Chemicals and Drugs
Adenosine TriphosphatasesMagnesiumAdenosineAcid Anhydride HydrolasesReceptor, Adenosine A2ANucleoside-TriphosphataseReceptor, Adenosine A1Adenosine Deaminaserac GTP-Binding ProteinsReceptor, Adenosine A3GTP PhosphohydrolasesReceptor, Adenosine A2BAdenosine Kinasecdc42 GTP-Binding ProteinReceptors, Adenosine A2Adenosine A2 Receptor Agonistsrho GTP-Binding ProteinsAdenosine A2 Receptor AntagonistsReceptors, Purinergic P1Adenosine A1 Receptor Antagonistsrac1 GTP-Binding ProteinAdenosine A1 Receptor AgonistsNucleotidyltransferasesPurinergic P1 Receptor AntagonistsGuanine Nucleotide Exchange FactorsXanthinesPurinergic P1 Receptor AgonistsAdenosine Monophosphate
Adenosine Triphosphatases
A group of enzymes which catalyze the hydrolysis of ATP. The hydrolysis reaction is usually coupled with another function such as transporting Ca(2+) across a membrane. These enzymes may be dependent on Ca(2+), Mg(2+), anions, H+, or DNA.
Magnesium
A metallic element that has the atomic symbol Mg, atomic number 12, and atomic weight 24.31. It is important for the activity of many enzymes, especially those involved in OXIDATIVE PHOSPHORYLATION.
Adenosine
A nucleoside that is composed of ADENINE and D-RIBOSE. Adenosine or adenosine derivatives play many important biological roles in addition to being components of DNA and RNA. Adenosine itself is a neurotransmitter.
Acid Anhydride Hydrolases
A group of enzymes that catalyze the hydrolysis of diphosphate bonds in compounds such as nucleoside di- and tri-phosphates, and sulfonyl-containing anhydrides such as adenylylsulfate. (Enzyme Nomenclature, 1992) EC 3.6.
Receptor, Adenosine A2A
A subclass of adenosine A2 receptors found in LEUKOCYTES, the SPLEEN, the THYMUS and a variety of other tissues. It is generally considered to be a receptor for ADENOSINE that couples to the GS, STIMULATORY G-PROTEIN.
Nucleoside-Triphosphatase
An enzyme which catalyzes the hydrolysis of nucleoside triphosphates to nucleoside diphosphates. It may also catalyze the hydrolysis of nucleotide triphosphates, diphosphates, thiamine diphosphates and FAD. The nucleoside triphosphate phosphohydrolases I and II are subtypes of the enzyme which are found mostly in viruses.
Receptor, Adenosine A1
A subtype of ADENOSINE RECEPTOR that is found expressed in a variety of tissues including the BRAIN and DORSAL HORN NEURONS. The receptor is generally considered to be coupled to the GI, INHIBITORY G-PROTEIN which causes down regulation of CYCLIC AMP.
Adenosine Deaminase
An enzyme that catalyzes the hydrolysis of ADENOSINE to INOSINE with the elimination of AMMONIA.
rac GTP-Binding Proteins
A sub-family of RHO GTP-BINDING PROTEINS that is involved in regulating the organization of cytoskeletal filaments. This enzyme was formerly listed as EC 3.6.1.47.
Receptor, Adenosine A3
A subtype of ADENOSINE RECEPTOR that is found expressed in a variety of locations including the BRAIN and endocrine tissues. The receptor is generally considered to be coupled to the GI, INHIBITORY G-PROTEIN which causes down regulation of CYCLIC AMP.
GTP Phosphohydrolases
Enzymes that hydrolyze GTP to GDP. EC 3.6.1.-.
Receptor, Adenosine A2B
A subclass of adenosine A2 receptors found in the CECUM, the COLON, the BLADDER, and a variety of other tissues. It is generally considered to be a low affinity receptor for ADENOSINE that couples to the GS, STIMULATORY G-PROTEIN.
Adenosine Kinase
An enzyme that catalyzes the formation of ADP plus AMP from adenosine plus ATP. It can serve as a salvage mechanism for returning adenosine to nucleic acids. EC 2.7.1.20.
cdc42 GTP-Binding Protein
A member of the Rho family of MONOMERIC GTP-BINDING PROTEINS. It is associated with a diverse array of cellular functions including cytoskeletal changes, filopodia formation and transport through the GOLGI APPARATUS. This enzyme was formerly listed as EC 3.6.1.47.
Receptors, Adenosine A2
A subclass of ADENOSINE RECEPTORS that are generally considered to be coupled to the GS, STIMULATORY G-PROTEIN which causes up regulation of CYCLIC AMP.
Adenosine A2 Receptor Agonists
Compounds that selectively bind to and activate ADENOSINE A2 RECEPTORS.
rho GTP-Binding Proteins
A large family of MONOMERIC GTP-BINDING PROTEINS that are involved in regulation of actin organization, gene expression and cell cycle progression. This enzyme was formerly listed as EC 3.6.1.47.
Adenosine A2 Receptor Antagonists
Compounds that selectively bind to and block the activation of ADENOSINE A2 RECEPTORS.
Receptors, Purinergic P1
A class of cell surface receptors that prefer ADENOSINE to other endogenous PURINES. Purinergic P1 receptors are widespread in the body including the cardiovascular, respiratory, immune, and nervous systems. There are at least two pharmacologically distinguishable types (A1 and A2, or Ri and Ra).
Adenosine A1 Receptor Antagonists
Compounds that bind to and block the stimulation of ADENOSINE A1 RECEPTORS.
rac1 GTP-Binding Protein
A rac GTP-binding protein involved in regulating actin filaments at the plasma membrane. It controls the development of filopodia and lamellipodia in cells and thereby influences cellular motility and adhesion. It is also involved in activation of NADPH OXIDASE. This enzyme was formerly listed as EC 3.6.1.47.
Adenosine A1 Receptor Agonists
Compounds that bind to and stimulate ADENOSINE A1 RECEPTORS.
Nucleotidyltransferases
A class of enzymes that transfers nucleotidyl residues. EC 2.7.7.
Purinergic P1 Receptor Antagonists
Compounds that bind to and block the stimulation of PURINERGIC P1 RECEPTORS.
Guanine Nucleotide Exchange Factors
Protein factors that promote the exchange of GTP for GDP bound to GTP-BINDING PROTEINS.
Xanthines
Purine bases found in body tissues and fluids and in some plants.
Purinergic P1 Receptor Agonists
Compounds that bind to and stimulate PURINERGIC P1 RECEPTORS.
Adenosine Monophosphate
Adenine nucleotide containing one phosphate group esterified to the sugar moiety in the 2'-, 3'-, or 5'-position.

Membrane deinsertion of SecA underlying proton motive force-dependent stimulation of protein translocation. (1/12201)

The proton motive force (PMF) renders protein translocation across the Escherichia coli membrane highly efficient, although the underlying mechanism has not been clarified. The membrane insertion and deinsertion of SecA coupled to ATP binding and hydrolysis, respectively, are thought to drive the translocation. We report here that PMF significantly decreases the level of membrane-inserted SecA. The prlA4 mutation of SecY, which causes efficient protein translocation in the absence of PMF, was found to reduce the membrane-inserted SecA irrespective of the presence or absence of PMF. The PMF-dependent decrease in the membrane-inserted SecA caused an increase in the amount of SecA released into the extra-membrane milieu, indicating that PMF deinserts SecA from the membrane. The PMF-dependent deinsertion reduced the amount of SecA required for maximal translocation activity. Neither ATP hydrolysis nor exchange with external SecA was required for the PMF-dependent deinsertion of SecA. These results indicate that the SecA deinsertion is a limiting step of protein translocation and is accelerated by PMF, efficient protein translocation thereby being caused in the presence of PMF.  (+info)

Stable remodeling of tailless nucleosomes by the human SWI-SNF complex. (2/12201)

The histone N-terminal tails have been shown previously to be important for chromatin assembly, remodeling, and stability. We have tested the ability of human SWI-SNF (hSWI-SNF) to remodel nucleosomes whose tails have been cleaved through a limited trypsin digestion. We show that hSWI-SNF is able to remodel tailless mononucleosomes and nucleosomal arrays, although hSWI-SNF remodeling of tailless nucleosomes is less effective than remodeling of nucleosomes with tails. Analogous to previous observations with tailed nucleosomal templates, we show both (i) that hSWI-SNF-remodeled trypsinized mononucleosomes and arrays are stable for 30 min in the remodeled conformation after removal of ATP and (ii) that the remodeled tailless mononucleosome can be isolated on a nondenaturing acrylamide gel as a novel species. Thus, nucleosome remodeling by hSWI-SNF can occur via interactions with a tailless nucleosome core.  (+info)

Arginine methylation and binding of Hrp1p to the efficiency element for mRNA 3'-end formation. (3/12201)

Hrp1p is a heterogeneous ribonucleoprotein (hnRNP) from the yeast Saccharomyces cerevisiae that is involved in the cleavage and polyadenylation of the 3'-end of mRNAs and mRNA export. In addition, Hrplp is one of several RNA-binding proteins that are posttranslationally modified by methylation at arginine residues. By using functional recombinant Hrp1p, we have identified RNA sequences with specific high affinity binding sites. These sites correspond to the efficiency element for mRNA 3'-end formation, UAUAUA. To examine the effect of methylation on specific RNA binding, purified recombinant arginine methyltransferase (Hmt1p) was used to methylate Hrp1p. Methylated Hrp1p binds with the same affinity to UAUAUA-containing RNAs as unmethylated Hrpl p indicating that methylation does not affect specific RNA binding. However, RNA itself inhibits the methylation of Hrp1p and this inhibition is enhanced by RNAs that specifically bind Hrpl p. Taken together, these data support a model in which protein methylation occurs prior to protein-RNA binding in the nucleus.  (+info)

The Golgi apparatus plays a significant role in the maintenance of Ca2+ homeostasis in the vps33Delta vacuolar biogenesis mutant of Saccharomyces cerevisiae. (4/12201)

The vacuole is the major site of intracellular Ca2+ storage in yeast and functions to maintain cytosolic Ca2+ levels within a narrow physiological range. In this study, we examined how cellular Ca2+ homeostasis is maintained in a vps33Delta vacuolar biogenesis mutant. We found that growth of the vps33Delta strain was sensitive to high or low extracellular Ca2+. This strain could not properly regulate cytosolic Ca2+ levels and was able to retain only a small fraction of its total cellular Ca2+ in a nonexchangeable intracellular pool. Surprisingly, the vps33Delta strain contained more total cellular Ca2+ than the wild type strain. Because most cellular Ca2+ is normally found within the vacuole, this suggested that other intracellular compartments compensated for the reduced capacity to store Ca2+ within the vacuole of this strain. To test this hypothesis, we examined the contribution of the Golgi-localized Ca2+ ATPase Pmr1p in the maintenance of cellular Ca2+ homeostasis. We found that a vps33Delta/pmr1Delta strain was hypersensitive to high extracellular Ca2+. In addition, certain combinations of mutations effecting both vacuolar and Golgi Ca2+ transport resulted in synthetic lethality. These results indicate that the Golgi apparatus plays a significant role in maintaining Ca2+ homeostasis when vacuolar biogenesis is compromised.  (+info)

Deletion mutation analysis of the mutS gene in Escherichia coli. (5/12201)

The MutS protein is part of the dam-directed MutHLS mismatch repair pathway in Escherichia coli. We have constructed deletion derivatives in the mutS gene, which retain the P-loop coding region for ATP binding. The mutant proteins were assayed for ATP hydrolysis, heteroduplex DNA binding, heterodimer MutS formation, and the ability to interact with MutL. Dimerization was assayed by expressing His6-tagged wild-type and non-tagged deletion mutant proteins in the same cell and isolating the His6-tagged protein followed by MutS immunoblotting after SDS-polyacrylamide gel electrophoresis. MutS-MutL interaction was measured using the same technique except that the MutL protein carried the His6 tag. Our results indicate that DNA binding ability resides in the N-terminal end of MutS, and dimerization and MutL interactions are located in the C-terminal end. Given the extensive amino acid homology in the MutS family our results with E. coli should be applicable to MutS homologues in other prokaryotes and eukaryotes.  (+info)

Evolutionary dynamics of a mitochondrial rearrangement "hot spot" in the Hymenoptera. (6/12201)

The arrangement of tRNA genes at the junction of the cytochrome oxidase II and ATPase 8 genes was examined across a broad range of Hymenoptera. Seven distinct arrangements of tRNA genes were identified among a group of wasps that have diverged over the last 180 Myr (suborder Apocrita); many of the rearrangements represent evolutionarily independent events. Approximately equal proportions of local rearrangements, inversions, and translocations were observed, in contrast to vertebrate mitochondria, in which local rearrangements predominate. Surprisingly, homoplasy was evident among certain types of rearrangement; a reversal of the plesiomorphic gene order has arisen on three separate occasions in the Insecta, while the tRNA(H) gene has been translocated to this locus on two separate occasions. Phylogenetic analysis indicates that this gene translocation is real and is not an artifactual translocation resulting from the duplication of a resident tRNA gene followed by mutation of the anticodon. The nature of the intergenic sequences surrounding this region does not indicate that it should be especially prone to rearrangement; it does not generally have the tandem or inverted repeats that might facilitate this plasticity. Intriguingly, these findings are consistent with the view that during the evolution of the Hymenoptera, rearrangements increased at the same time that the rate of point mutations and compositional bias also increased. This association may direct investigations into mitochondrial genome plasticity in other invertebrate lineages.  (+info)

Characterisation of copper-binding to the second sub-domain of the Menkes protein ATPase (MNKr2). (7/12201)

The Menkes ATPase (MNK) has an essential role in the translocation of copper across cellular membranes. In a complementary manner, the intracellular concentration of copper regulates the activity and cellular location of the ATPase through its six homologous amino-terminal domains. The roles of the six amino-terminal domains in the activation and cellular trafficking processes are unknown. Understanding the role of these domains relies on the development of an understanding of their metal-binding properties and structural properties. The second conserved sub-domain of MNK was over-expressed, purified and its copper-binding properties characterised. Reconstitution studies demonstrate that copper binds to MNKr2 as Cu(I) with a stoichiometry of one copper per domain. This is the first direct evidence of copper-binding to the MNK amino-terminal repeats. Circular dichroism studies suggest that the binding or loss of copper to MNKr2 does not cause substantial changes to the secondary structure of the protein.  (+info)

The interaction of the human MutL homologues in hereditary nonpolyposis colon cancer. (8/12201)

Germline mutations in two human mismatch repair (MMR) genes, hMSH2 and hMLH1, appear to account for approximately 70% of the common cancer susceptibility syndrome hereditary nonpolyposis colorectal cancer (HNPCC). Although the hMLH1 protein has been found to copurify with another MMR protein hPMS2 as a heterodimer, their function in MMR is unknown. In this study, we have identified the physical interaction regions of both hMLH1 with hPMS2. We then examined the effects of hMLH1 missense alterations found in HNPCC kindreds for their interaction with hPMS2. Four of these missense alterations (L574P, K616Delta, R659P, and A681T) displayed >95% reduction in binding to hPMS2. Two additional missense alterations (K618A and K618T) displayed a >85% reduction in binding to hPMS2, whereas three missense alterations (S44F, V506A, and E578G) displayed 25-65% reduction in binding to hPMS2. Interestingly, two HNPCC missense alterations (Q542L and L582V) contained within the consensus interaction region displayed no effect on interaction with hPMS2, suggesting that they may affect other functions of hMLH1. These data confirm that functional deficiencies in the interaction of hMLH1 with hPMS2 are associated with HNPCC as well as suggest that other unknown functional alteration of the human MutL homologues may lead to tumorigenesis in HNPCC kindreds.  (+info)

Interactions of Phospholipids with Sodium-plus-Potassium Ion-Dependent Adenosine Triphosphatase | Biochemical Society...Interactions of Phospholipids with Sodium-plus-Potassium Ion-Dependent Adenosine Triphosphatase | Biochemical Society...
MARTA ISERN DE CALDENTEY, KENNETH P. WHEELER; Interactions of Phospholipids with Sodium-plus-Potassium Ion-Dependent Adenosine Triphosphatase. Biochem Soc Trans 1 February 1977; 5 (1): 107-108. doi: https://doi.org/10.1042/bst0050107. Download citation file:. ...
https://portlandpress.com/biochemsoctrans/article-abstract/5/1/107/89034/Interactions-of-Phospholipids-with-Sodium-plus?redirectedFrom=fulltext
Vectorial aspects of adenosine-triphosphatase activity in erythrocyte membranes | Biochemical JournalVectorial aspects of adenosine-triphosphatase activity in erythrocyte membranes | Biochemical Journal
Thank you for your interest in spreading the word about Biochemical Journal.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
http://www.biochemj.org/content/93/2/337
Phosphate binding by cerebral microsomes in relation to adenosine-triphosphatase activity | Biochemical JournalPhosphate binding by cerebral microsomes in relation to adenosine-triphosphatase activity | Biochemical Journal
Thank you for your interest in spreading the word about Biochemical Journal.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
http://www.biochemj.org/content/101/2/502
Browsing Annual Medical Student Research Forum by Subject Adenosine TriphosphatasesBrowsing Annual Medical Student Research Forum by Subject Adenosine Triphosphatases
BACKGROUND: Neurons can survive for decades via cell maintenance and protein degradation. This process includes the general protein endolysosomal degradation pathway, an integral part of which is the Rab GTPase proteins ...
https://utswmed-ir.tdl.org/handle/2152.5/1482/browse?type=subject&value=Adenosine+Triphosphatases
Sodium-potassium-activated adenosine triphosphatase activity as a meas by M Levental and B TabakoffSodium-potassium-activated adenosine triphosphatase activity as a meas by M Levental and B Tabakoff
Levental, M and Tabakoff, B, Sodium-potassium-activated adenosine triphosphatase activity as a measure of neuronal membrane characteristics in ethanol-tolerant mice. (1980). Subject Strain Bibliography 1980. 2608 ...
https://mouseion.jax.org/ssbb1980/2608/
Enhanced na+-k+-activated adenosine triphosphatase activity in trans- by L B. Kasarov and H FriedmanEnhanced na+-k+-activated adenosine triphosphatase activity in trans- by L B. Kasarov and H Friedman
Kasarov, L B. and Friedman, H, Enhanced na+-k+-activated adenosine triphosphatase activity in trans- formed fibroblasts. (1974). Subject Strain Bibliography 1974. 1678 ...
https://mouseion.jax.org/ssbb1974/1678/
A Fragment-Based Ligand Screen Against Part of a Large Protein Machine: The ND1 Domains of the AAA+ ATPase p97/VCP. | Sigma...A Fragment-Based Ligand Screen Against Part of a Large Protein Machine: The ND1 Domains of the AAA+ ATPase p97/VCP. | Sigma...
Sigma-Aldrich offers abstracts and full-text articles by [Michael S Chimenti, Stacie L Bulfer, R Jeffrey Neitz, Adam R Renslo, Matthew P Jacobson, Thomas L James, Michelle R Arkin, Mark J S Kelly].
https://www.sigmaaldrich.com/catalog/papers/25690569
Microtubule-severing protein Katanin regulates neuromuscular junction development and dendritic elaboration in Drosophila. |...Microtubule-severing protein Katanin regulates neuromuscular junction development and dendritic elaboration in Drosophila. |...
Sigma-Aldrich offers abstracts and full-text articles by [Chuan-Xi Mao, Ying Xiong, Zhaohuan Xiong, Qifu Wang, Yong Q Zhang, Shan Jin].
https://www.sigmaaldrich.com/catalog/papers/24550114
Atp13a5 - Probable cation-transporting ATPase 13A5 - Mus musculus (Mouse) - Atp13a5 gene & proteinAtp13a5 - Probable cation-transporting ATPase 13A5 - Mus musculus (Mouse) - Atp13a5 gene & protein
integral component of plasma membrane, intracellular membrane-bounded organelle, calcium-transporting ATPase activity, cellular calcium ion homeostasis
http://www.uniprot.org/uniprot/Q3TYU2
AID 299465 - Inhibition of MKLP1 assessed as inhibition ATP hydrolysis by ATPase assay at 20 uM - PubChemAID 299465 - Inhibition of MKLP1 assessed as inhibition ATP hydrolysis by ATPase assay at 20 uM - PubChem
BioAssay record AID 299465 submitted by ChEMBL: Inhibition of MKLP1 assessed as inhibition ATP hydrolysis by ATPase assay at 20 uM.
https://pubchem.ncbi.nlm.nih.gov/bioassay/299465
Razvoj metode za mjerenje aktivnosti ekto-ATPaze u serumu čovjeka | Repozitorij Farmaceutsko-biokemijskog fakulteta Sveučilišta...Razvoj metode za mjerenje aktivnosti ekto-ATPaze u serumu čovjeka | Repozitorij Farmaceutsko-biokemijskog fakulteta Sveučilišta...
Ecto-ATPase is an enzyme which belongs to the group of the E-NTPDases. Those enzymes are ectoenzymes, and that they participate in the metabolism of extracellular molecules. Ecto-ATPase participate in metabolism of nucleoside triphosphate and nucleoside diphosphate with higher affinity for the nucleoside triphosphate. The metabolism of extracellular molecules with the appropriate enzymes is one of the steps in purinergic signaling that mediates a variety of physiological and pathophysiological processes. Therefore it is considered that value of ecto-ATPase activity in human serum may be a potential factor in the diagnosis of diseases associated with purinergic signaling. Ecto-ATPase activity in the human serum was measured by Fiske-Subbarow method, and the average value of 13 healthy samples was 992.3±281.2 nmol/ml/h. Results showed that the most suitable sample volume for the measuring enzyme activity is 50 μL, incubation time on 37 °C is 60 min and that 100 μL 1.12 mol/L TCA is required ...
https://repozitorij.pharma.unizg.hr/islandora/object/pharma%3A47
Efecto antioxidante de nuevo esteroide sintético (4-cloro-17ð-acetoxi-4-pregnen-3,20-diona) en cerebro de ratas adultas
The aim of the present study was to evaluate the antioxidant effect of a new steroid (4-chloro-17α-acetoxy-4-pregnene-3,20-dione) in rat brain. Twelve adults rats of 500g were randomly distributed in groups of 6 that were treated with 4-chloro-17α-acetoxy-4-pregnene-3,20-dione (4 mg/kg/day), or vehicle, administered during 5 days. At the end of treatment all animals were sacrificed and the GSH levels in the brain were measured by fluorescence method, as well as lipid peroxidation (TBARS), Na+,K+-ATPase and total ATPase enzymatic activity by spectrophotometry methods. Na+,K+-ATPase and total ATPase activities increased, only the total ATPase activity increase was significant as compared to the control group ( ...
http://connection.ebscohost.com/c/articles/25576284/efecto-antioxidante-de-nuevo-esteroide-sint-tico-4-cloro-17-acetoxi-4-pregnen-3-20-diona-en-cerebro-de-ratas-adultas
CCNA1 protein (human) - STRING interaction networkCCNA1 protein (human) - STRING interaction network
DNA replication licensing factor MCM6; Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for once per cell cycle DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differential ...
https://string-db.org/network/9606.ENSP00000255465
VPS4A antibody | acris-antibodies.com
VPS4A is a member of the AAA protein family (ATPases associated with diverse cellular activities), and is the homolog of the yeast Vps4 protein. In…
https://www.acris-antibodies.com/target/vps4a-antibody.htm
ATPaza presecanja mikrotubula - Википедија, слободна енциклопедијаATPaza presecanja mikrotubula - Википедија, слободна енциклопедија
Hartman, J.J., Mahr, J., McNally, K., Okawa, K., Iwamatsu, A., Thomas, S., Cheesman, S., Heuser, J., Vale, R.D. and McNally, F.J. (1998). „Katanin, a microtubule-severing protein, is a novel AAA ATPase that targets to the centrosome using a WD40-containing subunit. Cell. 93: 277-287. PMID 9568719 ...
https://sr.wikipedia.org/wiki/ATPaza_presecanja_mikrotubula
RCSB PDB - Protein Feature View - Putative ATPase, AAA family - Q7V3J8 (Q7V3J8 PROMP)RCSB PDB - Protein Feature View - Putative ATPase, AAA family - Q7V3J8 (Q7V3J8 PROMP)
The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex assemblies. As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
http://www.rcsb.org/pdb/protein/Q7V3J8
The yeast secretory pathway is perturbed by mutations in PMR1, a member of a Ca2+ ATPase familyThe yeast secretory pathway is perturbed by mutations in PMR1, a member of a Ca2+ ATPase family
The genes for two new P-type ATPases, PMR1 and PMR2, have been identified in yeast. A comparison of the deduced sequences of the PMR proteins with other known ion pumps showed that both proteins are very similar to Ca2+ ATPases. PMR1 is identical to SSC1, a gene previously identified by its effect o …
https://pubmed.ncbi.nlm.nih.gov/2526682/?dopt=Abstract
anti-ATAD3A antibody | GeneTexanti-ATAD3A antibody | GeneTex
ATAD3A antibody (ATPase family, AAA domain containing 3A) for IHC-P, WB. Anti-ATAD3A pAb (GTX116301) is tested in Human samples. 100% Ab-Assurance.
http://www.genetex.com/ATAD3A-antibody-GTX116301.html
EMBL: CP001115.PARA
CP001115.PARA Location/Qualifiers FT CDS_pept 204..965 FT /codon_start=1 FT /transl_table=11 FT /gene=parA FT /locus_tag=Deide_1p00010 FT /product=putative ATPase involved in plasmid/chromosome FT partitioning FT /db_xref=EnsemblGenomes-Gn:Deide_1p00010 FT /db_xref=EnsemblGenomes-Tr:ACO47390 FT /db_xref=InterPro:IPR025669 FT /db_xref=InterPro:IPR027417 FT /db_xref=UniProtKB/TrEMBL:C1D1V1 FT /protein_id=ACO47390.2 FT /translation=MITATVFNHAGGAGKTSIVRDVGYELARQGQRVLVVDLDPQANLT FT AWLGVVDVQMEQTVYQVATEGAELPEPVAVHGLHLIPSQVDLALAETGMLGVPGSQLFL FT QQALRTVQDRYDLVLVDSPPSVGQLAILGAAAADRLIVPVPTRTKGLNALPGLQKATNL FT YRRLRPELAMGLYVPTMYDARRTHDREVLALLRQHLSPLAEPVPERAAVWLDSTMAGEP FT VGVYKAGSPAHQDVLRLTDEVARSLGLKVNA atgatcacag cgaccgtgtt caaccacgcg ggtggtgcag gcaagaccag catcgtccgc 60 gacgtcggtt atgaattggc ccgccagggc cagcgcgttc tggtagtgga cctcgatcca 120 caggccaacc tcaccgcatg gctgggtgtg gttgacgtgc agatggagca gacggtgtat 180 caagtcgcca cagaaggtgc tgagcttcca gagcctgtcg ccgttcacgg acttcacctg 240 ...
http://pbil.univ-lyon1.fr/cgi-bin/acnuc-search-id?query=CP001115.PARA&db=EMBL&ident=ACNUC7421
Ubxn10 MGI Mouse Gene Detail - MGI:2443123 - UBX domain protein 10Ubxn10 MGI Mouse Gene Detail - MGI:2443123 - UBX domain protein 10
View mouse Ubxn10 Chr4:138709837-138737167 with: phenotypes, sequences, polymorphisms, proteins, references, function, expression
http://www.informatics.jax.org/marker/MGI:2443123
sodium:potassium-exchanging ATPase complex QuickView - Correlation Engine
Sodium:potassium-exchanging ATPases are tetrameric proteins, consisting of two large alpha subunits and two smaller beta subunits. The alpha subunits bear the active site and penetrate the membrane, while the beta subunits carry oligosaccharide groups and…
http://www.nextbio.com/b/search/ov/sodium:potassium-exchanging%20ATPase%20complex?id=34081&type=biogroup
Testing nucleotide-protein interaction - Biochemistry - BioForumTesting nucleotide-protein interaction - Biochemistry - BioForum
Testing nucleotide-protein interaction - posted in Biochemistry: Hi everybody I work with an intrinsically disordered protein with unknown function and no close homologs. Psi Blasts show some low degree of homology to ATPsaes, but with e-values above cutoff. Motif searches predict an incomplete Walker A motif. If so, only the GKS motif is conserved, but not the P-loop. The protein forms a stable complex with Ca-calmodulin. I tried atpase assays, but there was no activity. Upon addition...
http://www.protocol-online.org/forums/topic/29592-testing-nucleotide-protein-interaction/
SPAST DICDI » Spastin - Membranome database
MLFDLINSFL KNGINNSNNN NNNNNNKNNF YNSLEDDDYL LNNQTTKVSL YLYFFIFAFM FLVVDLIMLY YKHRENIESR ETDLSLKLNK MLIDFENDNK IKSSPTTSTT TTTITPTTTS SSQLRQPSTP KTTTKTINSP PSTPKSPPPL PSLESKLLYK DDIKQQLSLN EAKSQIDSAK QLDESLKYNS CIKLYIDGIE KLMALFSSYN SKEYRDYIDF YLKRAEYLKN ELKKGTNLKS ITNFNNFSKE YQINYNNKIL EQQQQQQQQS SSTYRNSLNL SSSKSNSTIN NRHSISSLSS LNSTTATTTT PSNTSTITSP GNKYGLQKSL SSTTLSLKKS SNSTNFQQPS PPSMVIPDIK GIDKSMVTLI MNEIMDRKNP VKWDDVVGLD KVKQSLMESV ILPNLRPDVF TGLRAPPKGL LLFGPPGNGK TMIAKAVAYE SKVTFFSISS SSLTSKYVGD GEKLVRALFA VATHFQPSII FIDEIDSLLT ERSSNESEAS RRLKTEILVQ FDGARTNGDE RVLVMGATNR PEDLDDAALR RLVKRIYVGL PELETRLQII QHLLVGQRHS LTKQQINSLA EVTQGYSGFD LAALCKDAAY EPIRRLGIGI KDLELNEISL ISFKDFANSL KQIRPSVTSQ SLKSFEKWNQ KFGTI ...
http://membranome.org/protein.php?pdbid=SPAST_DICDI
View gene SPAST - SpainMDB
We have used all reasonable efforts to ensure that the information displayed on these pages and contained in the databases is of high quality. We make no warranty, express or implied, as to its accuracy or that the information is fit for a particular purpose, and will not be held responsible for any consequences arising out of any inaccuracies or omissions. Individuals, organisations and companies which use this database do so on the understanding that no liability whatsoever either direct or indirect shall rest upon the curator(s) or any of their employees or agents for the effects of any product, process or method that may be produced or adopted by any part, notwithstanding that the formulation of such product, process or method may be based upon information here provided ...
https://lovd3.isciii.es/genes/SPAST
Fluorescein Analogues Inhibit SecA ATPase: The First Sub-micromolar Inhibitor of Bacterial Protein Translocation - Huang - 2012...Fluorescein Analogues Inhibit SecA ATPase: The First Sub-micromolar Inhibitor of Bacterial Protein Translocation - Huang - 2012...
SecA is a central component of the general secretion system that is essential for bacterial growth and thus an ideal target for antimicrobial agents. A series of fluorescein analogues were first screened against the ATPase activity using the truncated unregulated SecA catalytic domain. Rose bengal (RB) and erythrosin B (EB) were found to be potent inhibitors SecA with IC50 values of 0.5 μM and 2 μM, respectively. RB and EB inhibit the catalytic SecA ATPase more effectively than the F1F0-proton ATPase. We used three assays to test the effect of these compounds on full-length SecA ATPase: in solution (intrinsic ATPase), in membrane preparation, and translocation ATPase. RB and EB show the following trend in terms of IC50 values: translocation ATPase,membrane ATPase,intrinsic ATPase. Very importantly, the potency of these fluorescein analogues in inhibiting the truncated SecA ATPase correlates with their ability to inhibit the biologically relevant protein translocation activity of SecA. The in ...
http://onlinelibrary.wiley.com/doi/10.1002/cmdc.201100594/full
Plus itPlus it
A cell surface-located nucleoside triphosphatase activity can be assayed in liver epithelial cultures in situ with the incubation of intact cells in a medium containing [γ-32P]adenosine triphosphate and correlated with the tumorigenicity of these cells in neonatal Wistar rats. The ectoenzyme activity of normal diploid cell lines is minimal, whereas a considerably high activity has been found in all tumorigenic cell lines tested. The optimum condition for the adenosinetriphosphatase activity is physiological with regard to osmolarity, ionic composition, pH, and substrate concentration in the medium. The enzyme is significantly stimulated by Ca2+, and its activation is controlled by Mg2+. Histochemical examinations indicate that glutaraldehyde-fixed cells of tumorigenic lines have Ca2+-stimulated adenosinetriphosphatase activity on the external surface. The isotopic assay of adenosine triphosphate hydrolysis by intact cells may provide a rapid method for screening oncogenesis in vitro of liver ...
http://cancerres.aacrjournals.org/content/36/12/4491
Dicyclohexylcarbodiimide sensitivity and the binding of mitochondrial adenosine triphosphatase to the inner mitochondrial...
Fingerprint Dive into the research topics of Dicyclohexylcarbodiimide sensitivity and the binding of mitochondrial adenosine triphosphatase to the inner mitochondrial membrane. Together they form a unique fingerprint. ...
https://experts.syr.edu/en/publications/dicyclohexylcarbodiimide-sensitivity-and-the-binding-of-mitochond/fingerprints/
LOCALIZATION OF (SODIUM ION, POTASSIUM ION)-ACTIVATED ADENOSINE TRIPHOSPHATASE ACTIVITY IN TELEOST CHLORIDE CELLS: ...LOCALIZATION OF (SODIUM ION, POTASSIUM ION)-ACTIVATED ADENOSINE TRIPHOSPHATASE ACTIVITY IN TELEOST CHLORIDE CELLS: ...
LOCALIZATION OF (SODIUM ION, POTASSIUM ION)-ACTIVATED ADENOSINE TRIPHOSPHATASE ACTIVITY IN TELEOST CHLORIDE CELLS: CYTOCHEMICAL AND CELLISOLATION STUDIES ON THE BRANCHIAL EPITHELIUM OF THE PINFISH, LAGODON ...
https://scholarship.rice.edu/handle/1911/15373
Ca <sup>2+</sup> ](i) and pH(in) homeostasis in Kaposi sarcoma cells ...
TY - JOUR. T1 - [Ca 2+ ](i) and pH(in) homeostasis in Kaposi sarcoma cells AU - Martínez-Zaguilán, Raul. AU - Chinnock, Brian F.. AU - Wald-Hopkins, Sarah. AU - Bernas, Mike. AU - Way, Dennis. AU - Weinand, Martin. AU - Witte, Marlys H.. AU - Gillies, Robert J.. PY - 1996/1/1. Y1 - 1996/1/1. N2 - Changes in intracellular pH (pH(in)) and intracellular calcium concentration [Ca 2+ ](i) play a major role in signal transduction leading to cell growth, differentiation and transformation. In some tumor cell lines, vacuolar (V-type) H + -adenosine triphosphatases (ATPases) are important in pH(in) regulation. To clarify the neoplastic nature and endothelial origin of Kaposi sarcoma (KS), pH(in) and [Ca 2+ ](i) and the functional expression of V-type H + -ATPases were evaluated in cultured endothelial marker-positive KS cells derived from AIDS-KS skin lesions as compared to human umbilical vein endothelial cells (HUVEC). Human skin fibroblasts (HSF) were also examined. Cells were examined using ...
https://arizona.pure.elsevier.com/en/publications/ca-sup2sup-i-and-phin-homeostasis-in-kaposi-sarcoma-cells
Adenosine triphosphatase test synonyms, adenosine triphosphatase test antonyms - FreeThesaurus.comAdenosine triphosphatase test synonyms, adenosine triphosphatase test antonyms - FreeThesaurus.com
Synonyms for adenosine triphosphatase test in Free Thesaurus. Antonyms for adenosine triphosphatase test. 2 words related to adenosine: biochemistry, nucleoside. What are synonyms for adenosine triphosphatase test?
http://www.freethesaurus.com/adenosine+triphosphatase+test
Hsp70 - WikipediaHsp70 - Wikipedia
The Hsp70 system interacts with extended peptide segments of proteins as well as partially folded proteins to prevent aggregation, remodel folding pathways, and regulate activity[7] When not interacting with a substrate peptide, Hsp70 is usually in an ATP bound state. Hsp70 by itself is characterized by a very weak ATPase activity, such that spontaneous hydrolysis will not occur for many minutes. As newly synthesized proteins emerge from the ribosomes, the substrate binding domain of Hsp70 recognizes sequences of hydrophobic amino acid residues, and interacts with them. This spontaneous interaction is reversible, and in the ATP bound state Hsp70 may relatively freely bind and release peptides. However, the presence of a peptide in the binding domain stimulates the ATPase activity of Hsp70, increasing its normally slow rate of ATP hydrolysis. When ATP is hydrolyzed to ADP the binding pocket of Hsp70 closes, tightly binding the now-trapped peptide chain. Further speeding ATP hydrolysis are the ...
https://en.wikipedia.org/wiki/Hsp70
Circadian rhythm of adenosine triphosphatase activity and 32P content in Pliss lymphosarcomaCircadian rhythm of adenosine triphosphatase activity and 32P content in Pliss lymphosarcoma
Abstract: Within a daily period maximal activity of ATPases and content of 32P in Pliss lymphosarcoma tissue was found in the samples taken at 15 or 21 p.m. and 3 a.m. The radioactivity in the tumor was minimal between 9 and 12 a.m. and 18 or 24 p.m. The alterations in Mg2+-ATPase activity in their magnitude and circadian rhythm coincided completely with the daily variations in content of radiophosphorus. Activities of Na+, K+- and HCO(3-)-ATPases exhibited maximal values at 15 p.m. and, especially between 3 and 6 a.m., i.e. these alterations were of two-peak shape without the peak at 21 p.m ...
http://pbmc.ibmc.msk.ru/index.php/en/article/PBMC-1984-30-6-38-en
PLOS ONE: Spastins Microtubule-Binding Properties and Comparison to KataninPLOS ONE: Spastins Microtubule-Binding Properties and Comparison to Katanin
Spastin and katanin are ring-shaped hexameric AAA ATPases that sever microtubules, and thus crucially depend on a physical interaction with microtubules. For the first time, we report here the microtubule binding properties of spastin at the single-molecule level, and compare them to katanin. Microscopic fluorescence assays showed that human spastin bound to microtubules by ionic interactions, and diffused along microtubules with a diffusion coefficient comparable to katanin. The microscopic measurement of landing and dissociation rates demonstrated the ionic character of the interaction, which could be mapped to a patch of three lysine residues outside of the catalytic domain of human spastin. This motif is not conserved in Drosophila spastin or katanin, which also bound by non-catalytic parts of the protein. The binding affinities of spastin and katanin were nucleotide-sensitive, with the lowest affinities under ADP,, the highest under ATP-γS conditions. These changes correlated with the formation of
http://journals.plos.org/plosone/article/figure?id=10.1371/journal.pone.0050161.t002
ATPase-dependent cooperative binding of ORC and Cdc6 to origin DNAATPase-dependent cooperative binding of ORC and Cdc6 to origin DNA
Binding of Cdc6 to the origin recognition complex (ORC) is a key step in the assembly of a pre-replication complex (pre-RC) at origins of DNA replication. ORC recognizes specific origin DNA sequences in an ATP-dependent manner. Here we demonstrate cooperative binding of Saccharomyces cerevisiae Cdc6 …
https://pubmed.ncbi.nlm.nih.gov/16228006/
Effects of Chelators and Calcium Ions on the Response of Renal Adenosine Triphosphatase Activity to Hormones and Concanavalin A...Effects of Chelators and Calcium Ions on the Response of Renal Adenosine Triphosphatase Activity to Hormones and Concanavalin A...
Thank you for your interest in spreading the word about Biochemical Society Transactions.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
http://www.biochemsoctrans.org/content/6/5/952
RCSB PDB - 2IHY: Structure of the Staphylococcus aureus putative ATPase subunit of an ATP-binding cassette (ABC) transporterRCSB PDB - 2IHY: Structure of the Staphylococcus aureus putative ATPase subunit of an ATP-binding cassette (ABC) transporter
As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
https://www.rcsb.org/structure/2IHY
Actl6a - Actin-like protein 6A - Mus musculus (Mouse) - Actl6a gene & proteinActl6a - Actin-like protein 6A - Mus musculus (Mouse) - Actl6a gene & protein
Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. Required for maximal ATPase activity of SMARCA4/BRG1/BAF190A and for association of the SMARCA4/BRG1/BAF190A containing remodeling complex BAF with chromatin/nuclear matrix. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and is required for the proliferation of neural progenitors. During neural development a switch from a stem/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural
https://www.uniprot.org/uniprot/Q9Z2N8
Medizinische Universität Graz Austria/Österreich - Forschungsportal - Medical University of GrazMedizinische Universität Graz Austria/Österreich - Forschungsportal - Medical University of Graz
Hsp90 couples ATP hydrolysis to large conformational changes essential for activation of client proteins. The structural transitions involve dimerization of the N-terminal domains and formation of closed states involving the N-terminal and middle domains. Here, we used Hsp90 mutants that modulate ATPase activity and biological function as probes to address the importance of conformational cycling for Hsp90 activity. We found no correlation between the speed of ATP turnover and the in vivo activity of Hsp90: some mutants with almost normal ATPase activity were lethal, and some mutants with lower or undetectable ATPase activity were viable. Our analysis showed that it is crucial for Hsp90 to attain and spend time in certain conformational states: a certain dwell time in open states is required for optimal processing of client proteins, whereas a prolonged population of closed states has negative effects. Thus, the timing of conformational transitions is crucial for Hsp90 function and not cycle ...
https://forschung.medunigraz.at/fodok/suchen.publikationen_mug_autoren?sprache_in=de&menue_id_in=205&id_in=4030&publikation_id_in=156399
Regulation of Cytoplasmic Dynein ATPase by Lis1 | Journal of NeuroscienceRegulation of Cytoplasmic Dynein ATPase by Lis1 | Journal of Neuroscience
This work establishes Lis1 as a dynein regulatory protein and links its function to dynein enzymatic activity. The simplest interpretation of our data is that Lis1 acts specifically and directly on dynein. Although the increase in ATPase activity is modest at first glance, our determination that only one-third of the dynein molecules interacted with Lis1 suggests that there were two populations of motors present in the ATPase assay. The major population did not stably bind Lis1 and is not expected to have had any change in ATPase activity, whereas a smaller population binds Lis1, resulting in a boost in ATPase activity. In this scenario, the enzymatic activity of the dynein as a whole would have increased by only 40%, but the activity of Lis1-associated motors may have increased by ∼100%.. The finding that Lis1 can stimulate dynein in vitro supports our model that Lis1 has an activating influence on dynein in cells (Smith et al., 2000). In our previous work, we found that raising Lis1 ...
https://www.jneurosci.org/node/365882.full.print
Study of energy consumption by Na+/K+ ATPase using PercevalHRStudy of energy consumption by Na+/K+ ATPase using PercevalHR
Adenosine triphosphate (ATP) is an important macro molecule that is the prime supplier of energy to run cell metabolism and to regulate several physiological processes in a cell. Despite its central role, the number of non-invasive methods to study ATP on a single cell level in real time are limited. ATPases use energy derived from ATP hydrolysis to maintain cell membrane potential by regulating ion gradients across the plasma membrane. It is generally believed that the Na+/K+-ATPase (NKA) which belongs to the P-type ATPase superfamily represent the main energy consumer among the ATPases. In this study, we set out to quantify ATP consumption by NKA on a single cell level in human embryonic kidney cells (HEK293a) using PercevalHR, a genetically encoded fluorescent biosensor that reports changes in the ATP:ADP during live cell imaging. We demonstrate that ATP hydrolysis by NKA is faster at physiological temperatures (35 -37°C) compared to room temperature. K+ free KREBS pre-treatment increased ...
http://kth.diva-portal.org/smash/record.jsf?pid=diva2:1084467
KTN80 confers precision to microtubule severing by specific targeting of katanin complexes in plant cells | The EMBO Journal
The microtubule (MT)‐severing enzyme katanin triggers dynamic reorientation of cortical MT arrays that play crucial functions during plant cell morphogenesis, such as cell elongation, cell wall biosynthesis, and hormonal signaling. MT severing specifically occurs at crossover or branching nucleation sites in living Arabidopsis cells. This differs from the random severing observed along the entire length of single MTs in vitro and strongly suggests that a precise control mechanism must exist in vivo. However, how katanin senses and cleaves at MT crossover and branching nucleation sites in vivo has remained unknown. Here, we show that the katanin p80 subunit KTN80 confers precision to MT severing by specific targeting of the katanin p60 subunit KTN1 to MT cleavage sites and that KTN1 is required for oligomerization of functional KTN80-KTN1 complexes that catalyze severing. Moreover, our findings suggest that the katanin complex in Arabidopsis is composed of a hexamer of KTN1-KTN80 heterodimers ...
http://emboj.embopress.org/content/36/23/3435
Difference between revisions of Biomolecular Breadboards:Preliminary Data - OpenWetWareDifference between revisions of Biomolecular Breadboards:Preliminary Data - OpenWetWare
Implementing protein degradation is integral to enabling the function of many dynamical circuits, such as oscillators or feed-forward loops. We have been exploring the overexpression of AAA ATPases ClpXP to selectively target proteins with degradation tags. Initial experiments indicate that ClpXP, when overexpressed, can accelerate degradation of purified eGFP-ssrA (Fig. 1). We will further characterize this AAA ATPase family, as well as try to demonstrate its use through an incoherent feed-forward loop. We have not been able to replicate the results by adding purified ClpXP protein. However, we intend to express ClpXP off of plasmids or to create custom extract with ClpXP already overexpressed to enable rapid protein degradation. ...
https://openwetware.org/wiki/?title=Biomolecular_Breadboards:Preliminary_Data&diff=698698&oldid=697645
Condensin complex subunit 1 (zebrafish) | Protein Target - PubChemCondensin complex subunit 1 (zebrafish) | Protein Target - PubChem
Protein target information for Condensin complex subunit 1 (zebrafish). Find diseases associated with this biological target and compounds tested against it in bioassay experiments.
https://pubchem.ncbi.nlm.nih.gov/protein/A0A0R4IRW7
Erythrocyte Sodium-plus-Potassium Ion-Activated Adenosine Triphosphatase in Depressive Patients | Biochemical Society...Erythrocyte Sodium-plus-Potassium Ion-Activated Adenosine Triphosphatase in Depressive Patients | Biochemical Society...
Thank you for your interest in spreading the word about Biochemical Society Transactions.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
http://www.biochemsoctrans.org/content/2/3/505
RPN12 (YFR052W) Result Summary | BioGRIDRPN12 (YFR052W) Result Summary | BioGRID
Subunit Of The 19S Regulatory Particle Of The 26S Proteasome Lid; Synthetically Lethal With RPT1, Which Is An ATPase Component Of The 19S Regulatory Particle; Physically Interacts With Nob1p And Rpn3p; Protein Abundance Increases In Response To DNA Replication Stress
https://thebiogrid.org/31210/network/saccharomyces-cerevisiae/rpn12.html
Gene Ontology ClassificationsGene Ontology Classifications
Predicted to have DNA clamp unloader activity. Involved in several processes, including B cell activation; intracellular signal transduction; and positive regulation of B cell activation. Localizes to nucleus. Is expressed in liver; metanephros; midbrain ventricular layer; renal cortex; and telencephalon ventricular layer. Orthologous to human ATAD5 (ATPase family AAA domain containing 5 ...
http://www.informatics.jax.org/go/marker/MGI:2442925
Sodium/potassium-transporting ATPase subunit alpha-3Sodium/potassium-transporting ATPase subunit alpha-3
The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes an alpha 3 subunit. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012 ...
https://pharos.nih.gov/idg/targets/P13637
Sydney Research Online: Browsing Sydney Research Online
Altered intracellular localization and valosin-containing protein (p97 VCP) interaction underlie ATP7A-related distal motor neuropathy, Human Molecular Genetics, vol.21, 8, 2012,pp 1794-1807 ...
https://sro.library.usyd.edu.au/browse?type=author&value=Kaler%2C+Stephen&value_lang=en_US
PDB 1gaj structure summary ‹ Protein Data Bank in Europe (PDBe) ‹ EMBL-EBIPDB 1gaj structure summary ‹ Protein Data Bank in Europe (PDBe) ‹ EMBL-EBI
1gaj: Crystal structures of the MJ1267 ATP binding cassette reveal an induced-fit effect at the ATPase active site of an ABC transporter.
http://www.ebi.ac.uk/pdbe/entry/pdb/1gaj
Histoenzymological study of myocardial ATPase activity in experimental infarction in the rat.
Histoenzymological techniques were used to examine ATPase activity in rat heart muscle fibres after experimental infarction. 25 hours after coronary ligation, ATPase activity in all ventricular section fibres was high, homogeneous at pH 9.4, sections
http://www.biomedsearch.com/nih/Histoenzymological-study-myocardial-ATPase-activity/6460499.html
Studies of E. coli Min proteins - Lawrence RothfieldStudies of E. coli Min proteins - Lawrence Rothfield
The long-range goal of this project is to determine the mechanism used by bacteria to select the proper cell division site at midcell. The three Min proteins, M...
http://grantome.com/grant/NIH/R37-GM060632-14S1
The erythrocyte ATPase activities taken from normal rat | Open-iThe erythrocyte ATPase activities taken from normal rat | Open-i
The erythrocyte ATPase activities taken from normal rats when incubated in supernates of boiled plasma from control normotensive and experimental hypertensive r
https://openi.nlm.nih.gov/detailedresult.php?img=PMC4536719_kjim-1-2-185-9f2&req=4
ATAD2 Antibody (PCRP-ATAD2-1F12) - DSHBATAD2 Antibody (PCRP-ATAD2-1F12) - DSHB
Monoclonal antibody against ATPase family AAA domaining containg 2 expressed by ATAD2 for use in Immunoprecipitation, Microarray, Western Blot against Human
http://dshb.biology.uiowa.edu/PCRP-ATAD2-1F12
TCDB » SEARCHTCDB » SEARCH
TadABC complex; the Flp pilus assembly complex, consisting of one ATPase component, TadA or CpaF, and two membrane components, TadB (218 aas and 3 - 5 TMSs) and TadC (200 aas and 2 N- and C-terminal TMSs) (Bottacini et al. 2017 ...
http://tcdb.org/search/result.php?acc=B3DUC1&tc=9.A.47.2.2
Seca 374 Baby Scale with BMIFSeca 374 Baby Scale with BMIF
Seca 374 Baby Scale with BMIF - $479 No Tax - Buy Seca Baby Scale with Wireless Transmission to EMR Sytems. Easy online ordering from Cascade HealthCare Products Inc
https://www.1cascade.com/374-baby-scale-seca
CAF16 (YFL028C) Result Summary | BioGRIDCAF16 (YFL028C) Result Summary | BioGRID
Part Of Evolutionarily-conserved CCR4-NOT Regulatory Complex; Contains Single ABC-type ATPase Domain But No Transmembrane Domain; Interacts With Several Subunits Of Mediator
https://thebiogrid.org/31118/protein/saccharomyces-cerevisiae/caf16.html
Addgene: pCMV-Tag 3B/myc-M87L195VAddgene: pCMV-Tag 3B/myc-M87L195V
Plasmid pCMV-Tag 3B/myc-M87L195V from Dr. Peter Baass lab contains the insert SPAST and is published in Hum Mol Genet. 2010 Jul 15;19(14):2767-79. doi: 10.1093/hmg/ddq177. Epub 2010 Apr 29. This plasmid is available through Addgene.
https://www.addgene.org/87721/
ISW1-N抗体|Abcam中国|Anti-ISW1-N抗体ISW1-N抗体|Abcam中国|Anti-ISW1-N抗体
ISW1-N小鼠多克隆抗体(ab43434)可与酿酒酵母样本反应并经WB, IP, ICC/IF实验严格验证。中国75%以上现货，所有产品提供质保服务，可通过电话、电邮或微信获得本地专属技术支持。
http://www.abcam.cn/isw1-n-antibody-ab43434.html
ATPaseATPase
... s (EC 3.6.1.3, Adenosine 5'-TriPhosphatase, adenylpyrophosphatase, ATP monophosphatase, triphosphatase, SV40 T-antigen, ... Kielley WW (1961). "Myosin adenosine triphosphatase". In Boyer PD, Lardy H, Myrbäck K (eds.). The Enzymes. Vol. 5 (2nd ed.). ... Wikimedia Commons has media related to Adenosine triphosphatases. "ATP synthase - a splendid molecular machine" ATPase at the ... Martin SS, Senior AE (November 1980). "Membrane adenosine triphosphatase activities in rat pancreas". Biochimica et Biophysica ...
https://en.wikipedia.org/wiki/ATPase
Propionigenium modestumPropionigenium modestum
Mitchell, Peter D. (1974). "A chemiosmotic molecular mechanism for proton-translocating adenosine triphosphatases". FEBS Lett. ... Laubinger, Werner; Dimroth, Peter (1989). "The sodium ion translocating adenosine triphosphatase of Propionigenium modestum ...
https://en.wikipedia.org/wiki/Propionigenium_modestum
ATP synthaseATP synthase
8. Properties of a factor conferring oligomycin sensitivity on mitochondrial adenosine triphosphatase". The Journal of ... "Catalytic site cooperativity of beef heart mitochondrial F1 adenosine triphosphatase. Correlations of initial velocity, bound ... ATP synthase is a protein that catalyzes the formation of the energy storage molecule adenosine triphosphate (ATP) using ... adenosine diphosphate (ADP) and inorganic phosphate (Pi). It is classified under ligases as it changes ADP by the formation of ...
https://en.wikipedia.org/wiki/ATP_synthase
Discovery and development of proton pump inhibitorsDiscovery and development of proton pump inhibitors
"Gastric adenosine triphosphatases: A review of their possible role in HCl secretion". Gastroenterology. 73 (4 Pt 2): 921-6. doi ...
https://en.wikipedia.org/wiki/Discovery_and_development_of_proton_pump_inhibitors
Ian R. GibbonsIan R. Gibbons
Gibbons, Ian R.; Rowe, Arthur J. (23 July 1965). "Dynein: a protein with adenosine triphosphatase activity from cilia". Science ... Lindemann, Charles B.; Gibbons, Ian R. (1 April 1975). "Adenosine triphosphate-induced motility and sliding of filaments in ...
https://en.wikipedia.org/wiki/Ian_R._Gibbons
Đái Duy BanĐái Duy Ban
Dai Duy Ban: (Announcement in Japan in English): Adenosine Triphospha tases on Plasma. Membrane Surrounding Lipid Vacuoles in L ...
https://en.wikipedia.org/wiki/Đái_Duy_Ban
Brody myopathyBrody myopathy
"Exertional rhabdomyolysis in a patient with calcium adenosine triphosphatase deficiency". Journal of Neurology, Neurosurgery, ...
https://en.wikipedia.org/wiki/Brody_myopathy
Oxidative phosphorylationOxidative phosphorylation
I. Purification and properties of soluble dinitrophenol-stimulated adenosine triphosphatase". J. Biol. Chem. 235 (11): 3322-9. ... The ATP synthase uses the energy to transform adenosine diphosphate (ADP) into adenosine triphosphate, in a phosphorylation ... "Catalytic site cooperativity of beef heart mitochondrial F1 adenosine triphosphatase. Correlations of initial velocity, bound ... thereby releasing chemical energy in order to produce adenosine triphosphate (ATP). In eukaryotes, this takes place inside ...
https://en.wikipedia.org/wiki/Oxidative_phosphorylation
Sodium-potassium pumpSodium-potassium pump
The sodium-potassium pump (sodium-potassium adenosine triphosphatase, also known as Na⁺/K⁺-ATPase, Na⁺/K⁺ pump, or sodium- ... Skou JC (February 1957). "The influence of some cations on an adenosine triphosphatase from peripheral nerves". Biochimica et ...
https://en.wikipedia.org/wiki/Sodium–potassium_pump
1957 in science1957 in science
February 1957). "The Influence of Some Cations on an Adenosine Triphosphatase from Peripheral Nerves". Biochimica et Biophysica ...
https://en.wikipedia.org/wiki/1957_in_science
Timeline of chemistryTimeline of chemistry
Skou, Jens (1957). "The influence of some cations on an adenosine triphosphatase from peripheral nerves". Biochim Biophys Acta ...
https://en.wikipedia.org/wiki/Timeline_of_chemistry
Ronald WhittamRonald Whittam
Wheeler, K. P.; Whittam, R. (1 April 1970). "The involvement of phosphatidylserine in adenosine triphosphatase activity of the ... WHITTAM, R. (1962). "Directional Effects of Alkali Metal Ions on Adenosine Triphosphate Hydrolysis in Erythrocyte Ghosts". ... adenosine triphosphates in relation to active cation transport and directional effects of the alkali metal ions on adenosine ... Spatial asymmetry in the stimulation of a membrane adenosine triphosphates; the asymmetrical stimulation of a membrane ...
https://en.wikipedia.org/wiki/Ronald_Whittam
ATP5EATP5E
8. Properties of a factor conferring oligomycin sensitivity on mitochondrial adenosine triphosphatase". The Journal of ...
https://en.wikipedia.org/wiki/ATP5E
Alan HodgkinAlan Hodgkin
Skou, J. C. (1957). "The influence of some cations on an adenosine triphosphatase from peripheral nerves". Biochimica et ...
https://en.wikipedia.org/wiki/Alan_Hodgkin
P-type ATPaseP-type ATPase
doi:10.1016/0968-0004(87)90071-5. SKOU JC (February 1957). "The influence of some cations on an adenosine triphosphatase from ... adenosine triphosphate (ATP). In addition, they all appear to interconvert between at least two different conformations, ...
https://en.wikipedia.org/wiki/P-type_ATPase
Action potentialAction potential
Skou JC (February 1957). "The influence of some cations on an adenosine triphosphatase from peripheral nerves". Biochimica et ...
https://en.wikipedia.org/wiki/Action_potential
Jens Christian SkouJens Christian Skou
Skou, J. C. (1989). "The influence of some cations on an adenosine triphosphatase from peripheral nerves. 1957". Biochimica et ... Post, RL; Merritt, CR; Kinsolving, CR; Albright, CD (June 1960). "Membrane adenosine triphosphatase as a participant in the ... Skou, JC (23 February 1957). "The influence of some cations on an adenosine triphosphatase from peripheral nerves". Biochimica ... The Influence of Some Cations on an Adenosine Triphosphatase from Peripheral Nerves'". Biochimica et Biophysica Acta. 1000: 435 ...
https://en.wikipedia.org/wiki/Jens_Christian_Skou
MT-ATP6MT-ATP6
8. Properties of a factor conferring oligomycin sensitivity on mitochondrial adenosine triphosphatase". The Journal of ... Another segment of the enzyme uses the energy created by this proton flow to convert a molecule called adenosine diphosphate ( ...
https://en.wikipedia.org/wiki/MT-ATP6
ATP5F1AATP5F1A
8. Properties of a factor conferring oligomycin sensitivity on mitochondrial adenosine triphosphatase". The Journal of ... Resveratrol inhibition of the F1 catalytic core increases adenosine monophosphate (AMP) levels, thereby activating the AMP- ...
https://en.wikipedia.org/wiki/ATP5F1A
MT-ATP8MT-ATP8
8. Properties of a factor conferring oligomycin sensitivity on mitochondrial adenosine triphosphatase". The Journal of ... Another segment of the enzyme uses the energy created by this proton flow to convert a molecule called adenosine diphosphate ( ...
https://en.wikipedia.org/wiki/MT-ATP8
Colworth MedalColworth Medal
The adenosine triphosphatase reactions of myosin and actomyosin and their relation to energy transduction in muscle". ...
https://en.wikipedia.org/wiki/Colworth_Medal
ProstasomesProstasomes
Ronquist G, Brody I, Gottfries A, Stegmayr B (1978). "An Mg2+ and Ca2+-stimulated adenosine triphosphatase in human prostatic ... Ronquist G, Brody I, Gottfries A, Stegmayr B (1978). "An Mg2+ and Ca2+-stimulated adenosine triphosphatase in human prostatic ... Ronquist G, Hedström M (August 1977). "Restoration of detergent-inactivated adenosine triphosphatase activity of human ... "Abnormal deficiency of both Mg2+ and Ca2+-dependent adenosine triphosphatase and secretory granules and vesicles in human ...
https://en.wikipedia.org/wiki/Prostasomes
Thomas P. StosselThomas P. Stossel
Alveolar macrophage myosin Mg2+- adenosine triphosphatase requires a cofactor for activation by actin. J Biol Chem. 1975; 250: ...
https://en.wikipedia.org/wiki/Thomas_P._Stossel
Charcot-Marie-Tooth diseaseCharcot-Marie-Tooth disease
The standard for indicating fiber type is histoenzymatic adenosine triphosphatase (ATPase at pH 9.4). Often, the most important ...
https://en.wikipedia.org/wiki/Charcot–Marie–Tooth_disease
ArenobufaginArenobufagin
Experimental results show that Arenobufagin inhibits the sodium-potassium adenosine triphosphatase (Na+/K+-ATPase) . It is one ...
https://en.wikipedia.org/wiki/Arenobufagin
Meiotic recombination checkpointMeiotic recombination checkpoint
An AAA-adenosine triphosphatase (AAA-ATPase) was found to be essential in this pathway. but the mechanism is not yet clear. ...
https://en.wikipedia.org/wiki/Meiotic_recombination_checkpoint
SecretinSecretin
... adenosine triphosphatase". Gastroenterology. 108 (3): 850-9. doi:10.1016/0016-5085(95)90460-3. PMID 7875488. Marinelli RA, Pham ...
https://en.wikipedia.org/wiki/Secretin
OrellanineOrellanine
In addition, orellanine has also been shown to interfere with the production of adenosine triphosphatase. Orellanine is a ...
https://en.wikipedia.org/wiki/Orellanine
Antonio PacchioniAntonio Pacchioni
In a recent study, Go, et al., ~ using enzyme ultracnytochemistry, detected Na+/K + adenosine triphosphatase activity on cap ...
https://en.wikipedia.org/wiki/Antonio_Pacchioni
Thiamine triphosphateThiamine triphosphate
On the other hand, suppression of the carbon source leads to the accumulation, of adenosine thiamine triphosphate (AThTP). It ... In mammals, ThTP is hydrolyzed to thiamine pyrophosphate (ThDP) by a specific thiamine-triphosphatase. It can also be converted ... "Thiamine triphosphate and thiamine triphosphatase activities: from bacteria to mammals". Cell. Mol. Life Sci. 60 (7): 1477-88. ... "Structural Basis for the Catalytic Mechanism of Mammalian 25-kDa Thiamine Triphosphatase". Journal of Biological Chemistry. 283 ...
https://en.wikipedia.org/wiki/Thiamine_triphosphate
Topical fluorideTopical fluoride
... including enolase and proton releasing adenosine triphosphatase. As topical fluoride lowers the pH, bacteria have to consume ...
https://en.wikipedia.org/wiki/Topical_fluoride
List of homing endonuclease cutting sitesList of homing endonuclease cutting sites
... translocating adenosine triphosphatase from vacuolar membranes of Saccharomyces cerevisiae". J Biol Chem. 265 (12): 6726-33. ... adenosine triphosphatase". Science. 250 (4981): 651-7. Bibcode:1990Sci...250..651K. doi:10.1126/science.2146742. PMID 2146742. ...
https://en.wikipedia.org/wiki/List_of_homing_endonuclease_cutting_sites
Find-me signalsFind-me signals
Currently known find-me signals The nucleotides: adenosine triphosphate (ATP), adenosine diphosphate (ADP), uridine ... Nucleotides are often degraded by nucleotide triphosphatases (NTPases) when they are in the extracellular space. Only a small ...
https://en.wikipedia.org/wiki/Find-me_signals
Lidia MannuzzuLidia Mannuzzu
Decreased Calcium Adenosine Triphosphatase, and Altered Membrane Proteins During Fava Bean Hemolysis in Glucose-6-Phosphate ...
https://en.wikipedia.org/wiki/Lidia_Mannuzzu
Zygosaccharomyces bailiiZygosaccharomyces bailii
Another mechanism of Z. bailii to deal with acid challenge is that the yeast uses a plasma membrane H+-adenosine triphosphatase ...
https://en.wikipedia.org/wiki/Zygosaccharomyces_bailii
Mitochondrial fusionMitochondrial fusion
Fzo1 (P38297) and Mgm1 (P32266) are conserved guanosine triphosphatases that reside in the outer and inner membranes, ... This series of events causes problems with adenosine triphosphate (ATP) synthesis. The Mitochondrial Inner/Outer Membrane ...
https://en.wikipedia.org/wiki/Mitochondrial_fusion
Dorothy M. NeedhamDorothy M. Needham
... adenosine triphosphatase). During World War II, Needham participated in research as a member of the chemical defence group led ...
https://en.wikipedia.org/wiki/Dorothy_M._Needham
FolliculinFolliculin
... in a lysosome-associated complex with Ragulator and vacuolar adenosine triphosphatase (v-ATPase) interact with mTORC1 in ...
https://en.wikipedia.org/wiki/Folliculin
Histone H2AHistone H2A
... related adenosine triphosphatase. Another H2A variant that has been identified is H2AX. This variant has a C-terminal extension ...
https://en.wikipedia.org/wiki/Histone_H2A
Protein splicingProtein splicing
... translocating adenosine triphosphatase from vacuolar membranes of Saccharomyces cerevisiae". J Biol Chem. 265 (12): 6726-33. ... translocating adenosine triphosphatase from vacuolar membranes of Saccharomyces cerevisiae". J. Biol. Chem. 265 (12): 6726-33. ... adenosine triphosphatase". Science. 250 (4981): 651-7. Bibcode:1990Sci...250..651K. doi:10.1126/science.2146742. PMID 2146742. ... The protein splicing reactions which are known now do not require exogenous cofactors or energy sources such as adenosine ...
https://en.wikipedia.org/wiki/Protein_splicing
ATP2B2ATP2B2
... transporting adenosine triphosphatase isoform 2 genes". Cancer Res. 54 (9): 2486-91. PMID 8162598. Wang MG, Yi H, Hilfiker H, ...
https://en.wikipedia.org/wiki/ATP2B2
ThiamineThiamine
... adenosine thiamine diphosphate (AThDP) and adenosine thiamine triphosphate (AThTP). They are involved in many cellular ... July 2003). "Thiamine triphosphate and thiamine triphosphatase activities: from bacteria to mammals". Cellular and Molecular ... The mitochondrial PDH and OGDH are part of biochemical pathways that result in the generation of adenosine triphosphate (ATP), ...
https://en.wikipedia.org/wiki/Thiamine
Serotonin transporterSerotonin transporter
... properly the serotonin transporter requires the membrane potential created by the sodium-potassium adenosine triphosphatase. ...
https://en.wikipedia.org/wiki/Serotonin_transporter
Inhibition of Sodium-Potassium-activated Adenosine 5′-Triphosphatase and Ion Transport by Adriamycin1 | Cancer Research |...Inhibition of Sodium-Potassium-activated Adenosine 5′-Triphosphatase and Ion Transport by Adriamycin1 | Cancer Research |...
Inhibition of Sodium-Potassium-activated Adenosine 5′-Triphosphatase and Ion Transport by Adriamycin1 Mario Gosálvez; Mario ... The effects on both the adenosine triphosphatase and ion transport are markedly reduced by Ca2+, probably by chelation of this ... Mario Gosálvez, George D. V. van Rossum, Mary F. Blanco; Inhibition of Sodium-Potassium-activated Adenosine 5′-Triphosphatase ... The antitumor antibiotic Adriamycin is a potent inhibitor of the sodium-potassium-activated adenosine triphosphatase of native ...
https://aacrjournals.org/cancerres/article/39/1/257/483094/Inhibition-of-Sodium-Potassium-activated-Adenosine
A BIOCHEMICAL AND CYTOCHEMICAL STUDY OF ADENOSINE TRIPHOSPHATASE ACTIVITY IN THE PHLOEM OF NICOTIAN A TABACUM | Journal of Cell...A BIOCHEMICAL AND CYTOCHEMICAL STUDY OF ADENOSINE TRIPHOSPHATASE ACTIVITY IN THE PHLOEM OF NICOTIAN A TABACUM | Journal of Cell...
A BIOCHEMICAL AND CYTOCHEMICAL STUDY OF ADENOSINE TRIPHOSPHATASE ACTIVITY IN THE PHLOEM OF NICOTIAN A TABACUM Jamison Gilder, ... Jamison Gilder, James Cronshaw; A BIOCHEMICAL AND CYTOCHEMICAL STUDY OF ADENOSINE TRIPHOSPHATASE ACTIVITY IN THE PHLOEM OF ... It is suggested that the phloem transport system derives its energy from the demonstrated nucleoside triphosphatase activity. ...
https://rupress.org/jcb/article/60/1/221/18260/A-BIOCHEMICAL-AND-CYTOCHEMICAL-STUDY-OF-ADENOSINE
IMSEAR at SEARO: Adenosine triphosphatase of Aspergillus nidulans: effect of growth temperature.
Adenosine triphosphatase of Aspergillus nidulans: effect of growth temperature. Indian Journal of Experimental Biology. 1976 ...
https://imsear.searo.who.int/handle/123456789/61881
ATPase-Modulated Stress Granules Contain a Diverse Proteome and SubstructureATPase-Modulated Stress Granules Contain a Diverse Proteome and Substructure
Adenosine Triphosphatases * DED1 protein, S cerevisiae * DEAD-box RNA Helicases Grant support * P01 GM105537/GM/NIGMS NIH HHS/ ...
https://pubmed.ncbi.nlm.nih.gov/26777405/?dopt=Abstract
Flexibility of an active center in sodium-plus-potassium adenosine triphosphatase<...
In this adenosine triphosphatase a phosphorylated intermediate is formed from adenosine triphosphate in the presence of sodium ... In this adenosine triphosphatase a phosphorylated intermediate is formed from adenosine triphosphate in the presence of sodium ... In this adenosine triphosphatase a phosphorylated intermediate is formed from adenosine triphosphate in the presence of sodium ... In this adenosine triphosphatase a phosphorylated intermediate is formed from adenosine triphosphate in the presence of sodium ...
https://scholars.uky.edu/en/publications/flexibility-of-an-active-center-in-sodium-plus-potassium-adenosin
Table - Resistance to Dihydroartemisinin - Volume 12, Number 11-November 2006 - Emerging Infectious Diseases journal - CDC
PfATPase, Plasmodium falciparum adenosine triphosphatase; IC50, 50% inhibitory concentration.. Main Article ...
https://wwwnc.cdc.gov/eid/article/12/11/06-0903-t1
DeCS 2007 - Changed termsDeCS 2007 - Changed terms
Adenosine Triphosphatases. Ca(2+)-Transporting ATPase. Calcium-Transporting ATPases. Gelatinase A. Matrix Metalloproteinase 2. ...
https://decs.bvs.br/I/rep_i2007.htm
N-Terminal Coiled-Coil Structure of ATPase Subunits of 26S Proteasome Is Crucial for Proteasome Function | PLOS ONEN-Terminal Coiled-Coil Structure of ATPase Subunits of 26S Proteasome Is Crucial for Proteasome Function | PLOS ONE
Adenosine triphosphatase Is the Subject Area "Adenosine triphosphatase" applicable to this article? Yes. No. ...
https://journals.plos.org/plosone/article?id=10.1371/journal.pone.0134056
Vitamin B-12 Associated Neurological Diseases Clinical Presentation: History, Physical, CausesVitamin B-12 Associated Neurological Diseases Clinical Presentation: History, Physical, Causes
Other antibodies are directed at parietal cell hydrogen-potassium adenosine triphosphatase (ATPase). ...
https://www.medscape.com/answers/1152670-77142/which-disorders-cause-an-increased-vitamin-b-12-requirement
Vitamin B-12 Associated Neurological Diseases Clinical Presentation: History, Physical, CausesVitamin B-12 Associated Neurological Diseases Clinical Presentation: History, Physical, Causes
Other antibodies are directed at parietal cell hydrogen-potassium adenosine triphosphatase (ATPase). ...
https://emedicine.medscape.com/article/1152670-clinical
INSTRUCT HILIFE protein crystallography platform - Publications - University of Helsinki
Adenosine triphosphatases of thermophilic archaeal double-stranded DNA viruses. Happonen, L. J., Erdmann, S., Garrett, R. A. & ...
https://researchportal.helsinki.fi/en/equipments/instruct-hilife-protein-crystallography-platform/publications/
NIOSHTIC-2 Search Results - Basic View
Properties and drug sensitivity of adenosine triphosphatases from Schistosoma mansoni. Authors. Nechay BR; Hillman GR; Dotson ...
http://www2a.cdc.gov/nioshtic-2/BuildQyr.asp?s1=antimony&f1=%2A&Startyear=&Adv=0&terms=1&EndYear=&Limit=10000&sort=&D1=10&PageNo=89&RecNo=89&View=b&
Medical Microbiology<...Medical Microbiology<...
Adenosine Triphosphatases 100% * Heavy Metals 94% * Heavy Metal 83% * Ions 82% * P-type ATPases 59% ...
https://portal.research.lu.se/en/organisations/medical-microbiology
Yan Shens Research | CureHunterYan Shen's Research | CureHunter
Adenosine Triphosphatases (ATPase)IBA 03/2014 - 02/2009. 3. Chemokine CCL2 (Monocyte Chemoattractant Protein 1)IBA 03/2014 - 11 ...
https://www.curehunter.com/public/authorSummary-Shen,%20Yan.do
A progressive translational mouse model of human valosin-containing protein disease: the VCP(R155H/+) mouse<...A progressive translational mouse model of human valosin-containing protein disease: the VCP(R155H/+) mouse<...
keywords = "Adenosine Triphosphatases, Animals, Brain, Cell Cycle Proteins, Disease Models, Animal, Disease Progression, ...
https://research-portal.uea.ac.uk/en/publications/a-progressive-translational-mouse-model-of-human-valosin-containi
Antibiotic That Inhibits the ATPase Activity of an ATP-Binding Cassette Transporter by Binding to a Remote Extracellular Site<...
Adenosine Triphosphatases Engineering & Materials Science 100% * Teichoic Acids Medicine & Life Sciences 92% ...
https://pennstate.pure.elsevier.com/en/publications/antibiotic-that-inhibits-the-atpase-activity-of-an-atp-binding-ca
MeSH BrowserMeSH Browser
Adenosine Triphosphatases [D08.811.277.040.025] * MutL Proteins [D08.811.277.040.025.215] * Mismatch Repair Endonuclease PMS2 [ ... Adenosine Triphosphatases (2001-2016). DNA Repair Enzymes (2001-2016). Public MeSH Note. 2017. History Note. 2017. Date ...
https://meshb.nlm.nih.gov/record/ui?ui=D000070976
Mutating the converter-relay interface of Drosophila myosin perturbs ATPase activity, actin motility, myofibril stability and...Mutating the converter-relay interface of Drosophila myosin perturbs ATPase activity, actin motility, myofibril stability and...
Adenosine Triphosphatases / genetics * Adenosine Triphosphatases / metabolism* * Amino Acid Substitution / genetics * Animals * ...
https://pubmed.ncbi.nlm.nih.gov/20362584/
Earth | Free Full-Text | Invasion of the Giant Hogweed and the Sosnowsky’s Hogweed as a Multidisciplinary Problem with...Earth | Free Full-Text | Invasion of the Giant Hogweed and the Sosnowsky’s Hogweed as a Multidisciplinary Problem with...
Ezeala, D.O.; Hart, J.W.; Sabnis, D.D. Stimulation by monovalent cations of adenosine triphosphatase activity in extracts of ... Ezeala, D.O.; Hart, J.W.; Sabnis, D.D. Fractionation of monovalent ion-stimulated nucleoside triphosphatase activity in ...
https://www.mdpi.com/2673-4834/3/1/18
Plus itPlus it
1985) Mechanism of inhibition of mitochondrial adenosine triphosphatase by dicyclohexylcarbodiimide and oligomycin: ...
https://www.jneurosci.org/content/29/7/2053
Larry Que - Research output - Experts@MinnesotaLarry Que - Research output - [email protected]
Adenosine Triphosphatases 61% * Zinc 59% * Metals 53% * Ions 51% 25 Scopus citations ...
https://experts.umn.edu/en/persons/larry-que/publications/?ordering=title&descending=false&page=10
Propolis Prevents Hepatorenal Injury Induced by Chronic Exposure to Carbon TetrachloridePropolis Prevents Hepatorenal Injury Induced by Chronic Exposure to Carbon Tetrachloride
Activities of catalase, adenosine triphosphatase, glucose-6-phosphatase, acid, and alkaline phosphatase were also maintained ... Activities of catalase, adenosine triphosphatase, glucose-6-phosphatase, acid, and alkaline phosphatase were also maintained ... adenosine triphosphatase (ATPase), acid, and alkaline phosphatase (ACPase and ALPase). 2.5. Determination of Hepatorenal Marker ...
https://www.hindawi.com/journals/ecam/2012/235358/
Recapitulation of morphogenetic cell shape changes enables wound re-epithelialisation<...Recapitulation of morphogenetic cell shape changes enables wound re-epithelialisation<...
Myosin Adenosine Triphosphatase Medicine and Dentistry 44% * Myosin ATPase Neuroscience 44% * Drive Medicine and Dentistry 33% ...
https://research-information.bris.ac.uk/en/publications/recapitulation-of-morphogenetic-cell-shape-changes-enables-wound-
Relief from indigestion: a visual guide - The Pharmaceutical JournalRelief from indigestion: a visual guide - The Pharmaceutical Journal
ATPase; adenosine triphosphatase; C: carbon; Cl: chlorine; Cl-: chloride ion; H: hydrogen; H+: hydrogen ion; K+: potassium ion ...
https://pharmaceutical-journal.com/article/infographics/relief-from-indigestion-a-visual-guide
Effect of Cell Cycle on Cell Surface Expression of Voltage-Gated Sodium Channels and Na+,K+-ATPase | Research SquareEffect of Cell Cycle on Cell Surface Expression of Voltage-Gated Sodium Channels and Na+,K+-ATPase | Research Square
Durlacher, C. T. et al., Targeting Na⁺/K⁺ -translocating adenosine triphosphatase in cancer treatment. Clin. Exp. Pharmacol. ...
https://www.researchsquare.com/article/rs-1009085/v1
Find Research outputs - Heriot-Watt Research Portal
ATPaseTriphosphateNucleoside triphosphatase activityEnzymesProteinsSodiumMagnesiumIntracellularActivityGrowthEnzymeArticleTransportHydrolysisInhibitionATPasesPotassiumMembranesMutationMitochondrialDiphosphateBetaEnergy
ATPase4
  • Almost all enzymes involved in phosphorus reactions (eg, adenosine triphosphatase [ATPase]) require magnesium for activation. (medscape.com)
  • It suppresses gastric acid secretion by specific inhibition of the enzyme hydrogen-potassium adenosine triphosphatase (H+, K +-ATPase). (chromatographyonline.com)
  • The SecA adenosine triphosphatase (ATPase) mediates extrusion of the aminotermini of secreted proteins from the eubacterial cytosol based on cyclesof reversible binding to the SecYEG translocon. (embl-heidelberg.de)
  • We have determined thecrystal structure of SecA with and without magnesium-adenosine diphosphatebound to the high-affinity ATPase site at 3.0 and 2.7 angstrom resolution,respectively. (embl-heidelberg.de)
Triphosphate4
  • In this adenosine triphosphatase a phosphorylated intermediate is formed from adenosine triphosphate in the presence of sodium ions and is hydrolyzed with the addition of potassium ions. (uky.edu)
  • Pulse experiments on the native enzyme supported further a hypothesis of a sequence of phosphorylated forms, the first being made reversibly from adenosine triphosphate in the presence of sodium ion and the second being made irreversiblyfrom the first and hydrolyzed in the presence of potassium ion. (uky.edu)
  • Because magnesium is bound to adenosine triphosphate (ATP) inside the cell, shifts in intracellular magnesium concentration may help to regulate cellular bioenergetics, such as mitochondrial respiration. (medscape.com)
  • Magnesium is an essential element in human metabolism and is required for over 300 enzyme reactions, including all reactions requiring adenosine triphosphate. (europa.eu)
Nucleoside triphosphatase activity1
  • It is suggested that the phloem transport system derives its energy from the demonstrated nucleoside triphosphatase activity. (rupress.org)
Enzymes1
  • Pretreatment with a combination of quercetin and α-tocopherol ameliorates adenosine triphosphatases and lysosomal enzymes in myocardial infarcted rats. (scielo.br)
Proteins1
  • This gene encodes a member of the AAA family of adenosine triphosphatases with similarity to Clp proteases and heat shock proteins. (antibodies-online.com)
Sodium3
  • The antitumor antibiotic Adriamycin is a potent inhibitor of the sodium-potassium-activated adenosine triphosphatase of native heart microsomes. (aacrjournals.org)
  • In preparations of broken membranes it appears as an adenosine triphosphatase dependent on magnesium, sodium, and potassium ions together. (uky.edu)
  • Possible mechanism of hypokalemia is an increased sodium potassium adenosine triphosphatase pump activity with consequent massive shift og potassium from extracellula. (endocrine-abstracts.org)
Magnesium1
  • However, selective poisoning by N-ethylmaleimide or partial inhibition by a low magnesium ion concentration yielded an intermediate split by adenosine diphosphate and insensitive to potassium ions. (uky.edu)
Intracellular1
  • Ligand binding to MC4R activates adenylyl cyclase, resulting in increased levels of intracellular cyclic adenosine monophosphate (cAMP), a secondary messenger that regulates several cellular processes. (bvsalud.org)
Activity2
  • Adenosine triphosphatase activity in few tissues of a fresh water teleost, Channa gachua following in vivo exposure to endosulfan. (semanticscholar.org)
  • Similar to Hop, CyP40 was shown not to influence the adenosine triphosphatase activity of Hsc70. (edu.au)
Growth1
  • IMSEAR at SEARO: Adenosine triphosphatase of Aspergillus nidulans: effect of growth temperature. (who.int)
Enzyme1
  • Skou did not initially use the term 'pump' about the enzyme, but in 1957 he published his research in the Biochimica et Biophysica Acta journal under the heading The influence of some cations on an adenosine triphosphatase from peripheral nerves . (iucr.org)
Article1
  • Is the Subject Area "Adenosine triphosphatase" applicable to this article? (plos.org)
Transport1
  • The effects on both the adenosine triphosphatase and ion transport are markedly reduced by Ca 2+ , probably by chelation of this metal by Adriamycin. (aacrjournals.org)
Hydrolysis1
  • These kinesins use chemical energy from the hydrolysis of ATP (adenosine triphosphatase), a compound that the body produces from food to generate energy as needed by the body. (ucsd.edu)
Inhibition1
  • Inhibition of adenosine triphosphatases by gold. (cdc.gov)
ATPases1
  • Here we show that rotary adenosine triphosphatases (ATPases)/synthases from Thermus thermophilus and Enterococcus hirae can be maintained intact with membrane and soluble subunit interactions preserved in vacuum. (ox.ac.uk)
Potassium2
  • Effects of lead and natriuretic hormone on kinetics of sodium-potassium-activated adenosine triphosphatase: possible relevance to hypertension. (nih.gov)
  • Sodium-potassium-activated adenosine triphosphatase activity as a measure of neuronal membrane characteristics in ethanol-tolerant mice. (ucdenver.edu)
Membranes1
  • Vectorial aspects of adenosine-triphosphatase activity in erythrocyte membranes. (wikidata.org)
Mutation1
  • The T8993G mutation in the mitochondrial DNA adenosine triphosphatase 6 gene represents an important cause of maternally inherited Leigh's syndrome. (skadi.net)
Mitochondrial1
  • A protein inhibitor of the mitochondrial adenosine triphosphatase complex of rat liver. (utmb.edu)
Diphosphate2
  • Boyer and his co-workers have proposed, on the basis of biochemical data, a mechanism for how ATP is formed from adenosine diphosphate (ADP) and inorganic phosphate. (bioline.org.br)
  • On removal of the outermost phosphate group, adenosine diphosphate (ADP) is formed while at the same time the energy released can be employed for other reactions. (bioline.org.br)
Beta1
  • 1981) Identification of an essential glutamic acid residue in the [beta] subunit of the adenosine triphosphatase from the thermophilic bacterium PS3. (thefreedictionary.com)
Energy1
  • It is a supplementation of electromagnetic energy, charging cell mitochondria by boosting the reserves of the energy carrier - adenosine triphosphatase (ATP) - an aesthetically executed product intended to improve the quality of life. (bioptron.com)
Fosfatase - Wikipédia, a enciclopédia livre
Fosfatase - Wikipédia, a enciclopédia livre (pt.wikipedia.org)
Genetics of Menkes Kinky Hair Disease Medication: Trace metals, L-threo-dihydroxyphenylserine (L-DOPS)
Genetics of Menkes Kinky Hair Disease Medication: Trace metals, L-threo-dihydroxyphenylserine (L-DOPS) (emedicine.medscape.com)
Hypomagnesemia: Practice Essentials, Pathophysiology, Etiology
Hypomagnesemia: Practice Essentials, Pathophysiology, Etiology (medscape.com)
INSTRUCT HILIFE protein crystallography platform - Publications - University of Helsinki
INSTRUCT HILIFE protein crystallography platform - Publications - University of Helsinki (researchportal.helsinki.fi)
Emery-Dreifuss Muscular Dystrophy Workup: Laboratory Studies, Other Tests, Procedures
Emery-Dreifuss Muscular Dystrophy Workup: Laboratory Studies, Other Tests, Procedures (medscape.com)
Emery-Dreifuss Muscular Dystrophy Workup: Laboratory Studies, Other Tests, Procedures
Emery-Dreifuss Muscular Dystrophy Workup: Laboratory Studies, Other Tests, Procedures (medscape.com)
Medical Microbiology<...
Medical Microbiology<... (portal.research.lu.se)
A progressive translational mouse model of human valosin-containing protein disease: the VCP(R155H/+) mouse<...
A progressive translational mouse model of human valosin-containing protein disease: the VCP(R155H/+) mouse<... (research-portal.uea.ac.uk)
Inhibition of Sodium-Potassium-activated Adenosine 5′-Triphosphatase and Ion Transport by Adriamycin1 | Cancer Research |...
Inhibition of Sodium-Potassium-activated Adenosine 5′-Triphosphatase and Ion Transport by Adriamycin1 | Cancer Research |... (aacrjournals.org)
Mercury Toxicity: Background, Etiology, Epidemiology
Mercury Toxicity: Background, Etiology, Epidemiology (medscape.com)
Antibiotic That Inhibits the ATPase Activity of an ATP-Binding Cassette Transporter by Binding to a Remote Extracellular Site<...
Antibiotic That Inhibits the ATPase Activity of an ATP-Binding Cassette Transporter by Binding to a Remote Extracellular Site<... (pennstate.pure.elsevier.com)
Plus it
Plus it (jneurosci.org)
Primary Ciliary Dyskinesia (Kartagener Syndrome): Background, Pathophysiology, Etiology
Primary Ciliary Dyskinesia (Kartagener Syndrome): Background, Pathophysiology, Etiology (medscape.com)
MeSH Browser
MeSH Browser (meshb.nlm.nih.gov)
Wilson Disease: Practice Essentials, Background, Etiology
Wilson Disease: Practice Essentials, Background, Etiology (medscape.com)
Wilson Disease: Practice Essentials, Background, Etiology
Wilson Disease: Practice Essentials, Background, Etiology (medscape.com)
Hyperkalemia in Emergency Medicine: Practice Essentials, Background, Pathophysiology
Hyperkalemia in Emergency Medicine: Practice Essentials, Background, Pathophysiology (medscape.com)
Relief from indigestion: a visual guide - The Pharmaceutical Journal
Relief from indigestion: a visual guide - The Pharmaceutical Journal (pharmaceutical-journal.com)
McCune-Albright Syndrome Clinical Presentation: History, Physical Examination, Complications
McCune-Albright Syndrome Clinical Presentation: History, Physical Examination, Complications (medscape.com)
McCune-Albright Syndrome: Practice Essentials, Background, Pathophysiology
McCune-Albright Syndrome: Practice Essentials, Background, Pathophysiology (medscape.com)
McCune-Albright Syndrome Workup: Approach Considerations, Laboratory Studies, Plain Radiography
McCune-Albright Syndrome Workup: Approach Considerations, Laboratory Studies, Plain Radiography (medscape.com)
McCune-Albright Syndrome Treatment & Management: Approach Considerations, Pharmacologic Therapy, Surgical Interventions
McCune-Albright Syndrome Treatment & Management: Approach Considerations, Pharmacologic Therapy, Surgical Interventions (medscape.com)
PDF] From Na+/K+-ATPase and cardiac glycosides to cytotoxicity and cancer treatment. | Semantic Scholar
PDF] From Na+/K+-ATPase and cardiac glycosides to cytotoxicity and cancer treatment. | Semantic Scholar (semanticscholar.org)
Histiocytosis Workup: Laboratory Studies, Imaging Studies, Other Tests
Histiocytosis Workup: Laboratory Studies, Imaging Studies, Other Tests (medscape.com)
Histiocytosis Clinical Presentation: History, Classification, Other Histiocytoses
Histiocytosis Clinical Presentation: History, Classification, Other Histiocytoses (medscape.com)
EMG Evaluation of the Motor Unit - Electrophysiologic Biopsy: Overview, Indications, Equipment
EMG Evaluation of the Motor Unit - Electrophysiologic Biopsy: Overview, Indications, Equipment (emedicine.medscape.com)