A genus in the family ACETOBACTERACEAE consisting of chemoorganotrophic, straight rods with rounded ends. They are aerobic and acidophilic.
A family of gram-negative aerobic bacteria consisting of ellipsoidal to rod-shaped cells that occur singly, in pairs, or in chains.
A large group of bacteria including those which oxidize ammonia or nitrite, metabolize sulfur and sulfur compounds, or deposit iron and/or manganese oxides.
A genus of gram-negative, rod-shaped bacteria that derives energy from the oxidation of one or more reduced sulfur compounds. Many former species have been reclassified to other classes of PROTEOBACTERIA.
A strictly autotrophic species of bacteria that oxidizes sulfur and thiosulfate to sulfuric acid. It was formerly called Thiobacillus thiooxidans.
Pyrrole containing pigments found in photosynthetic bacteria.
The discarding or destroying of liquid waste products or their transformation into something useful or innocuous.
Constituent of 30S subunit prokaryotic ribosomes containing 1600 nucleotides and 21 proteins. 16S rRNA is involved in initiation of polypeptide synthesis.
The relative amounts of the PURINES and PYRIMIDINES in a nucleic acid.
DNA sequences encoding RIBOSOMAL RNA and the segments of DNA separating the individual ribosomal RNA genes, referred to as RIBOSOMAL SPACER DNA.
The relationships of groups of organisms as reflected by their genetic makeup.
A genus of RED ALGAE, in the family Plocamiaceae, found in temperate marine environments worldwide. Polyhalogenated monoterpenes of potential medicinal use have been isolated from its species.
A genus of gram-negative, facultatively anaerobic, rod-shaped bacteria that are common in the marine environment and on the surfaces and in the intestinal contents of marine animals. Some species are bioluminescent and are found as symbionts in specialized luminous organs of fish.
Uncontrolled release of biological material from its containment. This either threatens to, or does, cause exposure to a biological hazard. Such an incident may occur accidentally or deliberately.
A sulfur-containing essential L-amino acid that is important in many body functions.
A thiol-containing non-essential amino acid that is oxidized to form CYSTINE.
Substituted thioglucosides. They are found in rapeseed (Brassica campestris) products and related cruciferae. They are metabolized to a variety of toxic products which are most likely the cause of hepatocytic necrosis in animals and humans.
Physiologic methyl radical donor involved in enzymatic transmethylation reactions and present in all living organisms. It possesses anti-inflammatory activity and has been used in treatment of chronic liver disease. (From Merck, 11th ed)
A genus of gram-negative, chemoorganotrophic bacteria in the family Sphingobacteriaceae. They lack FLAGELLA but some species exhibit sliding motility.
The state of weariness following a period of exertion, mental or physical, characterized by a decreased capacity for work and reduced efficiency to respond to stimuli.
Databases containing information about PROTEINS such as AMINO ACID SEQUENCE; PROTEIN CONFORMATION; and other properties.
A process that includes the determination of AMINO ACID SEQUENCE of a protein (or peptide, oligopeptide or peptide fragment) and the information analysis of the sequence.
The procedures involved in combining separately developed modules, components, or subsystems so that they work together as a complete system. (From McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
A loose confederation of computer communication networks around the world. The networks that make up the Internet are connected through several backbone networks. The Internet grew out of the US Government ARPAnet project and was designed to facilitate information exchange.
The protein complement of an organism coded for by its genome.
Linear POLYPEPTIDES that are synthesized on RIBOSOMES and may be further modified, crosslinked, cleaved, or assembled into complex proteins with several subunits. The specific sequence of AMINO ACIDS determines the shape the polypeptide will take, during PROTEIN FOLDING, and the function of the protein.
A genus of gram-negative rod-shaped bacteria in the class GAMMAPROTEOBACTERIA. They are obligately acidophilic and aerobic, using reduced SULFUR COMPOUNDS to support AUTOTROPHIC GROWTH.
Bis(nitrato-O)dioxouranium. A compound used in photography and the porcelain industry. It causes severe renal insufficiency and renal tubular necrosis in mammals and is an effective lymphocyte mitogen.
Uranium. A radioactive element of the actinide series of metals. It has an atomic symbol U, atomic number 92, and atomic weight 238.03. U-235 is used as the fissionable fuel in nuclear weapons and as fuel in nuclear power reactors.
An island in the Lesser Antilles, one of the Windward Islands. Its capital is Fort-de-France. It was discovered by Columbus in 1502 and from its settlement in 1635 by the French it passed into and out of Dutch and British hands. It was made a French overseas department in 1946. One account of the name tells of native women on the shore calling "Madinina" as Columbus approached the island. The meaning was never discovered but was entered on early charts as Martinique, influenced by the name of St. Martin. (From Webster's New Geographical Dictionary, 1988, p734 & Room, Brewer's Dictionary of Names, 1992, p339)
Widely scattered islands in the Atlantic Ocean as far north as the AZORES and as far south as the South Sandwich Islands, with the greatest concentration found in the CARIBBEAN REGION. They include Annobon Island, Ascension, Canary Islands, Falkland Islands, Fernando Po (also called Isla de Bioko and Bioko), Gough Island, Madeira, Sao Tome and Principe, Saint Helena, and Tristan da Cunha.
A condition in which closely related persons, usually in the same family, share the same delusions.
Heat- and storage-labile plasma glycoprotein which accelerates the conversion of prothrombin to thrombin in blood coagulation. Factor V accomplishes this by forming a complex with factor Xa, phospholipid, and calcium (prothrombinase complex). Deficiency of factor V leads to Owren's disease.
A plasma protein that is the inactive precursor of thrombin. It is converted to thrombin by a prothrombin activator complex consisting of factor Xa, factor V, phospholipid, and calcium ions. Deficiency of prothrombin leads to hypoprothrombinemia.
Cylindrical epithelial cells in the innermost layer of the ENAMEL ORGAN. Their functions include contribution to the development of the dentinoenamel junction by the deposition of a layer of the matrix, thus producing the foundation for the prisms (the structural units of the DENTAL ENAMEL), and production of the matrix for the enamel prisms and interprismatic substance. (From Jablonski's Dictionary of Dentistry, 1992)
A genus of RHODOCYCLACEAE occurring as rod-shaped cells embedded in a gelatinous matrix. It includes Z. filipendula.
Ordered compilations of item descriptions and sufficient information to afford access to them.
Inorganic or organic compounds that contain divalent iron.

Energy and electron transfer in the photosynthetic reaction center complex of Acidiphilium rubrum containing Zn-bacteriochlorophyll a studied by femtosecond up-conversion spectroscopy. (1/4)

A photosynthetic reaction center (RC) complex was isolated from a purple bacterium, Acidiphilium rubrum. The RC contains bacteriochlorophyll a containing Zn as a central metal (Zn-BChl a) and bacteriopheophytin a (BPhe a) but no Mg-BChl a. The absorption peaks of the Zn-BChl a dimer (P(Zn)), the accessory Zn-BChl a (B(Zn)), and BPhe a (H) at 4 K in the RC showed peaks at 875, 792, and 753 nm, respectively. These peaks were shorter than the corresponding peaks in Rhodobacter sphaeroides RC that has Mg-BChl a. The kinetics of fluorescence from P(Zn)(*), measured by fluorescence up-conversion, showed the rise and the major decay with time constants of 0.16 and 3.3 ps, respectively. The former represents the energy transfer from B(Zn)(*) to P(Zn), and the latter, the electron transfer from P(Zn) to H. The angle between the transition dipoles of B(Zn) and P(Zn) was estimated to be 36 degrees based on the fluorescence anisotropy. The time constants and the angle are almost equal to those in the Rb. sphaeroides RC. The high efficiency of A. rubrum RC seems to be enabled by the chemical property of Zn-BChl a and by the L168HE modification of the RC protein that modifies P(Zn).  (+info)

Preferential use of an anode as an electron acceptor by an acidophilic bacterium in the presence of oxygen. (2/4)


Real-time PCR analysis of metabolic pathway of PHB in Acidiphilium cryptum DX1-1. (3/4)

The time, yield and related genes expression of PHB accumulation of Acidiphilium cryptum DX1-1 were investigated under four different initial C/N ratios 1.2, 2.4, 7.5, and 24. The results of time and yield of PHB accumulation show that the initial C/N ratio 2.4 was optimum for strain DX1-1 to accumulate PHB, both higher and lower initial C/N ratios did not favor that process. Based on the genome of Acidiphilium cryptum JF-5, 13 PHB accumulation related genes in strain JF-5 were chosen and successfully cloned from strain DX1-1. The differential expression of the 13 functional genes, in different C/N ratios as cited above, was then studied by Real-time PCR. The results show that all the 13 genes were most upregulated when initial C/N ratio was 2.4, and among which the gene Acry_3030 encoding poly-beta-hydroxybutyrate polymerase and Acry_0626 encoding acetyl-CoA synthetase were much more upregulated than the other genes, which prove that they play the most important role for PHB accumulation and acetate is the main initial substance for PHB accumulation for strain DX1-1. Potential regulatory motifs analysis shows that the genes related to PHB accumulation are regulated by different promoters and that the motif had weak similarity to the model promoters, suggesting that PHB- metabolism in Acidiphilium cryptum may be mediated by a different mechanism.  (+info)

Draft genome sequence of the electricigen Acidiphilium sp. strain PM (DSM 24941). (4/4)


Biohazard level, growth media and temperature, gram stain, industrial applications and more information for Acidiphilium angustum.
Serine is derived from 3-phospho-D-glycerate, an intermediate of glycolysis [MD:M00020], and glycine is derived from serine. Threonine is an essential amino acid, which animals cannot synthesize. In bacteria and plants, threonine is derived from aspartate [MD:M00018 ...
Cysteine and methionine are sulfur-containing amino acids. Cysteine is synthesized from serine through different pathways in different organism groups. In bacteria and plants, cysteine is converted from serine (via acetylserine) by transfer of hydrogen sulfide [MD:M00021]. In animals, methionine-derived homocysteine is used as sulfur source and its condensation product with serine (cystathionine) is converted to cysteine [MD:M00338]. Cysteine is metabolized to pyruvate in multiple routes. Methionine is an essential amino acid, which animals cannot synthesize. In bacteria and plants, methionine is synthesized from aspartate [MD:M00017]. S-Adenosylmethionine (SAM), synthesized from methionine and ATP, is a methyl group donor in many important transfer reactions including DNA methylation for regulation of gene expression. SAM may also be used to regenerate methionine in the methionine salvage pathway [MD:M00034 ...
Acidiphilium multivorum (strain DSM 11245 / JCM 8867 / AIU301) is an acidophilic, aerobic, anoxygenic, phototrophic, Gram-negative bacterium isolated from pyritic acid mine drainage. A.multivorum has high ability of resistance to various metals under acidic condition, and require high acidity for growth. It exhibits tolerance towards some heavy metal ions like nickel, zinc, cadmium and copper, and resistance to arsenate and arsenite. A. multivorum has zinc-chelated-bacteriochlorophylls (Zn-Bchl) a rather than Mg-Bchl a as the major photopigment. Among the mesoacidophilic bio-mining heterotrophs, A. multivorum has the unique ability to oxidize arsenite to arsenate as well as the capability to utilize a wide range of organic compounds for growth. These features make this bacterium a suitable host for carrying purpose specific genes for developing bioleaching operations. Current trends in biohydrometallurgy emphasize genetic engineering of bio-mining bacteria to achieve further success in this ...
I finally saved enough to order a DX7 for my CPs. It should arrive in a couple of days and Im really psyched! Since it will be up to me, myself, and
Le nouvel objectif ultra grand angle AT-X 116 PRO DX II est le successeur du très populaire AT-X PRO DX 116 DX. La principale amélioration réside dans la monture Nikon. Le AT- X PRO DX 116 DX II possède maintenant un moteur interne silencieux ...
Looking for online definition of RH70 in the Medical Dictionary? RH70 explanation free. What is RH70? Meaning of RH70 medical term. What does RH70 mean?
Your basket is currently empty. i ,p>When browsing through different UniProt proteins, you can use the basket to save them, so that you can back to find or analyse them later.,p>,a href=/help/basket target=_top>More...,/a>,/p> ...
Dekante A.; Rostoka E.; Isajevs S.; Sokolovska J.; Ošiņa K.; Baumane L.H.; Duburs G.; Sjakste N. Correction possibilities of the parameters of nitric oxide metabolism and DNA integrity in rats with streptozotocin-induced type 1 diabetes mellitus (DMT1) and in DNT1 patients blood ex vivo.. Daugavpils Universitātes 57. Starptautiskās zinātniskās konferences tēzes. Abstracts of the 57th International scientific conference of Daugavpils University. , Daugavpils Universitātes 57. Starptautiskās zinātniskās konference the 57th International scientific conference of Daugavpils University; Daugavpils UniversitāteAkad. apgāds Saule: Daugavpils Universitātes , 2015; 108 ...
In this paper, we present a new motion compensated frame rate up-conversion algorithm that uses multiframes to enhance the accuracy of motion estimation. W
Gouy phase anomaly in photonic nanojets. Myun-Sik Kim; Scharf, Toralf; Mühlig, Stefan; Rockstuhl, Carsten; Herzig, Hans Peter // Applied Physics Letters;5/9/2011, Vol. 98 Issue 19, p191114 We investigate in real space amplitude and phase distributions of light in photonic nanojets emerging from micrometer-sized dielectric spheres with a high-resolution interference microscope. Strong localization of light and a Gouy phase anomaly are witnessed. We show that the phase advance of... ...
We report a comprehensive study on the influence of solvent and organic ligands on the up-converted emission characteristics of NaYF4 nanowires. We have modified the hydrothermal reaction procedure, and used a
Alloying of disordered GaInP with nitrogen is shown to lead to very efficient PLU in GaInNP/GaAs heterostructures grown by gas source molecular beam epitaxy (GS‐MBE). This is attributed to the N‐induced changes in the band alignment at the GaInNP/GaAs heterointerface from the type I for the N‐free structure to the type II in the samples with N compositions exceeding 0.5%. Based on the performed excitation power dependent measurements, a possible mechanism for the energy upconversion is suggested as being due to the two‐step two‐photon absorption. The photon recycling effect is shown to be important for the structures with N=1%, from time‐resolved PL measurements. © 2007 American Institute of Physics. ...
Frequency up-conversion is demonstrated in a polyfluorene-based conjugated polymer. Up-converted emission is observed upon excitation to the red of the 0-0 luminescence band. The emission intensity depends strongly on temperature and provides an accurate probe of the operating temperature of organic light-emitting diodes. Temperature rises of up to 30 K are observed at standard operating current densities of 225 mA/cm2. Due to the low thermal conductivity and heat capacity of the polymer film, the temperature of the film is found to rise slowly on a time-scale of seconds. Upon termination of the current, the temperature decreases again on a time-scale of minutes. © 2002 American Institute of Physics ...
Organised by the FIP Programme Committee. Chairs: Betty Chaar (The University of Sydney, Australia) and Lars-Åke Söderlund (Apoteket, Sweden). Introduction. The world has witnessed over recent years an unprecedented movement of human beings across borders at sea and over land, seeking refuge from the horrors experienced in war torn countries. It has been called a refugee crisis.. These refugees are displaced, disoriented, in dire need of shelter and healthcare. And they present challenges to even the best of developed governments, communities and healthcare systems they arrive at. Some countries they appeal for help from are already themselves burdened with the weight of past civil or political unrest. According to the United Nations, in 2014, an astounding 86 percent of refugees lived in developing countries. Refugees also increasingly live in host communities rather than refugee camps, with 60 percent living in urban settings.. According to the United Nations High Commissioner for ...
"Restriction endonuclease AfaI from Acidiphilium facilis, a new isoschizomer of RsaI: purification and properties". Biochim ... "Isolation and identification of restriction endonuclease Aor51HI from Acidiphilium organovorum 51H". Nucleic Acids Res. 20 (2 ... "Restriction endonuclease Aor13HI from Acidiphilium organovorum 13H, a new isoschizomer of BspMII: Purification and ...
Hugenholtz P, Stackebrandt E (2004). "Reclassification of Sphaerobacter thermophilus from the subclass Sphaerobacteridae in the phylum Actinobacteria to the class Thermomicrobia (emended description) in the phylum Chloroflexi (emended description)". Int J Syst Evol Microbiol. 54 (Pt 6): 2049-51. doi:10.1099/ijs.0.03028-0. PMID 15545432 ...
1996, , formerly a member of the genus Acidiphilium A. facilis (Wichlacz et al. 1986) Kishimoto et al. 1996, type species of ... the genus, formerly a member of the genus Acidiphilium Bacterial taxonomy Microbiology Classification of Genera AC entry in ...
"Immunobiological activities of a new nontoxic lipopolysaccharide from Acidiphilium GS18h/ATCC55963, a soil isolate froman ... Immunobiological Activities of a Newnontoxic Lipopolysaccharide From Acidiphilium GS18h/ATCC55963, a Soil Isolate Froman Indian ...
... sulfane sulfur of persulfides is the actual substrate of the sulfur-oxidizing enzymes from Acidithiobacillus and Acidiphilium ...
... coccobacilli Part of the major acidophilic alphaproteobacterial group with the genera Acidiphilium and Rhodopila The name ...
Acidiphilium, Erythromicrobium, Blastomonas (synonym: Erythromonas), Porphyrobacter, Roseococcus, and Sandaracinobacter) genera ...
Acidiphilium sp.3.2Sup5, Klebsiella pneumoniae L17, Thermincola sp.strain JR, Pichia anomala. Reduced oxidoreductase enzymes at ...
... versutus to Paracoccus Thiobacillus acidophilus to Acidiphilium Thiobacillus intermedius, Thiobacillus ...
Skermanella Genus Thalassospira Genus Tistrella Family Rhodospirillaceae Genus Acetobacter Genus Acidicaldus Genus Acidiphilium ...
Acidiphilium MeSH B03.440.400.425.100.550 - Gluconobacter MeSH B03.440.400.425.100.550.550 - Gluconobacter oxydans MeSH B03.440 ... Acidiphilium MeSH B03.660.050.663.050.400 - Gluconacetobacter MeSH B03.660.050.663.050.400.500 - Gluconacetobacter xylinus MeSH ...
... is a genus in the phylum Proteobacteria (Bacteria). The name Acidiphilium derives from: New Latin noun acidum ( ... Transfer of Acidiphilium facilis and Acidiphilium aminolytica to the genus Acidocella gen. nov., and emendation of the genus ... Acidiphilium entry in LPSN; Euzéby, J.P. (1997). "List of Bacterial Names with Standing in Nomenclature: a folder available on ... New Latin neuter gender noun Acidiphilium (sic), acid lover. The genus contains 6 species (including basonyms and synonyms), ...
... is a species of heterotrophic bacteria, the type species of its genus. It is gram-negative, aerobic, ... Bilgin, Azize Azra; Silverstein, JoAnn; Jenkins, Joy D. (2004). "Iron respiration by Acidiphilium cryptum at pH 5". FEMS ... Harrison, A. P. (1981). "Acidiphilium cryptum gen. nov., sp. nov., Heterotrophic Bacterium From Acidic Mineral Environments". ... LPSN Type strain of Acidiphilium cryptum at BacDive - the Bacterial Diversity Metadatabase v t e. ...
Acidiphilium is a genus in the phylum Proteobacteria (Bacteria). The name Acidiphilium derives from: New Latin noun acidum ( ... Transfer of Acidiphilium facilis and Acidiphilium aminolytica to the genus Acidocella gen. nov., and emendation of the genus ... Acidiphilium entry in LPSN; Euzéby, J.P. (1997). "List of Bacterial Names with Standing in Nomenclature: a folder available on ... New Latin neuter gender noun Acidiphilium (sic), acid lover. The genus contains 6 species (including basonyms and synonyms), ...
Acidiphilium cryptum is a species of heterotrophic bacteria, the type species of its genus. It is gram-negative, aerobic, ... Bilgin, Azize Azra; Silverstein, JoAnn; Jenkins, Joy D. (2004). "Iron respiration by Acidiphilium cryptum at pH 5". FEMS ... Harrison, A. P. (1981). "Acidiphilium cryptum gen. nov., sp. nov., Heterotrophic Bacterium From Acidic Mineral Environments". ... LPSN Type strain of Acidiphilium cryptum at BacDive - the Bacterial Diversity Metadatabase v t e. ...
Proteome IDi ,p>The proteome identifier (UPID) is the unique identifier assigned to the set of proteins that constitute the ,a href="http://www.uniprot.org/manual/proteomes_manual">proteome,/a>. It consists of the characters UP followed by 9 digits, is stable across releases and can therefore be used to cite a UniProt proteome.,p>,a href=/help/proteome_id target=_top>More...,/a>,/p> ...
Acidiphilium cryptum JF-5 plasmid pACRY06, complete sequence Acidiphilium cryptum JF-5 plasmid pACRY06, complete sequence. gi, ... Acidiphilium cryptum JF-5 plasmid pACRY06, complete sequence. NCBI Reference Sequence: NC_009472.1 ...
Acidiphilium cryptum JF-5 plasmid pACRY04, complete sequence Acidiphilium cryptum JF-5 plasmid pACRY04, complete sequence. gi, ... Acidiphilium cryptum JF-5 plasmid pACRY04, complete sequence. NCBI Reference Sequence: NC_009470.1 ...
Terpenoid backbone biosynthesis - Acidiphilium multivorum [ Pathway menu , Organism menu , Pathway entry , Download KGML , Show ...
... industrial applications and more information for Acidiphilium angustum. ... Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales; Acetobacteraceae; Acidiphilium. Industrial uses or economic ... Acidiphilium angustum was isolated from a sample of acidic coal mine drainage obtained in Pennsylvania.. ...
Cysteine and methionine metabolism - Acidiphilium multivorum [ Pathway menu , Organism menu , Pathway entry , Download KGML , ...
... its transfer to the genus Acidiphilium as Acidiphilium acidophilum comb. nov. Int. J. Syst. Bacteriol. 48:1389-1398. ... For the Acidiphiliumspecies tested against probe Acdp821, the averageTd was 62.2 ± 0.42°C. A. diazotrophicus, a species with ... S-G-Acdp-0821-a-A-24 (Acdp821) was designed to circumscribe all catalogued members of the genusAcidiphilium, and S-S-Thio-0820- ... At site B, 53% of the probe Eub338 counts were accounted for by the sum ofThiobacillus and Acidiphilium species andL. ...
This information could be useful for the differentiation between Acidiphilium and Acidomonas species. In addition, Acidiphilium ... This information could be useful for the differentiation between Acidiphilium and Acidomonas species. In addition, Acidiphilium ... This information could be useful for the differentiation between Acidiphilium and Acidomonas species. In addition, Acidiphilium ... This information could be useful for the differentiation between Acidiphilium and Acidomonas species. In addition, Acidiphilium ...
Physicochemical Characterization of Acidiphilium sp. Biofilms. In: ChemPhysChem. 2013 ; Vol. 14, No. 6. pp. 1237-1244. ... Physicochemical Characterization of Acidiphilium sp. Biofilms. Moustafa Malki, Santiago Casado, Maria Francisca Lopez, Renaud ... Physicochemical Characterization of Acidiphilium sp. Biofilms. / Malki, Moustafa; Casado, Santiago; Lopez, Maria Francisca; ... The biofilm formation of a strain of the extremophile bacterium Acidiphilium sp., capable of donating electrons directly to ...
Acidiphilium acidophilum (Guay and Silver) Hiraishi et al. (ATCC® 27807™) ATCC® Number: 27807™ Deposited As Thiobacillus ... Acidiphilium angustum Wichlacz et al. (ATCC® 35903™) ATCC® Number: 35903™ Strain Designations: KLB ... Acidiphilium organovorum Lobos et al. (ATCC® 43141™) ATCC® Number: 43141™ Strain Designations: TFC ... Acidiphilium rubrum Wichlacz et al. (ATCC® 35905™) ATCC® Number: 35905™ Strain Designations: OP ...
... from Acidiphilium cryptum JF-5. Plus protein sequence and external database links. ... Domain assignment for gi,148260924,ref,YP_001235051.1, from Acidiphilium cryptum JF-5. Domain architecture ... 50S ribosomal protein L6 [Acidiphilium cryptum JF-5]. Sequence. MSRVGKYPVALPQGVSITVVDGILTAKGKLGELKMPLSERVETVVEDGKVTVSPRDKEAA ...
... from Acidiphilium cryptum JF-5. Plus protein sequence and external database links. ... Domain assignment for gi,148259239,ref,YP_001233366.1, from Acidiphilium cryptum JF-5. Domain architecture ...
Biochemical pathways detoxify hexavalent chromiumAcidiphilium cryptum. Respiratory enzymes in Acidiphilium cryptum bacteria ...
Acidiphilium cryptum (strain JF-5). Loading... A6T663 Methylthioribulose-1-phosphate dehydratase. Klebsiella pneumoniae subsp. ...
Acidiphilium cryptum (strain JF-5). Loading... A6WVQ2 UPF0262 protein Oant_0325. Ochrobactrum anthropi (strain ATCC 49188 / DSM ...
Acidiphilium cryptum (strain JF-5). OG Plasmid pACRY02 {ECO:0000313,EMBL:ABQ29063.1, OG ECO:0000313,Proteomes:UP000000245}. OC ... "Complete sequence of plasmid2 pACRY02 of Acidiphilium cryptum JF-5."; RL Submitted (MAY-2007) to the EMBL/GenBank/DDBJ ... Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales; OC Acetobacteraceae; Acidiphilium. OX NCBI_TaxID=349163 {ECO: ...
ferrooxidans was evaluated by adjusting the starting pH of the modified acidiphilium medium to initial pH-values of 1.5, 2.5, ... ferrooxidans in removing uranium from a solution of modified acidiphilium media was also evaluated. The mean concentrations of ... The electrode calibration was matched for the composition of the modified acidiphilium medium by including a non-inoculated ... The bacteria were grown to exponential phase using the modified acidiphilium growth medium. Cells were harvested by ...
Acidiphilium sp. 37-64-53. 345. UPI000788C72B. Fusobacterium necrophorum. 342. Magnesium chelatase. Fusobacterium necrophorum ...
... a strain that is closely related to Acidiphilium SJH. Recent annotation of the draft genome of another Acidiphilium strain (PM ... All Acidiphilium spp. are known to reduce ferric iron, though most strains do not grow under strictly anoxic conditions in the ... ferrooxidans and L. ferrooxidans in the oxic zones of the river and ferric iron reduction by Acidiphilium spp. and At. ... ferrooxidans and Acidiphilium SJH. The culture medium (pH 2.0) contained (initially) 25 mM ferrous sulfate and 10 mM glycerol, ...
Chadefaud, M. & Emberger, L. (eds.). 1960. Traité de botanique systématique. Masson et Cie., Paris. Tome I. Les végétaux non vasculaires (Cryptogamie), par M. Chadefaud, 1960, 1 vol. de 1016 pages, [6]. Tome II. Les végétaux vasculaires, par L. Emberger, 1960, deux fascicules, 1540 pages, [7], [8]. Monde vivant ...
Harrison AP (1981) Acidiphilium cryptum gen. nov., sp. nov., heterotrophic bacterium from acidic mineral environments. Int J ... evidence for constitutive and inducible enzyme systems in Acidiphilium spp. J Appl Microbiol 92:315-321PubMedCrossRefGoogle ... isolation of Acidiphilium cryptum JF-5 capable of coupling the reduction of Fe(III) to the oxidation of glucose. Appl Environ ... Proteogenomic and functional analysis of chromate reduction in Acidiphilium cryptum JF-5, an Fe(III)-respiring acidophile. ...
Hugenholtz P, Stackebrandt E (2004). "Reclassification of Sphaerobacter thermophilus from the subclass Sphaerobacteridae in the phylum Actinobacteria to the class Thermomicrobia (emended description) in the phylum Chloroflexi (emended description)". Int J Syst Evol Microbiol. 54 (Pt 6): 2049-51. doi:10.1099/ijs.0.03028-0. PMID 15545432 ...
Transformation of Acidiphilium by electroporation and conjugation journal, May 1992 * Glenn, Anne W.; Roberto, Frank F.; Ward, ... Characterization of a new bacteriophage which infects bacteria of the genus Acidiphilium journal, November 1993 * Ward, T. E.; ...
Transformation of Acidiphilium by electroporation and conjugation journal, May 1992 * Glenn, Anne W.; Roberto, Frank F.; Ward, ... Characterization of a new bacteriophage which infects bacteria of the genus Acidiphilium journal, November 1993 * Ward, T. E.; ...
All Acidiphilium isolates can oxidize organic compounds using ferric iron as an electron acceptor (anaerobic respiration). Some ... Leptospirillum and Acidiphilium, all members of the iron cycle [20]. At. ferrooxidans can oxidize ferrous iron aerobically and ... Acidiphilium sp., in acidic conditions [53], strongly suggests that the presence of biological nucleation sites can modify the ... Acidiphilium isolates can use ferric iron as an electron acceptor in the presence of oxygen [29,30]. Although other iron- ...
Acidiphilium cryptum Harrison 1981. Synonymous Name. Type Strain. type Accepted Date. 1983/04/14 ...
gi,88922422,gb,EAR41521.1, conserved hypothetical protein [Acidiphilium cryptum JF-5] * * gi,106770933,gb,EAT27572.1,_12:290 ... gi,88938974,ref,ZP_01144426.1,_2:261 conserved hypothetical protein [Acidiphilium cryptum JF-5] * ...
  • Acidiphilium is a genus in the phylum Proteobacteria (Bacteria). (wikipedia.org)
  • Acidiphilium cryptum is a species of heterotrophic bacteria, the type species of its genus. (wikipedia.org)
  • Other acidophilic bacteria have also been associated with acidic mining, bioleaching, and sewer crown environments, including Leptospirillum ferrooxidans and members of the genus Acidiphilium ( 14 , 21 , 38 ). (asm.org)
  • In the microbial ecology associated with acidic environments, members of the genus Acidiphilium may have significant interactions with sulfur- and iron-oxidizing bacteria. (asm.org)
  • PCR ( 14 , 38 ) and 16S rRNA gene sequence analyses of bacteria have been used to identify members of the genera Thiobacillus , Leptospirillum , and Acidiphilium and other chemolithoautotrophic bacteria in bioleaching applications, sites of pyrite oxidation ( 10 ), and natural systems containing high sulfide concentrations ( 4 ). (asm.org)
  • Photosynthetic bacteria of the genus Acidiphilium contain a purple chlorophyll pigment that uses zinc as cofactor instead of the more common magnesium. (asbmb.org)
  • Cayford and his colleagues found that the ceiling species were instead dominated by bacteria from the genera Acidiphilium and Mycobacterium . (asm.org)
  • Acidithiobacillus ferrooxidans) and heterotrophic (Acidiphilium and Acidocella species) bacteria of mine environments. (bvsalud.org)
  • Acidiphilium multivorum (strain DSM 11245 / JCM 8867 / AIU301) is an acidophilic, aerobic, anoxygenic, phototrophic, Gram-negative bacterium isolated from pyritic acid mine drainage. (wishartlab.com)
  • While genes bestowing arsenic resistance in Acidiphilium multivorum are similar to those analyzed from other sources, the metal (Cd and Zn)-resistance conferring cloned plasmid DNA fragments from Acidiphilium symbioticum KM2 and Acidocella GS19h strains were found to have no sequence similarity with the reported Cd- and Zn-resistant genes. (bvsalud.org)
  • Transformation of Escherichia coli with a large plasmid of Acidiphilium multivorum AIU 301 encoding arsenic resistance. (semanticscholar.org)
  • Acidiphilium multivorum AIU 301 isolated from acid mineral water had strong arsenic resistance. (semanticscholar.org)
  • The biofilm formation of a strain of the extremophile bacterium Acidiphilium sp. (elsevier.com)
  • General Information: Acidiphilium cryptum strain JF-5 was isolated under iron-reducing conditions from coal mine lake sediment and is able to grow by coupling the reduction of iron to the oxidation of glucose. (up.ac.za)
  • Zn-BChl has been found in only one other organism before, the acidophilic Acidiphilium rubrum. (nih.gov)
  • Plasmids of acidophilic heterotrophs of the genera Acidiphilium and Acidocella, on the other hand, carry metal resistant genes. (bvsalud.org)
  • Small-subunit rRNA genes from all of the Thiobacillus and Acidiphilium species catalogued by the Ribosomal Database Project were identified and used to design oligonucleotide DNA probes. (asm.org)
  • A mutualistic relationship between Thiobacillus species and members of the genus Acidiphilium has been suggested ( 21 ). (asm.org)
  • The apparent environmental importance of these two genera necessitates the development of a method to identify and quantify active Thiobacillus and Acidiphilium species in situ. (asm.org)
  • Acidiphilium species possessed high amounts (33 to 43% of the total lipids) of phosphorous-free lipoamino acids. (elsevier.com)
  • This information could be useful for the differentiation between Acidiphilium and Acidomonas species. (elsevier.com)
  • In addition, Acidiphilium species produced phosphatidylethanolamine, phosphatidylglycerol and phosphatidylcholine as the major phospholipids. (elsevier.com)
  • Retrieved 2011-05-27.CS1 maint: archived copy as title (link) Kishimoto (N.), Kosako (Y.), Wakao (N.), Tano (T.) and Hiraishi (A.): Transfer of Acidiphilium facilis and Acidiphilium aminolytica to the genus Acidocella gen. nov., and emendation of the genus Acidiphilium. (wikipedia.org)
  • Thiobacillus ferrooxidans and T. thiooxidans (probe Thio820) and members of the genus Acidiphilium (probe Acdp821). (asm.org)
  • Members of the genus Acidiphilium are capable of iron reduction. (asm.org)
  • Acidiphilium acidophilum (Guay and Silver) Hiraishi et al. (atcc.org)
  • Acidiphilium cryptum was first isolated from a supposedly pure culture of Thiobacillus ferrooxidans. (up.ac.za)
  • Acidiphilium angustum was isolated from a sample of acidic coal mine drainage obtained in Pennsylvania. (thelabrat.com)
  • Acidiphilium angustum Wichlacz et al. (atcc.org)
  • Two major lipoamino acids (OL1 and OL2) were isolated from Acidiphilium organovorum and shown to be α-N-3-hydroxystearylornithyltaurine (OL1) and α-N-3-hydroxystearylornithine (OL2), to which the fatty acid C18 : 1 is linked by an ester-linkage to the hydroxy fatty acid. (elsevier.com)
  • Acidiphilium organovorum Lobos et al. (atcc.org)
  • Conjugation is also employed to introduce broad-host range plasmids into Acidiphilium at neutral pH. (unt.edu)
  • Reduction of Cr(VI) Under Acidic Conditions by the Facultative Fe(III)-Reducing Bacterium Acidiphilium Cryptum. (pointloma.edu)
  • RT "Complete sequence of plasmid2 pACRY02 of Acidiphilium cryptum JF-5. (univ-lyon1.fr)
  • Using electroporation, chimeric and broad-host range plasmids are introduced into Acidiphilium. (unt.edu)
  • Zurück zum Zitat Bridge TAM, Johnson DB (2000) Reductive dissolution of ferric iron minerals by Acidiphilium SJH. (springerprofessional.de)
  • title = "Physicochemical Characterization of Acidiphilium sp. (elsevier.com)