resistant F1-F0 adenosine triphosphatase appeared to consist of eight proteins, five of ... We have purified the F1-F0 adenosine triphosphatase complex from wild-type Streptococcus faecalis ATCC 9790 and an N,N- ... Purification and characterization of the membrane adenosine triphosphatase complex from the wild-type and N,N- ... Purification and characterization of the membrane adenosine triphosphatase complex from the wild-type and N,N- ...
https://jb.asm.org/content/147/2/363?ijkey=b2919ebd500ebe212873103932f8b5d4186e93ed&keytype2=tf_ipsecsha
Get PDF - Neomycin inhibition of adenosine triphosphatase: evidence for a neomycin-phospholipid interactionGet PDF - Neomycin inhibition of adenosine triphosphatase: evidence for a neomycin-phospholipid interaction
Neomycin inhibition of adenosine triphosphatase: evidence for a neomycin-phospholipid interaction ... Evidence that sodium-potassium competition modulates the rate of ouabain interaction iwth (Na + +K + ) adenosine triphosphatase ... Neomycin inhibition of adenosine triphosphatase: evidence for a neomycin-phospholipid interaction. Lipsky, J.J.; Lietman, P.S. ... Neomycin inhibition of adenosine triphosphatase: evidence for a neomycin-phospholipid interaction. ...
https://eurekamag.com/research/043/723/043723021.php
Phosphate binding by cerebral microsomes in relation to adenosine-triphosphatase activity | Biochemical JournalPhosphate binding by cerebral microsomes in relation to adenosine-triphosphatase activity | Biochemical Journal
Phosphate binding by cerebral microsomes in relation to adenosine-triphosphatase activity. R Rodnight, DA Hems, BE Lavin ... Phosphate binding by cerebral microsomes in relation to adenosine-triphosphatase activity Message Subject (Your Name) has ...
http://www.biochemj.org/content/101/2/502
Erythrocyte Sodium-plus-Potassium Ion-Activated Adenosine Triphosphatase in Depressive Patients | Biochemical Society...Erythrocyte Sodium-plus-Potassium Ion-Activated Adenosine Triphosphatase in Depressive Patients | Biochemical Society...
Erythrocyte Sodium-plus-Potassium Ion-Activated Adenosine Triphosphatase in Depressive Patients. D. A. T. DICK, G. J. NAYLOR, E ... Erythrocyte Sodium-plus-Potassium Ion-Activated Adenosine Triphosphatase in Depressive Patients. D. A. T. DICK, G. J. NAYLOR, E ... Erythrocyte Sodium-plus-Potassium Ion-Activated Adenosine Triphosphatase in Depressive Patients Message Subject (Your Name) has ...
http://www.biochemsoctrans.org/content/2/3/505
Sodium-potassium dependent adenosine triphosphatase activity in gills and kidneys of Atlantic salmon (|i|Salmo salar|/i|)Sodium-potassium dependent adenosine triphosphatase activity in gills and kidneys of Atlantic salmon (|i|Salmo salar|/i|)
Sodium-potassium dependent adenosine triphosphatase activity in gills and kidneys of Atlantic salmon (Salmo salar). Series ... Sodium-potassium dependent adenosine triphosphatase activity in gills and kidneys of Atlantic salmon (Salmo salar). Comparative ...
https://pubs.er.usgs.gov/publication/1013997
Phosphorylation of the Adenosine Triphosphatase in a Deoxycholate-Treated Plasma Membrane Fraction from Corn Roots | Plant...Phosphorylation of the Adenosine Triphosphatase in a Deoxycholate-Treated Plasma Membrane Fraction from Corn Roots | Plant...
Phosphorylation of the Adenosine Triphosphatase in a Deoxycholate-Treated Plasma Membrane Fraction from Corn Roots. Donald P. ... Phosphorylation of the Adenosine Triphosphatase in a Deoxycholate-Treated Plasma Membrane Fraction from Corn Roots ... Phosphorylation of the Adenosine Triphosphatase in a Deoxycholate-Treated Plasma Membrane Fraction from Corn Roots ... Phosphorylation of the Adenosine Triphosphatase in a Deoxycholate-Treated Plasma Membrane Fraction from Corn Roots ...
http://www.plantphysiol.org/content/70/5/1459/tab-article-info
Adenosine triphosphatase deficiency - CheckOrphanAdenosine triphosphatase deficiency - CheckOrphan
CheckOrphan is a non-profit organization located in Basel, Switzerland and Santa Cruz, California that is dedicated to rare, orphan and neglected diseases. CheckOrphan offers users an interactive and dynamic platform for all these diseases. This strategy allows visitors to be updated daily on all the latest news and interact with people internationally. This is essential, because due to the nature of these diseases, there is not a large concentration of individuals within any given proximity ...
https://checkorphan.org/disease/adenosine-triphosphatase-deficiency-anemia-due/
Possible mechanism for the inhibition of gastric (H+ + K+)-adenosine triphosphatase by the proton pump inhibitor AG-1749. |...Possible mechanism for the inhibition of gastric (H+ + K+)-adenosine triphosphatase by the proton pump inhibitor AG-1749. |...
Possible mechanism for the inhibition of gastric (H+ + K+)-adenosine triphosphatase by the proton pump inhibitor AG-1749.. H ... Possible mechanism for the inhibition of gastric (H+ + K+)-adenosine triphosphatase by the proton pump inhibitor AG-1749.. H ... Possible mechanism for the inhibition of gastric (H+ + K+)-adenosine triphosphatase by the proton pump inhibitor AG-1749.. H ... Possible mechanism for the inhibition of gastric (H+ + K+)-adenosine triphosphatase by the proton pump inhibitor AG-1749. ...
http://jpet.aspetjournals.org/content/248/2/799
Anemia due to Adenosine triphosphatase deficiency | Genetic and Rare Diseases Information Center (GARD) - an NCATS...Anemia due to Adenosine triphosphatase deficiency | Genetic and Rare Diseases Information Center (GARD) - an NCATS...
... and questions answered by our Genetic and Rare Diseases Information Specialists for Anemia due to Adenosine triphosphatase ... is a searchable database of medical literature and lists journal articles that discuss Anemia due to Adenosine triphosphatase ...
https://rarediseases.info.nih.gov/diseases/548/anemia-due-to-adenosine-triphosphatase-deficiency
Inhibition of Brain Sodium- and Potassium-Stimulated Adenosine Triphosphatase Activity by Chlorpromazine Free Radical |...Inhibition of Brain Sodium- and Potassium-Stimulated Adenosine Triphosphatase Activity by Chlorpromazine Free Radical |...
Inhibition of Brain Sodium- and Potassium-Stimulated Adenosine Triphosphatase Activity by Chlorpromazine Free Radical. TAI ... Inhibition of Brain Sodium- and Potassium-Stimulated Adenosine Triphosphatase Activity by Chlorpromazine Free Radical. TAI ... Inhibition of Brain Sodium- and Potassium-Stimulated Adenosine Triphosphatase Activity by Chlorpromazine Free Radical. TAI ... Inhibition of Brain Sodium- and Potassium-Stimulated Adenosine Triphosphatase Activity by Chlorpromazine Free Radical ...
http://molpharm.aspetjournals.org/content/4/6/600
Structure-Activity Relationships of Cardiotonic Steroids for the Inhibition of Sodium- and Potassium-Dependent Adenosine...Structure-Activity Relationships of Cardiotonic Steroids for the Inhibition of Sodium- and Potassium-Dependent Adenosine...
... and Potassium-Dependent Adenosine Triphosphatase. ATSUNOBU YODA, SHIZUKO YODA and AWNI M. SARRIF ... and Potassium-Dependent Adenosine Triphosphatase. ATSUNOBU YODA, SHIZUKO YODA and AWNI M. SARRIF ... and Potassium-Dependent Adenosine Triphosphatase. II. Association Rate Constants of Various Enzyme-Cardiac Glycoside Complexes ... Structure-Activity Relationships of Cardiotonic Steroids for the Inhibition of Sodium- and Potassium-Dependent Adenosine ...
https://molpharm.aspetjournals.org/content/9/6/766
Get PDF - Electron microscopic studies on renal tubules (Malpighian tubules) in Drosophila melanogaster. V. Localization of Na...Get PDF - Electron microscopic studies on renal tubules (Malpighian tubules) in Drosophila melanogaster. V. Localization of Na...
Studies on the anion-sensitivity, oligomycin-sensitivity and sub-cellular localization of adenosine triphosphatase activity in ... V. Localization of Na-adenosine triphosphatase. Electron microscopic studies on renal tubules (Malpighian tubules) in ... V. Localization of Na-adenosine triphosphatase. Schulte, E.. Zeitschrift für Zellforschung und Mikroskopische Anatomie 133(1): ...
https://eurekamag.com/research/042/983/042983609.php
TriphosphateSodiumMembraneInhibitionCyclic adenosine monVacuolarVascular smoothMonophosphate-activated protein kinaseMitochondrialEnzyme1980ATPase ActivityRenalHydrolysisDeficiencyActivityDescriptorLocalization1982DicyclohexylcarbodiimideKidney1974ProteinsLiverProfilesVariationActivities
Triphosphate9
  • adenosine triphosphate (ATP) Adenosine triphosphate, or ATP, is the primary carrier of energy in cells. (britannica.com)
  • Incubation was carried out with in two different media containing paranitrophenyl phosphate (p-NPP) or adenosine triphosphate (ATP) as substrate. (springer.com)
  • catalyzes the hydrolysis of adenosine triphosphate in the presence of Mg ++ , Na + , and K + . The same preparation catalyzes a Mg ++ -dependent transphosphorylation between adenosine triphosphate and adenosine diphosphate. (sciencemag.org)
  • Deficiency of a chemical (adenosine triphosphate) resulting in anemia. (checkorphan.org)
  • The ATP synthase of mitochondria and chloroplasts is an anabolic enzyme that harnesses the energy of a transmembrane proton gradient as an energy source for adding an inorganic phosphate group to a molecule of adenosine diphosphate (ADP) to form a molecule of adenosine triphosphate (ATP). (wikipedia.org)
  • We established the level of adenosine triphosphate (ATP) release from porcine and normal human bladders. (edu.au)
  • This invention is based in part on the elucidation of new structural conformations and functions of the sodium/potassium adenosine triphosphate synthase (Na/K ATPase), and especially elucidation of new binding sites and interactions. (utoledo.edu)
  • Relationship between the hydrolysis of adenosine triphosphate and oxidative phosphorylation. (springer.com)
  • noun biochemistry A type of enzyme which works to convert adenosine triphosphate ( ATP ) into adenosine diphosphate ( ADP ) and a free phosphate ion, thereby releasing energy to be used in cellular activity. (wordnik.com)
Sodium9
  • Albers RW, Koval CJ (1972) Sodium potassium activated adenosine triphosphatase. (springer.com)
  • Fahn S, Koval GJ, Albers RW (1966) Sodium-potassium-activated adenosine triphosphatase of Electrophorus electric organ. (springer.com)
  • Mac Clurkin IJ (1964) A method for the cytochemical demonstration of sodium potassium activated adenosine triphosphatase. (springer.com)
  • For preliminary purification of the complex, reconstituted F1-F0, prepared from isolated F1 adenosine triphosphatase and depleted membranes, was extracted with sodium deoxycholate and fractionated by salt precipitation. (asm.org)
  • The inhibition of canine renal sodium potassium adenosine triphosphatase (ATPase) by neomycin was examined. (eurekamag.com)
  • Sodium-potassium-activated adenosine triphosphatase activity as a measure of neuronal membrane characteristics in ethanol-tolerant mice. (jax.org)
  • Materials related to sodium/potassium adenosine triphosphatase and Src" by Zi-jian Xie, Qiqi Ye et al. (utoledo.edu)
  • The effect of naloxone on the sodium- and potassium-activated and magnesium-dependent adenosine-5'-triphosphatase (Na+-K+/Mg+2 ATPase, EC.3.6.1.3. (cu.edu.tr)
  • The response of sodium, potassium-adenosine triphosphatase (Na,K-ATPase) to cyclic adenosine monophosphate (cAMP)-dependent protein kinase was examined in membranes obtained from rabbit iris-ciliary body. (elsevier.com)
Membrane6
  • Erythrocyte and plasma Ca2+, Mg2+ and cell membrane adenosine triphosphatase activity in patients with essential hypertension. (nih.gov)
  • To assess the relationships between plasma and intracellular Ca2+, Mg2+ and blood cell membrane adenosine triphosphatase (ATPase) activity in normotensive and hypertensive subjects. (nih.gov)
  • Purification and characterization of the membrane adenosine triphosphatase complex from the wild-type and N,N'-dicyclohexylcarbodiimide-resistant strains of Streptococcus faecalis. (asm.org)
  • We measured the sera levels of malondialdehyde, products of lipid peroxidation, Na+-K+/Mg++ Adenosine 5 triphosphatase (ATPase) and Ca++/Mg++ Adenosine 5 triphosphatase, erythrocyte membrane enzymes, in patients with sickle cell anemia and compared their levels with that of normal controls. (tjh.com.tr)
  • In addition the Na+-Ca++ exchange antiporter appears to be the membrane system which transports Ca++ ions into the neuronal cytoplasm during Na+,K+-adenosine triphosphatase inhibition. (osti.gov)
  • Uvomorulin (E-cadherin), a cell adhesion molecule, and Na + ,K + -adenosine triphosphatase (ATPase), a marker protein of the basal-lateral cell membrane domains of polarized epithelial cells, were investigated in a group of mouse skin tumors induced by a two-stage chemical carcinogenesis protocol and in cell lines derived from mouse skin papillomas and squamous cell carcinomas (SCC). (uthscsa.edu)
Inhibition4
  • Concurent inhibition of Na+K+ adenosine triphosphatase and activation of K+ nitrophenylphosphatase activities. (springer.com)
  • Possible mechanism for the inhibition of gastric (H+ + K+)-adenosine triphosphatase by the proton pump inhibitor AG-1749. (aspetjournals.org)
  • Inhibition from the H+/K+-adenosine triphosphatase (the proton pump) may be the last common mechanistic pathway in lowering gastric acidity secretion pharmacologically. (colinsbraincancer.com)
  • Inhibition of the brain microsomal adenosine triphosphatase by depolarizing agents. (springer.com)
Cyclic adenosine mon1
  • Since these vasodilators activate the adenylate cyclase of vascular smooth muscle, the effects of cyclic adenosine monophosphate (AMP) and theophylline on the Na + , K + ATPase were studied, both substances caused a concentration dependent increase in enzymatic activity. (umn.edu)
Vacuolar6
  • Expression and distribution of renal vacuolar proton-translocating adenosine triphosphatase in response to chronic acid and alkali loads in the rat. (nih.gov)
  • We examined the mechanism of adaptation by analyzing vacuolar proton-translocating adenosine triphosphatase (H+ ATPase) 31-kD subunit protein and mRNA levels, and immunocytochemical distribution in kidneys from rats subjected to acid or alkali loads for 1, 3, 5, 7, and 14 d. (nih.gov)
  • The vacuolar H+ adenosine-triphosphatase (v-ATPase) multisubunit complex is a key regulator of pHi homeostasis. (inserm.fr)
  • Tumor invasiveness and poor clinical outcome are linked to increased expression of cell surface-associated vacuolar adenosine triphosphatases. (jimmunol.org)
  • The a2 isoform vacuolar adenosine triphosphatase is found on the surface on many solid tumors, and we have identified a peptide cleaved from a2 isoform vacuolar adenosine triphosphatase called a2NTD. (jimmunol.org)
  • Potential initiators of cellular cross-talk are vacuolar adenosine triphosphatases (V-ATPases) found on the cell surface of tumors ( 4 , 5 ). (jimmunol.org)
Vascular smooth1
  • Na+, K(+)-adenosine triphosphatase regulation in hypertrophied vascular smooth muscle cells. (ahajournals.org)
Monophosphate-activated protein kinase2
  • The present work investigated the functional role of v-ATPase in primary human HSC (hHSC) activation and its modulation by specific adenosine monophosphate-activated protein kinase (AMPK) subunits. (inserm.fr)
  • It showed a significantly cytotoxic effect in H1975 cells by causing G2 phase arrest, also remarkably activated 5′ adenosine monophosphate-activated protein kinase (AMPK). (mdpi.com)
Mitochondrial1
  • Catalytic site cooperativity of beef heart mitochondrial F1 adenosine triphosphatase--correlation of initial velocity, bound intermediate, and oxygen exchange measurements with an alternating three-site model. (usda.gov)
Enzyme1
  • Enzyme kinetic measurements of the effects of actin on the heavy meromyosin adenosine triphosphatase (ATPase) are used for a study of the binding of heavy meromyosin to actin. (nebraska.edu)
19801
  • Denizot JP (1980) Adenosine triphosphatases (ATP-A) on sensory cell plasmic membranes of tuberous organs (electroreceptors) of Gnathonemus petersii (Mormyridae). (springer.com)
ATPase Activity3
  • To investigate the correlation between diffusion-weighted (DW) magnetic resonance (MR) image changes with alterations in extracellular volume and changes in cytochrome oxidase and Na(+)-K(+)-adenosine triphosphatase (ATPase) activity at various times during and after cerebral hypoxia-ischemia in neonatal and juvenile rats. (nih.gov)
  • Even if the pathogenesis of diabetic neuropathy is incompletely understood, an impaired Na/K adenosine triphosphatase (ATPase) activity has been involved in this pathogenesis. (cdc.gov)
  • Adenosine triphosphatase (ATPase) activity of human cataractous lenses. (bvsalud.org)
Renal1
  • Osore, H 1979, ' A Na + -activated Mg 2+ -dependent renal adenosine triphosphatase (Na + -ATPase) sensitive to aldosterone ', Biochemical Pharmacology , vol. 28, no. 18, pp. 2865-2866. (hw.ac.uk)
Hydrolysis1
  • adenosine triphosphatase: any of several enzymes that catalyze the hydrolysis of ATP to ADP and phosphate. (dictionary.com)
Deficiency5
  • The symptom information on this page attempts to provide a list of some possible signs and symptoms of Adenosine triphosphatase deficiency, anaemia due to . (rightdiagnosis.com)
  • This signs and symptoms information for Adenosine triphosphatase deficiency, anaemia due to has been gathered from various sources, may not be fully accurate, and may not be the full list of Adenosine triphosphatase deficiency, anaemia due to signs or Adenosine triphosphatase deficiency, anaemia due to symptoms. (rightdiagnosis.com)
  • Furthermore, signs and symptoms of Adenosine triphosphatase deficiency, anaemia due to may vary on an individual basis for each patient. (rightdiagnosis.com)
  • Only your doctor can provide adequate diagnosis of any signs or symptoms and whether they are indeed Adenosine triphosphatase deficiency, anaemia due to symptoms. (rightdiagnosis.com)
  • PubMed is a searchable database of medical literature and lists journal articles that discuss Anemia due to Adenosine triphosphatase deficiency. (nih.gov)
Activity2
  • Enhanced na+-k+-activated adenosine triphosphatase activity in trans- formed fibroblasts. (jax.org)
  • 1 In addition, it is thought that PKC stimulation also may lead indirectly to decreases in Na + -K + adenosine triphosphatase (NKase) activity. (asahq.org)
Descriptor1
  • Adenosine Triphosphatases" is a descriptor in the National Library of Medicine's controlled vocabulary thesaurus, MeSH (Medical Subject Headings) . (harvard.edu)
Localization2
  • Farquhar MG, Palade GE (1966) Adenosine triphosphatase localization in amphibian epidermis. (springer.com)
  • Jacobsen NO, Jorgensen PL (1969) A quantitative biochemical and histochemical study of the lead method for localization of adenosine triphosphatase hydrolysing enzymes. (springer.com)
19821
  • Denizot JP (1982) Adenosine triphosphatases in electroreceptor organs (ampullary organs and mormyromasts) of Gnathonemus petersii . (springer.com)
Dicyclohexylcarbodiimide1
  • We have purified the F1-F0 adenosine triphosphatase complex from wild-type Streptococcus faecalis ATCC 9790 and an N,N'-dicyclohexylcarbodiimide (DCCD)-resistant mutant strain, SF-dcc-8. (asm.org)
Kidney1
  • The distribution of the reaction product of a staining method for adenosine triphosphatase (ATPase) in rat small intestine, kidney, and liver was studied with electron microscopy. (rupress.org)
19741
  • Guth L, Albers RW (1974) Histochemical demonstration of (Na++K+) activated adenosine triphosphatase. (springer.com)
Proteins1
  • Both the DCCD-sensitive and the DCCD-resistant F1-F0 adenosine triphosphatase appeared to consist of eight proteins, five of which corresponded to the F1 subunits alpha, beta,, gamma, delta, and epsilon. (asm.org)
Liver1
  • Adenosine triphosphatase of rat liver mitochondria. (nih.gov)
Profiles2
  • This graph shows the total number of publications written about "Adenosine Triphosphatases" by people in Harvard Catalyst Profiles by year, and whether "Adenosine Triphosphatases" was a major or minor topic of these publication. (harvard.edu)
  • Below are the most recent publications written about "Adenosine Triphosphatases" by people in Profiles. (harvard.edu)
Variation1
  • DNA variation in the genes of the Na,K-adenosine triphosphatase and its relation with resting metabolic rate, respiratory quotient, and body fat. (jci.org)
Activities1
  • Ernst SA, Philpott CW (1970) Preservation of NaK activated and Mg-activated adenosine triphosphatase activities of avian salt gland and teleost gill with formaldehyde as fixative. (springer.com)