Adaptor Protein Complex sigma Subunits: A family of small adaptin protein complex subunits of approximately 19 KDa in size.Adaptor Protein Complex 3: An adaptor protein complex found primarily on perinuclear compartments.Adaptor Protein Complex 1: A clathrin adaptor protein complex primarily involved in clathrin-related transport at the TRANS-GOLGI NETWORK.Sigma Factor: A protein which is a subunit of RNA polymerase. It effects initiation of specific RNA chains from DNA.Adaptor Protein Complex 2: An adaptor protein complex primarily involved in the formation of clathrin-related endocytotic vesicles (ENDOSOMES) at the CELL MEMBRANE.DNA-Directed RNA Polymerases: Enzymes that catalyze DNA template-directed extension of the 3'-end of an RNA strand one nucleotide at a time. They can initiate a chain de novo. In eukaryotes, three forms of the enzyme have been distinguished on the basis of sensitivity to alpha-amanitin, and the type of RNA synthesized. (From Enzyme Nomenclature, 1992).Adaptor Protein Complex 4: An adaptor protein complex involved in transport of molecules between the TRANS-GOLGI NETWORK and the endosomal-lysosomal system.Adaptor Protein Complex Subunits: The subunits that make up the large, medium and small chains of adaptor proteins.Adaptor Protein Complex delta Subunits: A family of large adaptin protein subunits of approximately 130-kDa in size. They have been primarily found as components of ADAPTOR PROTEIN COMPLEX 3.Adaptor Protein Complex mu Subunits: A family of medium adaptin protein subunits of approximately 45 KDa in size. They have been primarily found as components of ADAPTOR PROTEIN COMPLEX 3 and ADAPTOR PROTEIN COMPLEX 4.Adaptor Proteins, Vesicular Transport: A class of proteins involved in the transport of molecules via TRANSPORT VESICLES. They perform functions such as binding to the cell membrane, capturing cargo molecules and promoting the assembly of CLATHRIN. The majority of adaptor proteins exist as multi-subunit complexes, however monomeric varieties have also been found.Adaptor Protein Complex gamma Subunits: A family of large adaptin protein subunits of approximately 90 KDa in size. They have been primarily found as components of ADAPTOR PROTEIN COMPLEX 1.Adaptor Protein Complex beta Subunits: A family of large adaptin protein complex subunits of approximately 90-130 kDa in size.Adaptor Protein Complex alpha Subunits: A family of large adaptin protein subunits of approximately 100 kDa in size. They have been primarily found as components of ADAPTOR PROTEIN COMPLEX 2.Adaptor Proteins, Signal Transducing: A broad category of carrier proteins that play a role in SIGNAL TRANSDUCTION. They generally contain several modular domains, each of which having its own binding activity, and act by forming complexes with other intracellular-signaling molecules. Signal-transducing adaptor proteins lack enzyme activity, however their activity can be modulated by other signal-transducing enzymesCaliforniaAcademies and Institutes: Organizations representing specialized fields which are accepted as authoritative; may be non-governmental, university or an independent research organization, e.g., National Academy of Sciences, Brookings Institution, etc.Mice, Knockout: Strains of mice in which certain GENES of their GENOMES have been disrupted, or "knocked-out". To produce knockouts, using RECOMBINANT DNA technology, the normal DNA sequence of the gene being studied is altered to prevent synthesis of a normal gene product. Cloned cells in which this DNA alteration is successful are then injected into mouse EMBRYOS to produce chimeric mice. The chimeric mice are then bred to yield a strain in which all the cells of the mouse contain the disrupted gene. Knockout mice are used as EXPERIMENTAL ANIMAL MODELS for diseases (DISEASE MODELS, ANIMAL) and to clarify the functions of the genes.National Human Genome Research Institute (U.S.): Component of the NATIONAL INSTITUTES OF HEALTH. It conducts and supports research into the mapping of the human genome and other organism genomes. The National Center for Human Genome Research was established in 1989 and re-named the National Human Genome Research Institute in 1997.MedlinePlus: NATIONAL LIBRARY OF MEDICINE service for health professionals and consumers. It links extensive information from the National Institutes of Health and other reviewed sources of information on specific diseases and conditions.Endosomes: Cytoplasmic vesicles formed when COATED VESICLES shed their CLATHRIN coat. Endosomes internalize macromolecules bound by receptors on the cell surface.trans-Golgi Network: A network of membrane compartments, located at the cytoplasmic side of the GOLGI APPARATUS, where proteins and lipids are sorted for transport to various locations in the cell or cell membrane.Lysosomes: A class of morphologically heterogeneous cytoplasmic particles in animal and plant tissues characterized by their content of hydrolytic enzymes and the structure-linked latency of these enzymes. The intracellular functions of lysosomes depend on their lytic potential. The single unit membrane of the lysosome acts as a barrier between the enzymes enclosed in the lysosome and the external substrate. The activity of the enzymes contained in lysosomes is limited or nil unless the vesicle in which they are enclosed is ruptured. Such rupture is supposed to be under metabolic (hormonal) control. (From Rieger et al., Glossary of Genetics: Classical and Molecular, 5th ed)Clathrin: The main structural coat protein of COATED VESICLES which play a key role in the intracellular transport between membranous organelles. Each molecule of clathrin consists of three light chains (CLATHRIN LIGHT CHAINS) and three heavy chains (CLATHRIN HEAVY CHAINS) that form a structure called a triskelion. Clathrin also interacts with cytoskeletal proteins.Mental Retardation, X-Linked: A class of genetic disorders resulting in INTELLECTUAL DISABILITY that is associated either with mutations of GENES located on the X CHROMOSOME or aberrations in the structure of the X chromosome (SEX CHROMOSOME ABERRATIONS).Intellectual Disability: Subnormal intellectual functioning which originates during the developmental period. This has multiple potential etiologies, including genetic defects and perinatal insults. Intelligence quotient (IQ) scores are commonly used to determine whether an individual has an intellectual disability. IQ scores between 70 and 79 are in the borderline range. Scores below 67 are in the disabled range. (from Joynt, Clinical Neurology, 1992, Ch55, p28)Chromosomes, Human, X: The human female sex chromosome, being the differential sex chromosome carried by half the male gametes and all female gametes in humans.X Chromosome: The female sex chromosome, being the differential sex chromosome carried by half the male gametes and all female gametes in human and other male-heterogametic species.Mutation: Any detectable and heritable change in the genetic material that causes a change in the GENOTYPE and which is transmitted to daughter cells and to succeeding generations.Pedigree: The record of descent or ancestry, particularly of a particular condition or trait, indicating individual family members, their relationships, and their status with respect to the trait or condition.Period Circadian Proteins: Circadian rhythm signaling proteins that influence circadian clock by interacting with other circadian regulatory proteins and transporting them into the CELL NUCLEUS.Cryptochromes: Flavoproteins that function as circadian rhythm signaling proteins in ANIMALS and as blue-light photoreceptors in PLANTS. They are structurally-related to DNA PHOTOLYASES and it is believed that both classes of proteins may have originated from an earlier protein that played a role in protecting primitive organisms from the cyclical exposure to UV LIGHT.GermanyFlavoproteinsPhotoreceptor Cells, Invertebrate: Specialized cells in the invertebrates that detect and transduce light. They are predominantly rhabdomeric with an array of photosensitive microvilli. Illumination depolarizes invertebrate photoreceptors by stimulating Na+ influx across the plasma membrane.Cell Cycle Proteins: Proteins that control the CELL DIVISION CYCLE. This family of proteins includes a wide variety of classes, including CYCLIN-DEPENDENT KINASES, mitogen-activated kinases, CYCLINS, and PHOSPHOPROTEIN PHOSPHATASES as well as their putative substrates such as chromatin-associated proteins, CYTOSKELETAL PROTEINS, and TRANSCRIPTION FACTORS.Nuclear Proteins: Proteins found in the nucleus of a cell. Do not confuse with NUCLEOPROTEINS which are proteins conjugated with nucleic acids, that are not necessarily present in the nucleus.Polymorphism, Single Nucleotide: A single nucleotide variation in a genetic sequence that occurs at appreciable frequency in the population.Genotype: The genetic constitution of the individual, comprising the ALLELES present at each GENETIC LOCUS.Taq Polymerase: A heat stable DNA-DIRECTED DNA POLYMERASE from the bacteria Thermus aquaticus. It is widely used for the amplification of genes through the process of POLYMERASE CHAIN REACTION. EC 2.7.7.-.Genotyping Techniques: Methods used to determine individuals' specific ALLELES or SNPS (single nucleotide polymorphisms).Genetic Predisposition to Disease: A latent susceptibility to disease at the genetic level, which may be activated under certain conditions.Alleles: Variant forms of the same gene, occupying the same locus on homologous CHROMOSOMES, and governing the variants in production of the same gene product.Gene Frequency: The proportion of one particular in the total of all ALLELES for one genetic locus in a breeding POPULATION.Antibodies: Immunoglobulin molecules having a specific amino acid sequence by virtue of which they interact only with the ANTIGEN (or a very similar shape) that induced their synthesis in cells of the lymphoid series (especially PLASMA CELLS).Antibody Specificity: The property of antibodies which enables them to react with some ANTIGENIC DETERMINANTS and not with others. Specificity is dependent on chemical composition, physical forces, and molecular structure at the binding site.Antibodies, Viral: Immunoglobulins produced in response to VIRAL ANTIGENS.Antibodies, Monoclonal: Antibodies produced by a single clone of cells.Antibodies, Bacterial: Immunoglobulins produced in a response to BACTERIAL ANTIGENS.Antibody Formation: The production of ANTIBODIES by proliferating and differentiated B-LYMPHOCYTES under stimulation by ANTIGENS.Rabbits: The species Oryctolagus cuniculus, in the family Leporidae, order LAGOMORPHA. Rabbits are born in burrows, furless, and with eyes and ears closed. In contrast with HARES, rabbits have 22 chromosome pairs.DNA-(Apurinic or Apyrimidinic Site) Lyase: A DNA repair enzyme that catalyses the excision of ribose residues at apurinic and apyrimidinic DNA sites that can result from the action of DNA GLYCOSYLASES. The enzyme catalyzes a beta-elimination reaction in which the C-O-P bond 3' to the apurinic or apyrimidinic site in DNA is broken, leaving a 3'-terminal unsaturated sugar and a product with a terminal 5'-phosphate. This enzyme was previously listed under EC 3.1.25.2.Immunohistochemistry: Histochemical localization of immunoreactive substances using labeled antibodies as reagents.Deoxyribonuclease IV (Phage T4-Induced): An enzyme which catalyzes the endonucleolytic cleavage of phosphodiester bonds at purinic or apyrimidinic sites (AP-sites) to produce 5'-Phosphooligonucleotide end products. The enzyme prefers single-stranded DNA (ssDNA) and was formerly classified as EC 3.1.4.30.Carbon-Oxygen Lyases: Enzymes that catalyze the cleavage of a carbon-oxygen bond by means other than hydrolysis or oxidation. EC 4.2.

Distinct and redundant functions of mu1 medium chains of the AP-1 clathrin-associated protein complex in the nematode Caenorhabditis elegans. (1/17)

In the nematode Caenorhabditis elegans, there exist two micro1 medium chains of the AP-1 clathrin-associated protein complex. Mutations of unc-101, the gene that encodes one of the micro1 chains, cause pleiotropic effects (). In this report, we identified and analyzed the second mu1 chain gene, apm-1. Unlike the mammalian homologs, the two medium chains are expressed ubiquitously throughout development. RNA interference (RNAi) experiments with apm-1 showed that apm-1 and unc-101 were redundant in embryogenesis and in vulval development. Consistent with this, a hybrid protein containing APM-1, when overexpressed, rescued the phenotype of an unc-101 mutant. However, single disruptions of apm-1 or unc-101 have distinct phenotypes, indicating that the two medium chains may have distinct functions. RNAi of any one of the small or large chains of AP-1 complex (sigma1, beta1, or gamma) showed a phenotype identical to that caused by the simultaneous disruption of unc-101 and apm-1, but not that by single disruption of either gene. This suggests that the two medium chains may share large and small chains in the AP-1 complexes. Thus, apm-1 and unc-101 encode two highly related micro1 chains that share redundant and distinct functions within AP-1 clathrin-associated protein complexes of the same tissue.  (+info)

Sigma 1- and mu 1-Adaptin homologues of Leishmania mexicana are required for parasite survival in the infected host. (2/17)

The sorting of membrane-bound proteins from the trans-Golgi network to lysosomal/endosomal compartments is achieved by preferential inclusion into clathrin-coated vesicles. Contained within the cytoplasmic domains of such proteins, specific sequence motifs have been identified (tyrosine-based and/or di-leucine-based) that are essential for targeting and are recognized by a family of heterotetrameric adaptor complexes, which then recruit clathrin. These cytosolic protein complexes, which have been found in a wide variety of higher eukaryotic organisms, are essential for the development of multicellular organisms. In trypanosomatids, the adaptin-mediated sorting of proteins is largely uncharacterized. In order to identify components of the adaptor-complex machinery, this study reports the cloning and characterization of sigma 1- and mu 1-adaptin gene homologues from the eukaryotic protozoan parasite, Leishmania mexicana. Generation of sigma 1- and mu 1-adaptin gene deletion mutants shows that these promastigote parasites are viable in culture, but are unable to establish infection of macrophages or mice, indicating that adaptin function is crucial for pathogenesis in these unicellular organisms.  (+info)

The AP-3 clathrin-associated complex is essential for embryonic and larval development in Caenorhabditis elegans. (3/17)

The adaptor protein (AP) complexes are involved in membrane transport of many proteins. There are 3 AP complexes in C. elegans unlike mammals that have four. To study the biological functions of the AP-3 complexes of C. elegans, we sought homologues of the mouse and human genes that encode subunits of the AP-3 complexes by screening C. elegans genomic and EST sequences. We identified single copies of homologues of the m3, s3, b3 and d genes. The medium chain of AP-3 is encoded by a single gene in C. elegans but two different genes in mammals. Since there are no known mutations in these genes in C. elegans, we performed RNAi to assess their functions in development. RNAi of each of the genes caused embryonic and larval lethal phenotypes. APM-3 is expressed in most cells, particularly strongly in spermatheca and vulva. We conclude that the products of the C. elegans m3, s3, b3 and d genes are essential for embryogenesis and larval development.  (+info)

Mutations in the gene encoding the Sigma 2 subunit of the adaptor protein 1 complex, AP1S2, cause X-linked mental retardation. (4/17)

In a systematic sequencing screen of the coding exons of the X chromosome in 250 families with X-linked mental retardation (XLMR), we identified two nonsense mutations and one consensus splice-site mutation in the AP1S2 gene on Xp22 in three families. Affected individuals in these families showed mild-to-profound mental retardation. Other features included hypotonia early in life and delay in walking. AP1S2 encodes an adaptin protein that constitutes part of the adaptor protein complex found at the cytoplasmic face of coated vesicles located at the Golgi complex. The complex mediates the recruitment of clathrin to the vesicle membrane. Aberrant endocytic processing through disruption of adaptor protein complexes is likely to result from the AP1S2 mutations identified in the three XLMR-affected families, and such defects may plausibly cause abnormal synaptic development and function. AP1S2 is the first reported XLMR gene that encodes a protein directly involved in the assembly of endocytic vesicles.  (+info)

Mutations in the AP1S2 gene encoding the sigma 2 subunit of the adaptor protein 1 complex are associated with syndromic X-linked mental retardation with hydrocephalus and calcifications in basal ganglia. (5/17)

Fried syndrome, first described in 1972, is a rare X-linked mental retardation that has been mapped by linkage to Xp22. Clinical characteristics include mental retardation, mild facial dysmorphism, calcifications of basal ganglia and hydrocephalus. A large four-generation family in which the affected males have striking clinical features of Fried syndrome were investigated for linkage to X-chromosome markers; the results showed that the gene for this condition lies within the interval DXS7109-DXS7593 in Xp22.2. In total, 60 candidate genes located in this region, including AP1S2, which was recently shown to be involved in mental retardation, were screened for mutations. A mutation in the third intron of AP1S2 was found in all affected male subjects in this large French family. The mutation resulted in skipping of exon 3, predicting a protein with three novel amino-acids and with termination at codon 64. In addition, the first known large Scottish family affected by Fried syndrome was reinvestigated, and a new nonsense mutation, p.Gln66X, was found in exon 3. Using CT, both affected patients from the French family who were analysed had marked calcifications of the basal ganglia, as previously observed in the first Scottish family, suggesting that the presence of distinctive basal ganglia calcification is an essential parameter to recognise this syndromic disorder. It may be possible to use this feature to identify families with X-linked mental retardation that should be screened for mutations in AP1S2.  (+info)

Disruption of AP1S1, causing a novel neurocutaneous syndrome, perturbs development of the skin and spinal cord. (6/17)

 (+info)

AP17 and AP19, the mammalian small chains of the clathrin-associated protein complexes show homology to Yap17p, their putative homolog in yeast. (7/17)

AP17 and AP19 are the smallest polypeptide chain components of AP-2 and AP-1, the clathrin-associated protein complexes found in coated structures of the plasma membrane and Golgi apparatus of mammalian cells. cDNA clones representing the entire coding sequence of AP17 and AP19 were isolated from rat and mouse brain cDNA libraries, respectively. Determination of their nucleotide sequence predicts proteins of 142 and 158 amino acids with Mr 17,018 and 18,733. A sequence comparison of rat brain AP17 with mouse brain AP19 demonstrates that the small chains are highly related. A computer search for other related proteins has uncovered in yeast a previously unknown gene whose DNA sequence encodes a protein homologous to the small chain of AP complexes. The yeast sequence predicts Yap17p, a protein with 147 amino acids and a Mr of 17,373 that is slightly more related to the mammalian AP17 chain than to its AP19 counterpart.  (+info)

Local clustering of transferrin receptors promotes clathrin-coated pit initiation. (8/17)

 (+info)

The protein encoded by this gene is the medium chain of the trans-Golgi network clathrin-associated protein complex AP-1. The other components of this complex are beta-prime-adaptin, gamma-adaptin, and the small chain AP1S1. This complex is located at the…
Component of the adaptor complexes which link clathrin to receptors in coated vesicles. Clathrin-associated protein complexes are believed to interact with the cytoplasmic tails of membrane proteins, leading to their selection and concentration. AP50 is a subunit of the plasma membrane adaptor. The complex binds polyphosphoinositide-containing lipids. [-] ...
One of the goals of this workout is to avoid "dumping the chain" into the hardest gear for a sprint. Sprinting starts out with a hard jump. As you "wind" out each gear, you shift down one. Just like driving a stick-shift car, you work down the gears when the rpms reach the correct range. After warming up, begin six sprints in the small chain ring with no gear changes, riding 50 meters and winding the gears out. Rest 2-3 minutes between sprints. Then do three sprints in the big chain ring, shifting once. Rest 2-3 minutes after each sprint. Next do three big chainring sprints two gear changes. Finish with one big-ring sprint with three gear changes. Cool down.. ...
By Scott Harris on June 21, 2013 I recently had a fascinating and illustrative new business meeting. I received a call from the owner of a small chain of
npu:Npun_F4197 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] , (GenBank) ribulose bisphosphate carboxylase, small chain RbcS (A) MQTLPKERRYETLSYLPPLSDAQIAKQIQYILNQGYIPAIEFNETSEPTELYWTMWKLPL FGAKSTQEVLSEVQGCRSQFNGSYIRVVGFDNIKQCQVLSFLVHKPNRY ...
K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] , (RefSeq) ribulose bisphosphate carboxylase small chain, ...
K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] , (RefSeq) ribulose bisphosphate carboxylase small chain A, chloroplastic- ...
This is one of three E.coli hydrogenases synthesized in response to different physiological conditions. HYD1 is believed to have a role in hydrogen cycling during fermentative growth.
Petrobreak oil cleaning spray is is an environmentally safe formula that is effective in both extinguishing and preventing petroleum fires, Petrobreak contains enzymes that convert long chain hydrocarbon into small chain byproducts, causing spills to disa
Petrobreak oil cleaning spray is is an environmentally safe formula that is effective in both extinguishing and preventing petroleum fires, Petrobreak contains enzymes that convert long chain hydrocarbon into small chain byproducts, causing spills to disa
ppp:PHYPADRAFT_87752 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] , (RefSeq) hypothetical protein (A) MASAVVSVSIVAAASPASVCRESSSVKQFSGLKSTTLSASKARRLSSVHNGSRVQCMQVW NPIGQPKFETFSYLPPLTDDQIAKQVDFMIQQNLIPCIEFDTVGSVSRTNFSGPGSSGYY DGRYWTMWKLPMFGCTDSAQVLREIQECKQSFPSCWVRVLGFDSKKQVQICGFLVARPN ...
BIKE: Jenn yelled at me that I was in 6th place overall...including the first wave. The guy in the lead had about 5 minutes on me. I used the initial flat part of the bike to get into my shoes, which were already on my bike. Then I dropped into the small chain ring and began the climb out of town. First, I picked off my buddy from the swim. Then I would spot riders way up the road, one by one....and use them to gauge off of. I felt really good, early. I tried to keep my power numbers in check. Around mile 21-22, I saw a rider. I thought that there was one more guy in front of him, based on Jenns early assessment. But, while I was working to catch him, I caught a glimpse of a car in front with the hazard lights on. Hmm...was that the lead car? I passed the guy around mile 23 and tried to ask him if he was in front....but he either didnt hear me or didnt want to tell me. But, I had a strong feeling he was. I received confirmation later when I passed a couple of spectators out on the course. I ...
I really enjoyed the book and learned a lot of new lessons from it. It posed some tricky questions that I hadnt really thought about deeply before, such as whether and how much to bail your kids out when they mess up (like when they forget their homework at home and youre already going to be stopping by school anyways). I was surprised by how far the author suggests taking the autonomy supportive parenting approach, but after thinking about it some more, I agree with her framework and ideas. It all boils down, in the end, to trusting your child and taking a long-term view on how they grow up to be independent, capable adults who can take care of themselves rather than optimizing for short-term performance (which is hard in a competitive, "if-they-dont-go-to-x-preschool-then-they-wont-go-to-Harvard-so-theyll-be-on-the-streets" mentality ...
#financialSherpa Valentina is very friendly, caring and attentive to all patients, and she is a pleasure to have with us. Our office is run with
No Prescription Required. Full Service, Full Discount Drug Store. All Our Medicines Are Sent In Discreet Packaging. Doxycycline Purchase Uk.
RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site.
Peptide therapeutics market is expected to grow over the forecast period owing to the increasing prevalence of cancer and other various metabolic diseases. The other growth drivers of this market are introduction of technological advancements such as hybrid method of synthesis of peptides, lifestyle induced diseases such as obesity & diabetes, sophisticated healthcare infrastructure, increasing population and awareness. Peptides are referred as amide bonds which are linked with small chains of amino acid monomers. Peptides differ from protein on the basis of size. The presence of amino acids in peptides is less than 55 molecules. Peptides crunch themselves to some imitate such as receptor ligands and specific cell surface receptors.. As peptides act on cell membrane, so it helps peptides in treating various diseases. As the market has a huge potential, thus various biotechnology and pharmaceutical industries are developing new peptides that can be used for various purposes. So these companies ...
Sensor uses frog peptides to test for drug and medical device contamination. Princeton engineers have developed a sensor that may revolutionize how drugs and medical devices are tested for contamination, and in the process also help ensure the survival of two species of threatened animals.. To be fair, some of the credit goes to an African frog.. In the wild, the African clawed frog produces antibacterial peptides -- small chains of amino acids -- on its skin to protect it from infection. Princeton researchers have found a way to attach these peptides, which can be synthesized in the laboratory, to a small electronic chip that emits an electrical signal when exposed to harmful bacteria, including pathogenic E. coli and salmonella.. "Its a robust, simple platform," said Michael McAlpine, an assistant professor of mechanical and aerospace engineering and the lead researcher on the project. "We think these chips could replace the current method of testing medical devices and drugs.". A paper ...
It has been 1 is strongly induced negative feedback like left ankle fracture. Although limited clinical studies, and i have been pharmacologic evidence, suggest that ceftriaxone 1 g daily either IM or IV countertransference reactions in contrast involve of overidentification, over idealization, enmeshment, and dose and duration of ceftriaxone therapy have not been defined 211. INTRODUCTION: Peritoneal access techniques to the cath eter, orthotics would seemingly solve clinical application of natural feel tired or struggle. Our team is here to help you reach demonstrates strain specific, preferential consumption of small chain a fulfilled and functional human lactation. Through the phosphorylation process, of my please click the following webpage - http://www.bvslogic.ru/index.php/component/k2/itemlist/user/35217 Heart and peripheral blood T cells NFAT signalling, which regulates technique may include a in a tight range, TSLP is required for activation of sensory neurones, and thereby, itch ...
Monoklonale und polyklonale gamma 1 Adaptin Antikörper für viele Methoden. Ausgesuchte Qualitäts-Hersteller für gamma 1 Adaptin Antikörper. Hier bestellen.
Since RuBisCO is often rate-limiting for photosynthesis in plants, it may be possible to improve photosynthetic efficiency by modifying RuBisCO genes in plants to increase catalytic activity and/or decrease oxygenation rates.[24] This could improve biosequestration of CO2 and be an important climate change strategy. Approaches under investigation include transferring RuBisCO genes from one organism in another organism,engineering Rubisco activase from thermophilic cyanobacteria into temperature sensitive plants, increasing the level of expression of RuBisCO subunits, expressing RuBisCO small chains from the chloroplast DNA, and altering RuBisCO genes to increase specificity for carbon dioxide or otherwise increase the rate of carbon fixation.[25][26]. Although, as the levels of CO2 rise, efforts to increase specificity for CO2 may be unnecessary.. One avenue is to introduce RuBisCO variants with naturally high specificity values such as the ones from the red alga Galdieria partita into plants. ...
In 1971, the business was re-launched as "Thomson Holidays" under the leadership of Bryan Llewellyn as managing director.[2] In 1972 Thomson acquired Lunn Poly, a small chain of agents which Thomas grew to become the largest chain of travel agents in the United Kingdom.[3] In 1981, Thomson Holidays were the first recorded users of Business-to-Business online shopping.[4] The business was floated on the London Stock Exchange with a valuation of £1.7 billion as Thomson Travel in May 1998.[5][6] In 2000, Thomson Travel was acquired by Preussag AG, an industrial and transport conglomerate.[7] Although Preussag AG, which re-named as TUI AG in 2002, retained the Thomson brand for a while, it was retired completely in 2017.[7] ...
McKesson Corporation (McKesson), one of the nations largest distributors of pharmaceutical drugs, agreed to pay a record $150 million civil penalty for alleged violations of the Controlled Substances Act (CSA), the Justice Department announced today. The nationwide settlement requires McKesson to suspend sales of controlled substances from distribution centers in Colorado, Ohio, Michigan and Florida for multiple years. The staged suspensions are among the most severe sanctions ever agreed to by a Drug Enforcement Administration (DEA) registered distributor. The settlement also imposes new and enhanced compliance obligations on McKessons distribution system. In 2008, McKesson agreed to a $13.25 million civil penalty and administrative agreement for similar violations. In this case, the government alleged again that McKesson failed to design and implement an effective system to detect and report "suspicious orders" for controlled substances distributed to its independent and small chain pharmacy ...
At UC San Francisco, we encourage our students to approach health care issues with critical thinking and a spirit of inquiry. As tomorrows health and science leaders in training, UCSF students embody our passion for improving the human condition and pushing health care forward.. ...
"Entrez Gene: AP3S2 adaptor-related protein complex 3, sigma 2 subunit". Dell'Angelica, E C; Ooi C E; Bonifacino J S (Jun 1997 ... AP-3 complex subunit sigma-2 is a protein that in humans is encoded by the AP3S2 gene. AP3S2 has been shown to interact with ... Dell'Angelica EC, Ooi CE, Bonifacino JS (1997). "Beta3A-adaptin, a subunit of the adaptor-like complex AP-3". J. Biol. Chem. ... 2003). "Specific regulation of the adaptor protein complex AP-3 by the Arf GAP AGAP1". Dev. Cell. 5 (3): 513-21. doi:10.1016/ ...
"Entrez Gene: AP1S1 adaptor-related protein complex 1, sigma 1 subunit". Montpetit A, Côté S, Brustein E, Drouin CA, Lapointe L ... AP-1 complex subunit sigma-1A is a protein that in humans is encoded by the AP1S1 gene. The protein encoded by this gene is ... Boehm M, Aguilar RC, Bonifacino JS (Nov 2001). "Functional and physical interactions of the adaptor protein complex AP-4 with ... Page LJ, Robinson MS (Nov 1995). "Targeting signals and subunit interactions in coated vesicle adaptor complexes". The Journal ...
"Entrez Gene: AP3S1 adaptor-related protein complex 3, sigma 1 subunit". Human AP3S1 genome location and AP3S1 gene details page ... AP-3 complex subunit sigma-1 is a protein that in humans is encoded by the AP3S1 gene. GRCh38: Ensembl release 89: ... "Interaction of insulin receptor substrate-1 with the sigma3A subunit of the adaptor protein complex-3 in cultured adipocytes". ... Dell'Angelica EC, Ohno H, Ooi CE, Rabinovich E, Roche KW, Bonifacino JS (Apr 1997). "AP-3: an adaptor-like protein complex with ...
AP-1 complex subunit sigma-2 is a protein that in humans is encoded by the AP1S2 gene. Adaptor protein complex 1 is found at ... "Entrez Gene: AP1S2 adaptor-related protein complex 1, sigma 2 subunit". Human AP1S2 genome location and AP1S2 gene details page ... "Mutations in the gene encoding the Sigma 2 subunit of the adaptor protein 1 complex, AP1S2, cause X-linked mental retardation ... The protein encoded by this gene serves as the small subunit of this complex and is a member of the adaptin protein family. ...
AP1S2: AP-1 complex subunit sigma-2. Adaptor protein complex 1 is found on the cytoplasmic face of vesicles located at the ... "Entrez Gene: AP1S2 adaptor-related protein complex 1, sigma 2 subunit". Piccini M, Vitelli F, Bruttini M, Pober BR, Jonsson JJ ... "Mutations in the Gene Encoding the Sigma 2 Subunit of the Adaptor Protein 1 Complex, AP1S2, Cause X-Linked Mental Retardation ... This nucleolar protein is involved in the processing and modification of tRNA. GDI1: RabGDI alpha makes a complex with ...
"Entrez Gene: AP2S1 adaptor-related protein complex 2, sigma 1 subunit". Pearse BM, Smith CJ, Owen DJ (2000). "Clathrin coat ... AP-2 complex subunit sigma is a protein that in humans is encoded by the AP2S1 gene. One of two major clathrin-associated ... Page LJ, Robinson MS (1995). "Targeting signals and subunit interactions in coated vesicle adaptor complexes". J. Cell Biol. ... "A novel spliced transcript of human CLAPS2 encoding a protein alternative to clathrin adaptor protein AP17". Gene. 220 (1-2): ...
Adaptins are clustered subunits of adaptor protein (AP) complexes.. There are several types of adaptin, each related to a ... sigma): complex 1 AP1B1 AP1G1 AP1G2 AP1M1 AP1M2 AP1S1 AP1S2 AP1S3 complex 2 AP2A1 AP2A2 AP2B1 AP2M1 AP2S1 complex 3 AP3B1 AP3B2 ... 2011) The Fifth Adaptor Protein Complex. PLoS Biol 9(10): e1001170. doi:10.1371/journal.pbio.1001170. ... "Bivalent Motif-Ear Interactions Mediate the Association of the Accessory Protein Tepsin with the AP-4 Adaptor Complex". ncbi. ...
AP complexes are heterotetramers composed of two large subunits (adaptins), a medium subunit (mu) and a small subunit (sigma). ... Adaptor protein (AP) complexes are found in coated vesicles and clathrin-coated pits. AP complexes connect cargo proteins and ... Touz MC, Kulakova L, Nash TE (July 2004). "Adaptor protein complex 1 mediates the transport of lysosomal proteins from a Golgi- ... The two major types of clathrin adaptor complexes are the heterotetrameric vesicular transport adaptor proteins (AP1-5), and ...
This gene encodes the alpha 1 adaptin subunit of the adaptor protein 2 (AP2 adaptors) complex found in clathrin coated vesicles ... sigma). The complex is part of the protein coat on the cytoplasmic face of coated vesicles which links clathrin to receptors in ... "Entrez Gene: AP2A1 adaptor-related protein complex 2, alpha 1 subunit". Nishimura, Takashi; Fukata Yuko; Kato Katsuhiro; ... Adaptor-related protein complex 2, alpha 1 has been shown to interact with DPYSL2 and NUMB. GRCh38: Ensembl release 89: ...
The protein encoded by this gene is the medium subunit of AP-3, which is an adaptor-related protein complex associated with the ... a medium subunit (mu3), and a small subunit (sigma 3). Mutations in one of the large subunits of AP-3 have been associated with ... "Entrez Gene: AP3M1 adaptor-related protein complex 3, mu 1 subunit". Human AP3M1 genome location and AP3M1 gene details page in ... 2000). "Interactions of HIV-1 nef with the mu subunits of adaptor protein complexes 1, 2, and 3: role of the dileucine-based ...
AP (adaptor protein) complexes are found in coated vesicles and clathrin-coated pits. AP complexes connect cargo proteins and ... AP complexes are heterotetramers composed of two large subunits (adaptins), a medium subunit (mu) and a small subunit (sigma). ... The two major types of clathrin adaptor complexes are the heterotetrameric adaptor protein (AP) complexes, and the monomeric ... Touz MC, Kulakova L, Nash TE (July 2004). "Adaptor protein complex 1 mediates the transport of lysosomal proteins from a Golgi- ...
... and a small subunit σ (sigma ∼20 kD), and named 1 through 5 corresponding to the 5 AP complexes. Components of COPI (cop one) a ... Most of the adaptor proteins are heterotetramers. In the AP complexes, there are two large proteins (∼100 kD) and two smaller ... Vesicular transport adaptor proteins are proteins involved in forming complexes that function in the trafficking of molecules ... but not closely related to the AP/TSET complexes. The individual proteins of the COPII complex are called SEC proteins, because ...
AP-4 complex subunit beta-1 is a protein that in humans is encoded by the AP4B1 gene. The heterotetrameric adaptor protein (AP ... sigma-4 (AP4S1) AP4B1 has been shown to interact with AP4M1. AP4-complex-mediated trafficking plays a crucial role in brain ... "Entrez Gene: AP4B1 adaptor-related protein complex 4, beta 1 subunit". Hirst J, Bright NA, Rous B, Robinson MS (August 1999). " ... 2001). "Similar subunit interactions contribute to assembly of clathrin adaptor complexes and COPI complex: analysis using ...
AP-4 complex subunit sigma-1 is a protein that in humans is encoded by the AP4S1 gene. The heterotetrameric adaptor protein (AP ... Hirst J, Bright NA, Rous B, Robinson MS (1999). "Characterization of a fourth adaptor-related protein complex". Mol. Biol. Cell ... Dell'Angelica EC, Mullins C, Bonifacino JS (1999). "AP-4, a novel protein complex related to clathrin adaptors". J. Biol. Chem ... adaptor-related protein complex 4". Abou Jamra R, Philippe O, Raas-Rothschild A, Eck SH, Graf E, Buchert R, Borck G, Ekici A, ...
AP-4 complex subunit epsilon-1 is a protein that in humans is encoded by the AP4E1 gene. The heterotetrameric adaptor protein ( ... sigma-4 (AP4S1). It is currently hypothesized that AP4-complex-mediated trafficking plays a crucial role in brain development ... 2001). "Similar subunit interactions contribute to assembly of clathrin adaptor complexes and COPI complex: analysis using ... Hirst J, Bright NA, Rous B, Robinson MS (1999). "Characterization of a fourth adaptor-related protein complex". Mol. Biol. Cell ...
Sedimentation Velocity Analysis of Heterogeneous Protein-Protein Interactions: Lamm Equation Modeling and Sedimentation ... The ribosomes, membranes and Golgi complexes can be separated by another technique called density gradient centrifugation. ... The rotors may come with different adapters to hold various sizes of test tubes, bottles, or microtiter plates. ... "Sigma-Aldrich. Retrieved 10 May 2016.. *^ Article on "Centrifugation" retrieved on 15 October 2013 from http://www.lenntech.com ...
... adaptor protein complex mu subunits MeSH D12.776.543.990.150.500.750 -- adaptor protein complex sigma subunits MeSH D12.776. ... adaptor protein complex alpha subunits MeSH D12.776.543.990.150.500.200 -- adaptor protein complex beta subunits MeSH D12.776. ... adaptor protein complex delta subunits MeSH D12.776.543.990.150.500.400 -- adaptor protein complex gamma subunits MeSH D12.776. ... adaptor protein complex 4 MeSH D12.776.543.990.150.500 -- adaptor protein complex subunits MeSH D12.776.543.990.150.500.100 -- ...
By 1900, it had been generally accepted that proteins were composed of amino acids; however, whether proteins were colloids or ... "Centrifugation Basics". Sigma-Aldrich. Retrieved 10 May 2016. Article on "Centrifugation" retrieved on 15 October 2013 from ... The rotors may come with different adapters to hold various sizes of test tubes, bottles, or microtiter plates. General method ... membranes and Golgi complexes can be separated by another technique called density gradient centrifugation. Ultracentrifugation ...
2001). "Axonal transport of amyloid precursor protein is mediated by direct binding to the kinesin light chain subunit of ... and the Golgi complex. Thus, kinesin light chains function as adapter molecules and not motors per se. Although previously ... 2005). "Targeted proteomic analysis of 14-3-3 sigma, a p53 effector commonly silenced in cancer". Mol. Cell. Proteomics. 4 (6 ... Kinesin light chain 1 is a protein that in humans is encoded by the KLC1 gene. Conventional kinesin is a tetrameric molecule ...
... a Rho family GTPase-activating protein that interacts with signaling adapters Gab1 and Gab2". J. Biol. Chem. 278 (36): 34641-53 ... PX-RICS was found to be a necessary component for the export of this complex to the Golgi and then onwards to the cellular ... Benzinger A, Muster N, Koch HB, Yates JR, Hermeking H (2005). "Targeted proteomic analysis of 14-3-3 sigma, a p53 effector ... and weak binding to the NR2 subunits) suggests that there may be another pathway for it modifying spine structure as well. The ...
Moreover, cingulin forms a complex with JAM-A, a tight junction membrane protein. Most of cingulin protein interactions are ... Aijaz S, D'Atri F, Citi S, Balda MS, Matter K (May 2005). "Binding of GEF-H1 to the tight junction-associated adaptor cingulin ... Benzinger A, Muster N, Koch HB, Yates JR, Hermeking H (June 2005). "Targeted proteomic analysis of 14-3-3 sigma, a p53 effector ... each subunit containing a N-terminal globular "head" domain, a long α-helical coiled-coil "rod" domain and a small globular C- ...
The adaptor molecules were eventually shown to be tRNAs and the catalytic "ribonucleic-protein complexes" became known as ... Such a code might be "degenerate", with 4×4×4=64 possible triplets of the four nucleotide subunits while there were only 20 ... ribonucleic-protein complexes that catalyse the assembly of amino acids into proteins according to the messenger RNA ... Sigma Xi. Hidden categories: *Pages using ISBN magic links. *Use British English from August 2012 ...
Gi alpha subunits (also termed Giα subunits) inhibit adenylyl cyclase b) G beta-gamma complex of subunits (Gβγ) have many ... G-protein coupled receptor signaling pathway. • adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway. • G- ... clathrin and clathrin adaptor AP2, of the receptor internalization machinery. These pathways render DP2 unable to mobilize ... G protein-coupled receptors (GPCRs) such as DP2 are integral membrane proteins that, when bound by their cognate ligands (or, ...
Signal transducing adaptor protein. *Scaffold protein. Transcription factors. *General. *Transcription preinitiation complex ... They have a heteromeric structure in that each subunit consists of the extracellular ligand-binding domain and a transmembrane ... and can be a protein or peptide (short protein), or another small molecule such as a neurotransmitter, hormone, pharmaceutical ... In biochemistry and pharmacology, a receptor is a protein molecule that receives chemical signals from outside a cell.[1] When ...
Compare adaptor related protein complex 2 subunit sigma 1 ELISA Kits from leading suppliers on Biocompare. View specifications ... adaptor related protein complex 2 subunit sigma 1 ELISA Kits. The ELISA (enzyme-linked immunosorbent assay) is a well- ... Your search returned 34 adaptor related protein complex 2 subunit sigma 1 ELISA ELISA Kit across 3 suppliers. ... Watch Webinar: How To Get Speed and Depth in your Host Cell Protein (HCP) Analysis ...
... adaptor related protein complex 4 sigma 1 subunit), Authors: Dessen P. Published in: Atlas Genet Cytogenet Oncol Haematol. ... AP4S1 (adaptor related protein complex 4 sigma 1 subunit). Identity. Alias_names. adaptor-related protein complex 4, sigma 1 ... transporter activity clathrin-coated pit protein transporter activity protein transport endosome lumen trans-Golgi network ... transporter activity clathrin-coated pit protein transporter activity protein transport endosome lumen trans-Golgi network ...
adaptor-related protein complex 2, sigma 1 subunit. Gene nomenclature, locus information, and GO, OMIM, and PMID associations ... OMIM: HYPOCALCIURIC HYPERCALCEMIA, FAMILIAL, TYPE III; HHC3, ADAPTOR-RELATED PROTEIN COMPLEX 2, SIGMA-1 SUBUNIT; AP2S1*Gene ...
Creative Biomart offer ap3s2 proteins for life sciences research. All the products are rigorously tested to meet the most ... AP3S2;adaptor-related protein complex 3, sigma 2 subunit;AP-3 complex subunit sigma-2;sigma3b;sigma-3B-adaptin;sigma-adaptin 3b ... adaptor complex sigma3B;AP-3 complex subunit sigma-3B;clathrin-associated/assembly/adaptor protein, small 4, 22-kD;AP3S3; ... Protein Function. AP3S2 has several biochemical functions, for example, protein transporter activity. Some of the functions are ...
adaptor related protein complex 4 subunit sigma 1. Enable Javascript to view the expand/collapse boxes.. Open All Close All ... Component of the adaptor protein complex 4 (AP-4). Adaptor protein complexes are vesicle coat components involved both in ... The encoded protein is the small subunit of adaptor protein complex-4, which is associated with both clathrin- and nonclathrin- ... This gene encodes a member of the adaptor complexes small subunit protein family. These proteins are components of the ...
AP1S2 encodes an adaptin protein that constitutes part of the adaptor protein complex found at the cytoplasmic face of coated ... Aberrant endocytic processing through disruption of adaptor protein complexes is likely to result from the AP1S2 mutations ... AP1S2 is the first reported XLMR gene that encodes a protein directly involved in the assembly of endocytic vesicles. ... The complex mediates the recruitment of clathrin to the vesicle membrane. ...
The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the ... Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi ... Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi ... help/subunit_structure target=_top>More...,/a>,/p>Subunit structurei. Adaptor protein complex 1 (AP-1) is a heterotetramer ...
AP-1 complex subunit sigma-3 , adapter-related protein complex 1 sigma-1C subunit , adaptor protein complex AP-1 sigma-1C ... anti-Adaptor-Related Protein Complex 3, sigma 1 Subunit Antikörper * anti-Adaptor-Related Protein Complex 3, sigma 2 Subunit ... anti-Adaptor-Related Protein Complex 1, sigma 2 Subunit Antikörper * anti-Adaptor-Related Protein Complex 1, mu 2 Subunit ... anti-Adaptor-Related Protein Complex 2, mu 1 Subunit Antikörper * anti-Adaptor-Related Protein Complex 2, sigma 1 Subunit ...
AP-3 complex sigma-3A subunit; AP-3 complex subunit sigma-1; AP-3 complex subunit sigma-3A; adapter-related protein complex 3 ... sigma-1 subunit; clathrin-associated/assembly/adapter protein, small 3; clathrin-associated/assembly/adaptor protein, small 3 ( ... AP3S1 belongs to the adaptor complexes 3 (AP3) small subunit family which is not clathrin-associated. The complex is associated ...
"Entrez Gene: AP3S2 adaptor-related protein complex 3, sigma 2 subunit". DellAngelica, E C; Ooi C E; Bonifacino J S (Jun 1997 ... AP-3 complex subunit sigma-2 is a protein that in humans is encoded by the AP3S2 gene. AP3S2 has been shown to interact with ... DellAngelica EC, Ooi CE, Bonifacino JS (1997). "Beta3A-adaptin, a subunit of the adaptor-like complex AP-3". J. Biol. Chem. ... 2003). "Specific regulation of the adaptor protein complex AP-3 by the Arf GAP AGAP1". Dev. Cell. 5 (3): 513-21. doi:10.1016/ ...
"Entrez Gene: AP1S1 adaptor-related protein complex 1, sigma 1 subunit". Montpetit A, Côté S, Brustein E, Drouin CA, Lapointe L ... AP-1 complex subunit sigma-1A is a protein that in humans is encoded by the AP1S1 gene. The protein encoded by this gene is ... Boehm M, Aguilar RC, Bonifacino JS (Nov 2001). "Functional and physical interactions of the adaptor protein complex AP-4 with ... Page LJ, Robinson MS (Nov 1995). "Targeting signals and subunit interactions in coated vesicle adaptor complexes". The Journal ...
"Entrez Gene: AP3S1 adaptor-related protein complex 3, sigma 1 subunit". Human AP3S1 genome location and AP3S1 gene details page ... AP-3 complex subunit sigma-1 is a protein that in humans is encoded by the AP3S1 gene. GRCh38: Ensembl release 89: ... "Interaction of insulin receptor substrate-1 with the sigma3A subunit of the adaptor protein complex-3 in cultured adipocytes". ... DellAngelica EC, Ohno H, Ooi CE, Rabinovich E, Roche KW, Bonifacino JS (Apr 1997). "AP-3: an adaptor-like protein complex with ...
AP-1 complex subunit sigma-2 is a protein that in humans is encoded by the AP1S2 gene. Adaptor protein complex 1 is found at ... "Entrez Gene: AP1S2 adaptor-related protein complex 1, sigma 2 subunit". Human AP1S2 genome location and AP1S2 gene details page ... "Mutations in the gene encoding the Sigma 2 subunit of the adaptor protein 1 complex, AP1S2, cause X-linked mental retardation ... The protein encoded by this gene serves as the small subunit of this complex and is a member of the adaptin protein family. ...
adaptor-related protein complex 1, sigma 2 subunit [Source:HGNC Symbol;Acc:560]. Mouse Orthologue:. Ap1s2. Mouse Description:. ... adaptor-related protein complex 1, sigma 2 subunit Gene [Source:MGI Symbol;Acc:MGI:1889383]. ...
adaptor-related protein complex 3, sigma 1 subunit. Protein Similarities Based on Shared Motif Content. ... CC] AP-3 adaptor complex *[CC] AP-type membrane coat adaptor complex *[CC] Golgi apparatus *[CC] cytoplasmic vesicle membrane * ... BP] intracellular protein transport *[BP] vesicle-mediated transport *[ ... AP3S1, adaptor-related protein complex 3, sigma 1 subunit. Sequence ID:. NM_001002924. NM_001284. ...
Adaptor-related protein complex 2, sigma 1 subunit. NM_004069. NM_021575. Gene Info. ... PML-RARA regulated adaptor molecule 1. NM_032152. Gene Info. PRKAA1. Protein kinase, AMP-activated, alpha 1 catalytic subunit. ... Low density lipoprotein receptor adaptor protein 1. NM_015627. Gene Info. LGI3. Leucine-rich repeat LGI family, member 3. NM_ ... Mindbomb E3 ubiquitin protein ligase 1. NM_020774. Gene Info. MIB1. Mindbomb E3 ubiquitin protein ligase 1. BX648566. Gene Info ...
AP1S2: AP-1 complex subunit sigma-2. Adaptor protein complex 1 is found on the cytoplasmic face of vesicles located at the ... "Entrez Gene: AP1S2 adaptor-related protein complex 1, sigma 2 subunit". Piccini M, Vitelli F, Bruttini M, Pober BR, Jonsson JJ ... "Mutations in the Gene Encoding the Sigma 2 Subunit of the Adaptor Protein 1 Complex, AP1S2, Cause X-Linked Mental Retardation ... This nucleolar protein is involved in the processing and modification of tRNA. GDI1: RabGDI alpha makes a complex with ...
adaptor related protein complex 1 sigma 1 subunit. The protein encoded by this gene is part of the clathrin coat assembly ... adaptor related protein complex 1 sigma 1 subunit. AP19;CLAPS1;EKV3;MEDNIK;SIGMA1A. NM_001283.3. rs13225397. ... adaptor related protein complex 1 sigma 1 subunit. AP19;CLAPS1;EKV3;MEDNIK;SIGMA1A. NM_001283.3. rs2239537. ... adaptor related protein complex 1 sigma 1 subunit. AP19;CLAPS1;EKV3;MEDNIK;SIGMA1A. NM_001283.3. rs61414985. ...
Adaptor-related protein complex 1, sigma 3 subunit Aliases:. Not Available. RefSeq:. Not Available. ...
Adaptor-related protein complex 3, sigma 2 subunit Aliases:. Not Available. RefSeq:. NM_001159342. ...
adaptor related protein complex 3 sigma 1 subunit. protein-coding. APOBEC3A. apolipoprotein B mRNA editing enzyme catalytic ... adaptor related protein complex 3 beta 1 subunit. protein-coding. APBA2. amyloid beta precursor protein binding family A member ... adaptor related protein complex 4 epsilon 1 subunit. protein-coding. ACP7. acid phosphatase 7, tartrate resistant (putative). ... anaphase promoting complex subunit 4. protein-coding. AIFM2. apoptosis inducing factor, mitochondria associated 2. protein- ...
C15orf38-AP3S2 readthrough;adaptor related protein complex 3 sigma 2 subunit. AP3S3;sigma3b. NM_001199058.1;NM_005829.4. rs7111 ... C15orf38-AP3S2 readthrough;adaptor related protein complex 3 sigma 2 subunit. AP3S3;sigma3b. NM_001199058.1;NM_005829.4. ... C15orf38-AP3S2 readthrough;adaptor related protein complex 3 sigma 2 subunit. AP3S3;sigma3b. NM_001199058.1;NM_005829.4. ... C15orf38-AP3S2 readthrough;adaptor related protein complex 3 sigma 2 subunit. AP3S3;sigma3b. NM_001199058.1;NM_005829.4. ...
AP complexes are heterotetramers composed of two large subunits (adaptins), a medium subunit (mu) and a small subunit (sigma). ... Adaptor protein (AP) complexes are found in coated vesicles and clathrin-coated pits. AP complexes connect cargo proteins and ... Touz MC, Kulakova L, Nash TE (July 2004). "Adaptor protein complex 1 mediates the transport of lysosomal proteins from a Golgi- ... The two major types of clathrin adaptor complexes are the heterotetrameric vesicular transport adaptor proteins (AP1-5), and ...
adaptor-related protein complex 3, sigma 2 subunit. Aliases:. AP3S3, FLJ35955, sigma3b. ...
... adaptor related protein complex 3 sigma 1 subunit) for WB. Anti-AP3S1 pAb (GTX45817) is tested in Human samples. 100% Ab- ... adaptor related protein complex 3 sigma 1 subunit. Synonyms. SIGMA3A Antibody , AP3S1 Antibody , CLAPS3 Antibody. ... Primary Antibodies Secondary Antibodies Proteins & Peptides Lysates & Slides Serum & Reagents Research Kits Isotype Controls ...
  • DLG3: Disks large homolog 3, also named neuroendocrine-DLG or synapse-associated protein 102 (SAP-102). (wikipedia.org)
  • JARID1C: Lysine-specific demethylase 5C is an enzyme that in humans is encoded by the KDM5C gene a member of the SMCY homolog family and encodes a protein with one ARID domain, one JmjC domain, one JmjN domain and two PHD-type zinc fingers. (wikipedia.org)
  • p>When browsing through different UniProt proteins, you can use the 'basket' to save them, so that you can back to find or analyse them later. (uniprot.org)
  • The highly-conserved Notch signaling pathway is unique, as both the Notch receptor and most of its respective ligands (canonically the DSL or Delta/Serrate/lag-2 family members) are transmembrane proteins attached to the cell surface. (antibodies-online.com)
  • We identified several SNPs in the toll-like receptor 4 ( TLR4 ) and syntaxin binding protein 5-like ( STXBP5L ) loci that were associated with fibrosis risk independently of the original significant SNPs. (pubmedcentralcanada.ca)
  • CONTEXT: Autosomal dominant hypocalcemia (ADH) types 1 and 2 are due to calcium-sensing receptor (CASR) and G-protein subunit-α11 (GNA11) gain-of-function mutations, respectively, whereas CASR and GNA11 loss-of-function mutations result in familial hypocalciuric hypercalcemia (FHH) types 1 and 2, respectively. (ox.ac.uk)
  • There are 1193 AP3B1_C domains in 1191 proteins in SMART's nrdb database. (embl.de)
  • Taxonomic distribution of proteins containing AP3B1_C domain. (embl.de)
  • The complete taxonomic breakdown of all proteins with AP3B1_C domain is also avaliable . (embl.de)
  • Click on the protein counts, or double click on taxonomic names to display all proteins containing AP3B1_C domain in the selected taxonomic class. (embl.de)
  • The AP-2 alpha subunit binds polyphosphoinositide-containing lipids, positioning AP-2 on the membrane. (genecards.org)
  • Furthermore, a hydrophobic patch present in the domain also binds to a subset of D-phi-F/W motif-containing proteins that are bound by the alpha-adaptin appendage domain (epsin, AP180, eps15). (wikipedia.org)
  • Note=Binds 0.5 mol of zinc/mol protein, probably 1 zinc per dimer. (antibody-antibodies.com)
  • That RACS also binds to β-catenin and N-cadherins, in vivo within the PSD (which it binds to through PSD-95, and weak binding to the NR2 subunits) suggests that there may be another pathway for it modifying spine structure as well. (wikipedia.org)
  • The pathway maps illustrate protein interactions and regulation to provide a comprehensive picture of signaling and disease processes. (bio-rad.com)
  • In addition, via our preliminary analysis, we report many novel protein interactions and pathway associations. (genes2cognition.org)
  • Proteins required for nutrient uptake or cell wall biosynthesis in the new environment are incorporated into the plasma membrane via the secretory pathway. (asm.org)
  • The AP-3 complex may be directly involved in trafficking to lysosomes or alternatively it may be involved in another pathway, but that mis-sorting in that pathway may indirectly lead to defects in pigment granules (PMID:10024875). (embl.de)
  • p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors. (uniprot.org)
  • Loss-of-function mutations of adaptor protein-2 sigma subunit (AP2σ 2), encoded by AP2S1, cause FHH3, and we therefore sought for gain-of-function AP2S1 mutations that may cause an additional form of ADH, which we designated ADH3. (ox.ac.uk)
  • For example, in AP1 these subunits are gamma-1-adaptin, beta-1-adaptin, mu-1 and sigma-1, while in AP2 they are alpha-adaptin, beta-2-adaptin, mu-2 and sigma-2. (wikipedia.org)
  • By contrast, GGAs are monomers composed of four domains, which have functions similar to AP subunits: an N-terminal VHS (Vps27p/Hrs/Stam) domain, a GAT (GGA and Tom1) domain, a hinge region, and a C-terminal GAE (gamma-adaptin ear) domain. (embl.de)
  • In the present study we have searched the EST database and haveidentified, cloned, and sequenced a ubiquitously expressed homologue of beta-NAP,beta3A, as well as homologues of the alpha/gamma and sigma adaptor subunits,delta and sigma3, which are also ubiquitously expressed. (embl.de)