(1/31) Membrane-bound hydrogenase and sulfur reductase of the hyperthermophilic and acidophilic archaeon Acidianus ambivalens.

A sulfur reductase (SR) and a hydrogenase were purified from solubilized membrane fractions of anaerobically grown cells of the sulfur-dependent archaeon Acidianus ambivalens and the corresponding genes were sequenced. The SR reduced elemental sulfur with hydrogen as electron donor [45 U (mg protein)(-1)] in the presence of hydrogenase and either 2,3-dimethylnaphthoquinone (DMN) or cytochrome c in the enzyme assay. The SR could not be separated from the hydrogenase during purification without loss of activity, whereas the hydrogenase could be separated from the SR. The specific activity of the hydrogenase was 170 U (mg protein)(-1) with methyl viologen and 833 U (mg protein)(-1) with DMN as electron acceptors. Both holoenzymes showed molecular masses of 250 kDa. In SDS gels of active fractions, protein bands with apparent masses of 110 (SreA), 66 (HynL), 41 (HynS) and 29 kDa were present. Enriched hydrogenase fractions contained 14 micro mol Fe and 2 micromol Ni (g protein)(-1); in addition, 2.5 micromol Mo (g protein)(-1) was found in the membrane fraction. Two overlapping genomic cosmid clones were sequenced, encoding a five-gene SR cluster (sre) including the 110 kDa subunit gene (sreA), and a 12-gene hydrogenase cluster (hyn) including the large and small subunit genes and genes encoding proteins required for the maturation of NiFe hydrogenases. A phylogenetic analysis of the SR amino acid sequence revealed that the protein belonged to the DMSO reductase family of molybdoenzymes and that the family showed a novel clustering. A model of sulfur respiration in Acidianus developed from the biochemical results and the data of the amino acid sequence comparisons is discussed.  (+info)

(2/31) AFV1, a novel virus infecting hyperthermophilic archaea of the genus acidianus.

We describe a novel virus, AFV1, of the hyperthermophilic archaeal genus Acidianus. Filamentous virions are covered with a lipid envelope and contain at least five different proteins with molecular masses in the range of 23-130 kDa and a 20.8-kb-long linear double-stranded DNA. The virus has been assigned to the family Lipothrixviridae on the basis of morphotypic characteristics. Host range is confined to several strains of Acidianus and the virus persists in its hosts in a stable carrier state. The latent period of virus infection is about 4 h. Viral DNA was sequenced and sequence similarities were found to the lipothrixvirus SIFV, the rudiviruses SIRV1 and SIRV2, as well as to conjugative plasmids and chromosomes of the genus Sulfolobus. Exceptionally for the linear genomes of archaeal viruses, many short direct repeats, with the sequence TTGTT or close variants thereof, are closely clustered over 300 bp at each end of the genome. They are reminiscent of the telomeric ends of linear eukaryal chromosomes.  (+info)

(3/31) The sulphur oxygenase reductase from Acidianus ambivalens is a multimeric protein containing a low-potential mononuclear non-haem iron centre.

The SOR (sulphur oxygenase reductase) is the initial enzyme in the sulphur-oxidation pathway of Acidianus ambivalens. Expression of the sor gene in Escherichia coli resulted in active, soluble SOR and in inclusion bodies from which active SOR could be refolded as long as ferric ions were present in the refolding solution. Wild-type, recombinant and refolded SOR possessed indistinguishable properties. Conformational stability studies showed that the apparent unfolding free energy in water is approx. 5 kcal x mol(-1) (1 kcal=4.184 kJ), at pH 7. The analysis of the quaternary structures showed a ball-shaped assembly with a central hollow core probably consisting of 24 subunits in a 432 symmetry. The subunits form homodimers as the building blocks of the holoenzyme. Iron was found in the wild-type enzyme at a stoichiometry of one iron atom/subunit. EPR spectroscopy of the colourless SOR resulted in a single isotropic signal at g=4.3, characteristic of high-spin ferric iron. The signal disappeared upon reduction with dithionite or incubation with sulphur at elevated temperature. Thus both EPR and chemical analysis indicate the presence of a mononuclear iron centre, which has a reduction potential of -268 mV at pH 6.5. Protein database inspection identified four SOR protein homologues, but no other significant similarities. The spectroscopic data and the sequence comparison led to the proposal that the Acidianus ambivalens SOR typifies a new type of non-haem iron enzyme containing a mononuclear iron centre co-ordinated by carboxylate and/or histidine ligands.  (+info)

(4/31) Active site structure of the aa3 quinol oxidase of Acidianus ambivalens.

The membrane bound aa(3)-type quinol:oxygen oxidoreductase from the hyperthermophilic archaeon, Acidianus ambivalens, which thrives at a pH of 2.5 and a temperature of 80 degrees C, has several unique structural and functional features as compared to the other members of the heme-copper oxygen reductase superfamily, but shares the common redox-coupled, proton-pumping function. To better understand the properties of the heme a(3)-Cu(B) catalytic site, a resonance Raman spectroscopic study of the enzyme under a variety of conditions and in the presence of various ligands was carried out. Assignments of several heme vibrational modes as well as iron-ligand stretching modes are made to serve as a basis for comparing the structure of the enzyme to that of other oxygen reductases. The CO-bound oxidase has conformations that are similar to those of other oxygen reductases. However, the addition of CO to the resting enzyme does not generate a mixed valence species as in the bovine aa(3) enzyme. The cyanide complex of the oxidized enzyme of A. ambivalens does not display the high stability of its bovine counterpart, and a redox titration demonstrates that there is an extensive heme-heme interaction reflected in the midpoint potentials of the cyanide adduct. The A. ambivalens oxygen reductase is very stable under acidic conditions, but it undergoes an earlier alkaline transition than the bovine enzyme. The A. ambivalens enzyme exhibits a redox-linked reversible conformational transition in the heme a(3)-Cu(B) center. The pH dependence and H/D exchange demonstrate that the conformational transition is associated with proton movements involving a group or groups with a pK(a) of approximately 3.8. The observed reversibility and involvement of protons in the redox-coupled conformational transition support the proton translocation model presented earlier. The implications of such conformational changes are discussed in relation to general redox-coupled proton pumping mechanisms in the heme-copper oxygen reductases.  (+info)

(5/31) Theoretical identification of proton channels in the quinol oxidase aa3 from Acidianus ambivalens.

Heme-copper oxidases are membrane proteins found in the respiratory chain of aerobic organisms. They are the terminal electron acceptors coupling the translocation of protons across the membrane with the reduction of oxygen to water. Because the catalytic process occurs in the heme cofactors positioned well inside the protein matrix, proton channels must exist. However, due to the high structural divergence among this kind of proteins, the proton channels previously described are not necessarily conserved. In this work we modeled the structure of the quinol oxidase from Acidianus ambivalens using comparative modeling techniques for identifying proton channels. Additionally, given the high importance that water molecules may have in this process, we have developed a methodology, within the context of comparative modeling, to identify high water probability zones and to deconvolute them into chains of ordered water molecules. From our results, and from the existent information from other proteins from the same superfamily, we were able to suggest three possible proton channels: one K-, one D-, and one Q-spatial homologous proton channels. This methodology can be applied to other systems where water molecules are important for their biological function.  (+info)

(6/31) Key role of cysteine residues in catalysis and subcellular localization of sulfur oxygenase-reductase of Acidianus tengchongensis.

Analysis of known sulfur oxygenase-reductases (SORs) and the SOR-like sequences identified from public databases indicated that they all possess three cysteine residues within two conserved motifs (V-G-P-K-V-C(31) and C(101)-X-X-C(104); numbering according to the Acidianus tengchongensis numbering system). The thio-modifying reagent N-ethylmaleimide and Zn(2+) strongly inhibited the activities of the SORs of A. tengchongensis, suggesting that cysteine residues are important. Site-directed mutagenesis was used to construct four mutant SORs with cysteines replaced by serine or alanine. The purified mutant proteins were investigated in parallel with the wild-type SOR. Replacement of any cysteine reduced SOR activity by 98.4 to 100%, indicating that all the cysteine residues are crucial to SOR activities. Circular-dichroism and fluorescence spectrum analyses revealed that the wild-type and mutant SORs have similar structures and that none of them form any disulfide bond. Thus, it is proposed that three cysteine residues, C(31) and C(101)-X-X-C(104), in the conserved domains constitute the putative binding and catalytic sites of SOR. Furthermore, enzymatic activity assays of the subcellular fractions and immune electron microscopy indicated that SOR is not only present in the cytoplasm but also associated with the cytoplasmic membrane of A. tengchongensis. The membrane-associated SOR activity was colocalized with the activities of sulfite:acceptor oxidoreductase and thiosulfate:acceptor oxidoreductase. We tentatively propose that these enzymes are located in close proximity on the membrane to catalyze sulfur oxidation in A. tengchongensis.  (+info)

(7/31) The sulfur oxygenase reductase from Acidianus ambivalens is an icosatetramer as shown by crystallization and Patterson analysis.

The sulfur oxygenase reductase (SOR) is the initial enzyme in the aerobic sulfur metabolism of the thermoacidophilic and chemolithoautotrophic crenarchaeote Acidianus ambivalens. Single colorless polyhedral crystals were obtained under two crystallization conditions from SOR preparations heterologously overproduced in Escherichia coli. They belonged to space-group I4 and diffraction data were collected up to 1.7 A resolution. Their Patterson symmetry shows additional 4-, 3- and 2-fold non-crystallographic symmetry rotation axes, characteristic of the point group 432. Taking into account the molecular mass of SOR, the crystal unit cell volume, the non-crystallographic symmetry operators and previous electron microscopy studies of the SOR, it was deduced that the quaternary structure of the functionally active enzyme is an icosatetramer with 871 kDa molecular mass.  (+info)

(8/31) A Rieske ferredoxin typifying a subtype within Rieske proteins: spectroscopic, biochemical and stability studies.

A new subtype of archaeal Rieske ferredoxin (RFd) has been identified in the genome of the thermoacidophilic archaeon Acidianus ambivalens. The gene is inserted in an atypical genomic context in a gene cluster encoding a NiFe hydrogenase. Sequence and phyletic analysis showed that the protein is related to bacterial RFd but not to any of the known archaeal Rieske proteins. The recombinant 14 kDa protein isolated from Escherichia coli behaved as a dimer in solution. It contained approximately 2 Fe/mol and all visible and EPR spectroscopic features typical of Rieske centre-containing proteins. However, its redox potential (+170 mV) was significantly higher than those of canonical RFd. This difference is rationalized in terms of the protein structure environment, as discrete amino acid substitutions in key positions around the metal centre account for the higher potential.  (+info)

*  Betalipothrixvirus
Acidianus filamentous virus 3 Acidianus filamentous virus 6 Acidianus filamentous virus 7 Acidianus filamentous virus 8 ... Acidianus filamentous virus 9 Sulfolobus islandicus filamentous virus Viruses in Betalipothrixvirus are enveloped, with rod- ...
*  List of virus species
... filamentous virus 8 Acidianus filamentous virus 9 Acidianus rod-shaped virus 1 Acidianus spindle-shaped virus 1 Acidianus two- ... Acholeplasma virus MV-L51 Acidianus bottle-shaped virus Acidianus filamentous virus 1 Acidianus filamentous virus 2 Acidianus ... filamentous virus 3 Acidianus filamentous virus 6 Acidianus filamentous virus 7 Acidianus ...
*  Acidianus
... pages for Acidianus Search Species2000 page for Acidianus MicrobeWiki page for Acidianus LPSN page for Acidianus Acidianus at ... PubMed references for Acidianus PubMed Central references for Acidianus Google Scholar references for Acidianus NCBI taxonomy ... Segerer A; Neuner AM; Kristjansson JK; Stetter KO (1986). "Acidianus infernus gen. nov., sp. nov., and Acidianus brierleyi comb ... In taxonomy, Acidianus is a genus of the Sulfolobaceae. List of bacterial genera named after mythological figures See the NCBI ...
*  Acidianus sulfidivorans
... at the Encyclopedia of Life LPSN Type strain of Acidianus sulfidivorans at BacDive - the Bacterial ... The type strain is JP7(T) (=DSM 18786(T)=JCM 13667(T)). Plumb JJ; Haddad CM; Gibson JA; Franzmann PD (July 2007). "Acidianus ... Acidianus sulfidivorans is a species of archaeon. It is an extremely thermoacidophilic, obligately chemolithotrophic archaeon. ... Plumb, J., Haddad, C., and Franzmann, P. (2008). A novel extremophile Acidianus sulfidivorans sp. nov. from island paradise to ...
*  Acidianus infernus
... at the Encyclopedia of Life LPSN Type strain of Acidianus infernus at BacDive - the Bacterial Diversity ... Segerer, A.; Neuner, A.; Kristjansson, J. K.; Stetter, K. O. (1986). "Acidianus infernus gen. nov., sp. nov., and Acidianus ... Acidianus infernus is a species of archaeon. It is aerobic, extremely acidophilic, thermophilic (hence its name) and sulfur- ...
*  Ampullavirus
Genus acidianus serve as natural hosts. There are currently only one species in this genus: the type species Acidianus bottle- ... Genus acidianus serve as the natural host. Transmission routes are passive diffusion. "Viral Zone". ExPASy. Retrieved 15 June ... Group: dsDNA Order: Unassigned Family: Ampullaviridae Genus: Ampullavirus Acidianus bottle-shaped virus Viruses in Ampullavirus ...
*  Gammalipothrixvirus
Archaea acidianus serve as natural hosts. There is currently only one species in this genus: the type species Acidianus ... Archaea acidianus serve as the natural host. Transmission routes are passive diffusion. "Viral Zone". ExPASy. Retrieved 15 June ... filamentous virus 1. Group: dsDNA Order: Ligamenvirales Family: Lipothrixviridae Genus: Gammalipothrixvirus Acidianus ...
*  Bicaudaviridae
Genus acidianus serve as natural hosts. There was only one genus (Bicaudavirus) and one species in this family: the type ... Genus acidianus serve as the natural host. Transmission routes are passive diffusion. This family was first described by the ... Group: dsDNA Order: Unassigned Family: Bicaudaviridae Genus: Bicaudavirus Acidianus two-tailed virus Viruses in Bicaudaviridae ... species Acidianus two-tailed virus. until the Sulfolobus tengchongensis spindle-shaped virus 1 (STSV-1) was regarded to belong ...
*  List of taxa with candidatus status
Acidianus copahuensis" Giaveno et al. 2013 "Ca. Aciduliprofundum boonei" Schouten et al. 2008 "Ca. Accumulibacter phosphatis" ...
*  Rudivirus
Acidianus rod-shaped virus 1 is 610 nm long and 22 nm wide, also has the three tail fibers protruding at each end and the same ... Acidianus rod-shaped virus 1, ARV1, the first member of the family Rudiviridae infecting hyperthermophilic archaea of the genus ... Other species Acidianus rod-shaped virus 1, ARV1; genome sequence accession no. AJ875026. Stygiolobus rod-shaped virus, SRV, ... of the hyperthermophilic archaeal genus Acidianus". Virology. 336: 83-92. doi:10.1016/j.virol.2005.02.025. PMID 15866073. ...
*  Lipothrixviridae
Acidianus filamentous virus 3 Acidianus filamentous virus 6 Acidianus filamentous virus 7 Acidianus filamentous virus 8 ... Acidianus filamentous virus 2 Genus: Gammalipothrixvirus Acidianus filamentous virus 1 The family consists of four genera: ... a novel virus infecting hyperthermophilic archaea of the genus Acidianus. Virology, 315, 68-79. Häring M, Vestergaard G, ... Acidianus filamentous virus 9 Sulfolobus islandicus filamentous virus Genus: Deltalipothrixvirus ...
*  List of bacterial genera named after mythological figures
Acidianus and Janibacter: Janus, a god in Roman mythology with two faces. Amphritea: Amphitrite ('Αμφιτρίτη), a sea-goddess and ...
*  Carbon disulfide hydrolase
The hyperthermophilic Acidianus strain was found to convert CS2 into H2S and CO2. The apoenzyme form, lacking the zinc cofactor ...
*  Ampullaviridae
... is a family of viruses that infect archaea of the genus Acidianus. Only one genus in this family has been ... Peng, X; Basta, T; Häring, M; Garrett, R. A.; Prangishvili, D (2007). "Genome of the Acidianus bottle-shaped virus and insights ... Acidianus bottle-shaped virus, from a new family, the Ampullaviridae". Journal of Virology. 79 (15): 9904-11. doi:10.1128/JVI. ... described, Ampullavirus, which contains one species, Acidianus bottle-shaped virus. The name of the family and genus is derived ...
*  Sulfur oxygenase/reductase
Scholz C, Teixeira M, Gomes CM, Kletzin A (2004). "The sulphur oxygenase reductase from Acidianus ambivalens is a multimeric ... Acidianus strain S5". Extremophiles. 7 (2): 131-4. doi:10.1007/s00792-002-0304-5. PMID 12664265. ...
*  List of sequenced archaeal genomes
You XY, Liu C, Wang SY, Jiang CY, Shah SA, Prangishvili D, She Q, Liu SJ, Garrett RA (2011). "Genomic analysis of Acidianus ...
*  Present day Mars habitability analogue environments on Earth
Acidianus), like those that live around hydrothermal vents, are able to survive independent of a source of oxygen. So the caves ...
*  List of Archaea genera
Genus Acidianus Genus Metallosphaera Genus Stygiolobus Genus Sulfolobus Genus Sulfurisphaera This section lists the genera of ...
*  David Prangishvili
... a novel virus infecting hyperthermophilic archaea of the genus Acidianus". Virology 315: 68-79. 12. Prangishvili D. (2013) "The ...
*  Hot spring
Acidianus bottle-shaped virus, from a new family, the Ampullaviridae". J. Virol. 79 (15): 9904-11. doi:10.1128/JVI.79.15.9904- ...
*  Acidophile
... in the Euryarchaeota branch of Archaea Acidianus brierleyi, A. infernus, facultatively anaerobic thermoacidophilic ...
*  List of MeSH codes (B07)
... acidianus MeSH B07.075.725.725.725 --- sulfolobus MeSH B07.075.725.725.725.070 --- sulfolobus acidocaldarius MeSH B07.075. ...
*  Taxonomic list of viruses
Acidianus filamentous virus 3 Acidianus filamentous virus 6 Acidianus filamentous virus 7 Acidianus filamentous virus 8 ... Acidianus filamentous virus 1 Family: Rudiviridae Genus: Rudivirus Acidianus rod-shaped virus 1 Sulfolobus islandicus rod- ... Acidianus filamentous virus 9 Sulfolobus islandicus filamentous virus Genus: Deltalipothrixvirus Acidianus filamentous virus 2 ... Acidianus two-tailed virus Family: Clavaviridae Genus: Clavavirus Aeropyrum pernix bacilliform virus 1 Family: Corticoviridae ...
*  Ligamenvirales
Goulet A, Blangy S, Redder P, Prangishvili D, Felisberto-Rodrigues C, Forterre P, Campanacci V, Cambillau C (2009) Acidianus ...
*  Fuselloviridae
Acidianus spindle-shaped virus 1 Sulfolobus spindle-shaped virus 6 Take care: The abbreviation SSV is also used for 'Simian ...
Betalipothrixvirus is a genus of viruses in the order Ligamenvirales, in the family Lipothrixviridae. Archaea serve as natural hosts. There are currently six species in this genus including the type species Sulfolobus islandicus filamentous virus. Group: dsDNA Order: Ligamenvirales Family: Lipothrixviridae Genus: Betalipothrixvirus Acidianus filamentous virus 3 Acidianus filamentous virus 6 Acidianus filamentous virus 7 Acidianus filamentous virus 8 Acidianus filamentous virus 9 Sulfolobus islandicus filamentous virus Viruses in Betalipothrixvirus are enveloped, with rod-shaped geometries. The diameter is around 24 nm, with a length of 2000 nm. Genomes are linear, around 40.5kb in length. The genome has 67 open reading frames. Viral replication is cytoplasmic. Entry into the host cell is achieved by adsorption into the host cell. Dna templated transcription is the method of transcription. Archaea serve as the natural host. Transmission routes are passive diffusion. "Viral Zone". ExPASy. ...
Acidianus two-tailed virus (ATV) infects crenarchaea of the genus Acidianus living in terrestrial thermal springs at extremely high temperatures and low pH. ATV is a member of the Bicaudaviridae virus family and undergoes extra-cellular development of two tails, a process that is unique in the viral world. To understand this intriguing phenomenon, we have undertaken structural studies of ATV virion proteins and here we present the crystal structure of one of these proteins, ATV. ATV forms tetramers in solution and a molecular envelope is provided for the tetramer, computed from small-angle X-ray scattering (SAXS) data. The crystal structure has properties typical of hyperthermostable proteins, including a relatively high number of salt bridges. However, the protein also exhibits flexible loops and surface pockets. Remarkably, ATV displays a new protein fold, consistent with the absence of homologues of this protein in public sequence databases.
This is a list of biological viruses. See also Comparison of computer viruses Excluded are other ranks of virus, viroids and prions. Also excluded are more recently discovered viruses such as Bourbon Virus, common names and obsolete names for viruses. For a list of virus genera, see List of genera of viruses. For a list of virus families and subfamilies, see List of virus families and subfamilies. For a taxonomic list, see Taxonomic list of viruses. Contents Top 0-9 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z Abaca bunchy top virus Abutilon golden mosaic virus Abutilon mosaic Bolivia virus Abutilon mosaic Brazil virus Abutilon mosaic virus Abutilon yellows virus Acanthamoeba polyphaga mimivirus Acanthocystis turfacea chlorella virus 1 Acara orthobunyavirus Acerodon celebensis polyomavirus 1 Acerodon celebensis polyomavirus 2 Acholeplasma virus L2 Acholeplasma virus MV-L51 Acidianus bottle-shaped virus Acidianus filamentous virus 1 Acidianus filamentous virus 2 Acidianus filamentous virus ...
Abalone herpesvirus Abalone shriveling syndrome-associated virus Abelson murine leukemia virus Abutilon mosaic virus Acanthamoeba castellanii mamavirus Acanthamoeba polyphaga mimivirus Acanthamoeba polyphaga moumouvirus Acanthocystis turfacea Chlorella virus Acheta domestica densovirus Achimota virus Acidianus bottle-shaped virus Acidianus filamentous virus Acidianus filamentus virus Acidianus spindle-shaped virus Aconitum latent virus Acute bee paralysis virus Adelaide River virus Adeno-associated virus Adenovirus Adoxophyes honmai enomopoxvirus Adoxophyes honmai nucleopolyhedrovirus Adoxophyes orana granulovirus Adoxophyes orana nucleopolyhedrovirus Aedes aegypti densovirus Aedes flavivirus Aedes taeniorhynchus iridescent virus Aeropyrum pernix K1 DNA Aeropyrum spring-shaped virus African cassava mosaic Burkina Faso virus African cassava mosaic virus African green monkey polyomavirus African oil palm ringspot virus African swine fever virus Ageratum enation alphasatellite Ageratum enation ...
Abalone herpesvirus Abalone shriveling syndrome-associated virus Abelson murine leukemia virus Abutilon mosaic virus Acanthamoeba castellanii mamavirus Acanthamoeba polyphaga mimivirus Acanthamoeba polyphaga moumouvirus Acanthocystis turfacea Chlorella virus Acheta domestica densovirus Achimota virus Acidianus bottle-shaped virus Acidianus filamentous virus Acidianus filamentus virus Acidianus spindle-shaped virus Aconitum latent virus Acute bee paralysis virus Adelaide River virus Adeno-associated virus Adenovirus Adoxophyes honmai enomopoxvirus Adoxophyes honmai nucleopolyhedrovirus Adoxophyes orana granulovirus Adoxophyes orana nucleopolyhedrovirus Aedes aegypti densovirus Aedes flavivirus Aedes taeniorhynchus iridescent virus Aeropyrum pernix K1 DNA Aeropyrum spring-shaped virus African cassava mosaic Burkina Faso virus African cassava mosaic virus African green monkey polyomavirus African oil palm ringspot virus African swine fever virus Ageratum enation alphasatellite Ageratum enation ...
Electron microscopic studies of the viruses in two hot springs (85 degrees C, pH 1.5-2.0, and 75-93 degrees C, pH 6.5) in Yellowstone National Park revealed particles with twelve different morphotypes. This diversity encompassed known viruses of hyperthermophilic archaea, filamentous Lipothrixviridae, rod-shaped Rudiviridae, and spindle-shaped Fuselloviridae, and novel morphotypes previously not observed in nature. Two virus types resembled head-and-tail bacteriophages from the families Siphoviridae and Podoviridae, and constituted the first observation of these viruses in a hydrothermal environment. Viral hosts in the acidic spring were members of the hyperthermophilic archaeal genus Acidianus.
Electron microscopic studies of the viruses in two hot springs (85 degrees C, pH 1.5-2.0, and 75-93 degrees C, pH 6.5) in Yellowstone National Park revealed particles with twelve different morphotypes. This diversity encompassed known viruses of hyperthermophilic archaea, filamentous Lipothrixviridae, rod-shaped Rudiviridae, and spindle-shaped Fuselloviridae, and novel morphotypes previously not observed in nature. Two virus types resembled head-and-tail bacteriophages from the families Siphoviridae and Podoviridae, and constituted the first observation of these viruses in a hydrothermal environment. Viral hosts in the acidic spring were members of the hyperthermophilic archaeal genus Acidianus. ...
1J8M: The crystal structure of the conserved GTPase of SRP54 from the archaeon Acidianus ambivalens and its comparison with related structures suggests a model for the SRP-SRP receptor complex.
1J8M: The crystal structure of the conserved GTPase of SRP54 from the archaeon Acidianus ambivalens and its comparison with related structures suggests a model for the SRP-SRP receptor complex.
0064]As described above, the inner diameter at the reduced diameter section 15 is somewhat smaller than an outer diameter (x) of the bead ring 6 immediately after the completion of the heating step, and is (x-0.1) mm to (x-0.4) mm. If the inner diameter of the reduced diameter section 15 is larger than (x-0.1) mm (for example, (x-0.05) mm), the inner diameter of the reduced diameter section 15 does not show a significant difference from the outer diameter of the bead ring 6, so that the latter would not be squeezed satisfactorily. If, the inner diameter of the reduced diameter section 15 is smaller than (x-0.4) mm (for example, (x-0.5) mm), the reduced diameter section 15 would crush the bead ring 6 to deform the bead ring 6. Since the tapered section 16 is outwardly expanding toward the lower end of the cylinder 14, the threads 8 and the bead ring 6 do not contact with the lower end of the cylinder 14 to deform neither the threads 8 nor the bead ring 6, when the cylinder 14 is engaged with the ...
The main aim of this study was determination of thermo- radio- and photostability ofperindopril tert-butyloamine (PER) therefore the efficiency and safety of the therapy could bemaintained.A chromatographic method (RP-HPLC) had been validated before use to determinePER loss. The evaluation of stability properties of PER in solid state under the influence ofisothermal condition, relative humidity - RH = 0% and 76.4%, exposure to 6 mln lux h andionizing radiation generated by beam of electrons of 25-400 kGy was investigated.Studies pointed out that presence of moisture changes a kinetic model of PER degradation;lack of moisture in the air generates a first-order kinetic model of the reaction, increasehumidity generates the autocatalytic model. PER proved to be resistant for ionizing radiation. Itis possible to use radiation sterilization and decontamination (dose 25 kGy) with no significantloss of content. Investigation of PER photostability proved, that after exposure to 6 mln lux hphysicochemical
url=http://longchampsoldesa.webs.com/]sacs longchamp[/url] Most women make blunder of buying a handbag which is larger than their body The latest and best Mulberry Outlet Medium Alexa Leather Satchel Blue Bag sale unique size, which could have an unfavorable consequence on their overall prospects when they go to show the new purchase. Women should select a bottle-shaped purse or a backpack that is not awfully bulky. However, if you have a Betty Boop Handbags model similar to the figure, large and thin, you should go for round or square-shaped handbags... Buy from an online abundance that offers a defended transaction and supply method. A lot of of these shops acquire specific bureau of online transaction methods such. The bazaar buyer gucci continental should aswell agreement safe and defended shipping. Its gross profit margins exceed 67%, vs. 54% five years ago. And Coach stores have incredibly high [annual] sales per square foot, roughly $865, compared with a traditional retailer like the ...
url=http://longchampsoldesa.webs.com/]sacs longchamp[/url] Most women make blunder of buying a handbag which is larger than their body The latest and best Mulberry Outlet Medium Alexa Leather Satchel Blue Bag sale unique size, which could have an unfavorable consequence on their overall prospects when they go to show the new purchase. Women should select a bottle-shaped purse or a backpack that is not awfully bulky. However, if you have a Betty Boop Handbags model similar to the figure, large and thin, you should go for round or square-shaped handbags... Buy from an online abundance that offers a defended transaction and supply method. A lot of of these shops acquire specific bureau of online transaction methods such. The bazaar buyer gucci continental should aswell agreement safe and defended shipping. Its gross profit margins exceed 67%, vs. 54% five years ago. And Coach stores have incredibly high [annual] sales per square foot, roughly $865, compared with a traditional retailer like the ...
Identification of plasmid pTC1 from Sulfolobus tengchongensis RT8-4. (a) Restriction digestion of the total DNA from S. tengchongensis RT8-4 containing pTC1. Th
Need a Hotel near Lago dAverno? We offer the CLOSEST Hotels with 24/7 Social Support. Find a Lower Price? Well Refund the Difference!
Close The Infona portal uses cookies, i.e. strings of text saved by a browser on the users device. The portal can access those files and use them to remember the users data, such as their chosen settings (screen view, interface language, etc.), or their login data. By using the Infona portal the user accepts automatic saving and using this information for portal operation purposes. More information on the subject can be found in the Privacy Policy and Terms of Service. By closing this window the user confirms that they have read the information on cookie usage, and they accept the privacy policy and the way cookies are used by the portal. You can change the cookie settings in your browser. ...
T01090 (acav,adh,amin,apom,arn,asoc,ato,balt,bara,bko,camg,cmb,def,fln,gli,gtm,lagl,les,mbov,mee,ntp,ntt,parb,part,pcx,pht,ppoa,ptu,rhu,sbj,sgv,smal,sscu,sya,tpaf,trl : calculation not yet completed ...
T01090 (apre,bapi,bgg,bhan,bths,cchv,ceh,chon,cwa,epa,eti,mmas,myi,nab,nhi,pmai,pspo,rdi,tbs,thh,xhr,zdf : calculation not yet completed ...
A virus isolate causing mosaic disease of commercial sugarcane was purified to homogeneity. Electron microscopy revealed flexuous filamentous virus particles of ca 890*15 nm. The virus isolate reacted positively with heterologous antiserum to narcissus latent virus form UK, but failed to react with potyvirus group specific antiserum. N-terminal sequencing of the intact coat protein (CP) and the tryptic peptides indicated that the virus was probably a potyvirus but distinct from several reported potyviruses. Comparison of the 30-terminal 1084 nucleotide sequence of the RNA genome of this virus revealed 93.6% sequence identity in the coat protein coding region with the recently described sugarcane streak mosaic virus (Pakistani isolate). The molecular weight of the coat protein (40 kDa) was higher than that deduced from the amino acid sequence (34 kDa). The apparent increase in size was shown to be due to glycosylation of the coat protein which has not been reported thus far in the family, ...
Many biopolymers share the properties of being only slightly flexible and having a high negative surface charge. These general properties of the single filaments have many implications for the structure and mechanical properties of the macroscopic networks they form in physiologic settings. Two biochemically distinct polymers, F-actin and the filamentous viruses fD, M13, and
Acetobacter ghanensis Cleenwerck et al. 2007, sp. nov. (Part 7) Acetobacter senegalensis Ndoye et al. 2007, sp. nov. (Part 7) Acidaminococcus Rogosa 1969 emend. Jumas-Bilak et al. 2007. (Part 10) Acidaminococcus intestini Jumas-Bilak et al. 2007, sp. nov. (Part 10) Acidianus Segerer et al. 1986 emend. Plumb et al. 2007. (Part 7) Acidianus sulfidivorans Plumb et al. 2007, sp. nov. (Part 7) Actinobacillus capsulatus Arseculeratne 1962 (Approved Lists 1980) emend. Kuhnert et al. 2007. (Part 3) Actinocatenispora sera Matsumoto et al. 2007, sp. nov. (Part 11) Actinocorallia aurea Tamura et al. 2007, sp. nov. (Part 9) Actinomadura alba Wang et al. 2007, sp. nov. (Part 8) Actinomadura rudentiformis Le Roes and Meyers 2007, sp. nov. (Part 1) Actinoplanes couchii Kämpfer et al. 2007, sp. nov. (Part 4) Actinotalea Yi et al. 2007, gen. nov. (Part 1) Actinotalea fermentans (Bagnara et al. 1985) Yi et al. 2007, comb. nov. - Basonym: Cellulomonas fermentans Bagnara et al. 1985. (Part 1) Aerococcus suis Vela ...
CYP238A1, one of the two P450 enzymes in the genome of Pseudomonas putida KT2440, has been produced heterologously in Escherichia coli, purified, and found to bind acyclic and cyclic terpene alcohols such as farnesol, nerolidol, linalool, and terpineol. The other P450 enzyme in this organism (gene locus: PP1950) was also produced in E. coli but no substrate has been identified from a limited screen. A phthalate family oxygenase reductase (PFOR) encoded by the PP1957 gene, just downstream of the PP1955 gene for CYP238A1, accepts electrons from the reduced form of both nicotinamide adenine dinucleotide (NADH) and nicotinamide adenine dinucleotide phosphate and is able to support monooxygenase activity of CYP238A1, both in vitro and in E. coli, in which both enzymes are produced. CYP238A1 oxidizes cis- and trans-nerolidol to the 9-hydroxy product, with no evidence of attack at the olefinic double bonds. The NADH turnover rate of 170 nmol(nmol-P450)⁻¹ Min⁻¹ for CYP238A1 with cis-nerolidol as substrate
Viruses that infect the third domain of life, Archaea, are a newly emerging field of interest. To date, all characterized archaeal viruses infect archaea that thrive in extreme conditions, such as halophilic, hyperthermophilic, and methanogenic environments. Viruses in general, especially those replicating in extreme environments, contain highly mosaic genomes with open reading frames (ORFs) whose sequences are often dissimilar to all other known ORFs. It has been estimated that approximately 85% of virally encoded ORFs do not match known sequences in the nucleic acid databases, and this percentage is even higher for archaeal viruses (typically 90%-100%). This statistic suggests that either virus genomes represent a larger segment of sequence space and/or that viruses encode genes of novel fold and/or function. Because the overall three-dimensional fold of a protein evolves more slowly than its sequence, efforts have been geared toward structural characterization of proteins encoded by archaeal viruses
Boab trees for wholesale distribution & export ranges from 5 to 15 meters, usually between 9 and 12 metres, with a broad bottle-shaped trunk.
ID K4L035_9FIRM Unreviewed; 324 AA. AC K4L035; DT 09-JAN-2013, integrated into UniProtKB/TrEMBL. DT 09-JAN-2013, sequence version 1. DT 25-OCT-2017, entry version 32. DE SubName: Full=Chromosomal replication initiator protein DnaA {ECO:0000313,EMBL:AFV04880.1}; GN Name=dnaA {ECO:0000313,EMBL:AFV04880.1}; GN ORFNames=DCF50_p873 {ECO:0000313,EMBL:AFV04880.1}; OS Dehalobacter sp. CF. OC Bacteria; Firmicutes; Clostridia; Clostridiales; Peptococcaceae; OC Dehalobacter. OX NCBI_TaxID=1131462 {ECO:0000313,EMBL:AFV04880.1, ECO:0000313,Proteomes:UP000000482}; RN [1] {ECO:0000313,EMBL:AFV04880.1, ECO:0000313,Proteomes:UP000000482} RP NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. RC STRAIN=CF {ECO:0000313,EMBL:AFV04880.1}; RX PubMed=23284863; DOI=10.1371/journal.pone.0052038; RA Tang S., Gong Y., Edwards E.A.; RT "Semi-automatic in silico gap closure enabled de novo assembly of two RT dehalobacter genomes from metagenomic data."; RL PLoS ONE 7:E52038-E52038(2012). CC -!- SIMILARITY: Belongs to the DnaA ...
R. Osellame,1 N. Chiodo,1 V. Maselli,1 A. Yin,1 M. Zavelani-Rossi,1 G. Cerullo, P. Laporta,1 L. Aiello,2 S. De Nicola,2 P. Ferraro,2 A. Finizio,2 and G. Pierattini2 1Istituto di Fotonica e Nanotecnologie del CNR - Dipartimento di Fisica del Politecnico di Milano P.zza L. da Vinci 32, 20133 Milano, Italy. 2Istituto Nazionale di Ottica Applicata - Istituto di Cibernetica del CNR "E. Caianiello" Via Campi Flegrei 34 80078 Pozzuoli (Napoli) ...
Read "Characterization of a filamentous virus from Bermuda grass and its molecular, serological and biological comparison with Spartina mottle virus, Archives of Virology" on DeepDyve, the largest online rental service for scholarly research with thousands of academic publications available at your fingertips.
Potexviruses and carlaviruses are plant‐infectingviruses belonging to the family Aphaflexiviridae and Betaflexiviridae, respectively
Smart polymers represent a new class of advanced materials with a wide range of applications. The stimuli responsive polymers respond to external stimuli, such as heat or light, by a change of physical properties. The self-healing polymers belong to the most promising applications of a smart behavior. They are stimuli responsive and possess the ability to self-heal when damaged. The project involves the synthesis and characterization of the novel smart polymers with enhanced mechanical properties. The thermo- or photo sensitive systems and self-healing materials will be studied and reinforced by application of polymer nanocomposites. The sensitive unit is presented by physical supramolecular structures or by reversible covalent bonds containing moieties. The project will be focused on (i) study and understanding of the response mechanism to the thermo- and photo-stimuli in smart polymer nanocomposites, and on (ii) thermo- and photo induced self-healing of materials with a high mechanical ...
Mycoplasmas are the smallest self-replicating prokaryotes. They are devoid of cell walls, with the plasticity of their outer membrane favouring pleomorphism, although some have a characteristic bottle-shaped appearance. Mycoplasmas recovered from humans belong to the genera Mycoplasma (14 species) and Ureaplasma (2 species). They are predominantly found in the respiratory and genital tracts, but sometimes invade the bloodstream and thus gain access to joints and other organs.... ...
Atherosclerosis of aorta abdominal region arises among the first complications of increased cholesterol level in an organism. Danger of disease is that at initial stages it is practically not distinguished, complaints of the patient are absent. When the state worsens there is an abdominal pain of various intensity that depends on the volume of vessels lesion. There is a feeling of gravity and dyspepsia: appetite loss, excessive flatulency, weight loss.. Development of abdominal aorta atherosclerosis leads to more terrible complications. The most dangerous is aneurysm. This is a uniform bottle-shaped expansion of whole vessel with a thinning of its walls or local "protruding" aorta wall.. Such patients have nagging pains in stomach; they are localized in the left half of stomach or near umbilicus, sometimes in loin, seldom inguinal area. Pains begin from attack-like usually right after meal, then in two-three hours stop without assistance.. Feeling of pulsation in stomach is a one more diagnostic ...
by Mike Arnold. Conflicting Opinions. Beginning in the mid-1990s, the issue of stomach distension became an area of criticism among traditionalists, with many in the bodybuilding community voicing disapproval over its presence within the upper echelons of the sport. Ever since then various events have continued to transpire, thrusting the issue back into the spotlight and each time, speculation regarding the reasons for its appearance has run rampant. Most recently, it was Arnold Schwarzenegger who, during an interview with Bob Chicerillo at the annual Arnold Classic, decided to voice his displeasure over the problem. Referring to modern physiques as "bottle-shaped" and ridiculing head judge Jim Manion for his complacency in allowing the sport to depart from traditional aesthetic standards, Arnolds words were heard loud and clear all around the world. Within one day of his comments making headlines, we started seeing threads pop up all over the place, asking why todays bodybuilders dont have ...
In this study, the collective microbial diversity in the rumen was examined by performing a meta-analysis of all the curated 16S rRNA gene (rrn) sequences deposited in the RDP database. As of November 2010, 13478 bacterial and 3516 archaeal rrn sequences were found. The bacterial sequences were assigned to 5271 operation taxonomic units (OTUs) at species level (0.03 phylogenetic distance) representing 19 existing phyla, of which the Firmicutes (2958 OTUs), Bacteroidetes (1610 OTUs) and Proteobacteria (226 OTUs) were the most predominant. These bacterial sequences were grouped into more than 3500 OTUs at genus level (0.05 distance), but only 180 existing genera were represented. Nearly all the archaeal sequences were assigned to 943 species-level OTUs in phylum Euryarchaeota. Although clustered into 670 genus-level OTUs, only 12 existing archaeal genera were represented. Based on rarefaction analysis, the current percent coverage at species level reached 71% for bacteria and 65% for archaea. At ...
Aaron dont worry about what your standard of modeling is. Build what you want. Experiance comes with age and practice. We all cant be number one. Some of us a better at other things. I built my MGS with BAR Armor I think 2 years ago. I found as many pics as I could on the internet and I live 15 miles from FT Knox the once great home of Armor. Hard to get close to the things. I did as best as I could , use Evergreen strip styrene. I think it came out pretty good. I put a .50 cal on the gun mantle for counter sniper operations. Hey its my model ...
afv:AFLA_018910 K01312 trypsin [EC:3.4.21.4] , (RefSeq) elastase, putative (A) MHVVPFTSLLLAIASFANAIVNGVEATKDQAPFTVGLSGTRLFCAGSLIGEKSVITAASC VKDKDATSINVRLGSLQHASGGTVIGVASIDIHPQYDADSLDNDIAFLALADSYSGATPA QLPTKQKALGYGSSVQIFGWGETSKGASFSRTLKTASVNIISRSNCQNIYGPITTITRRE FCVITKDGKGACQADQGGPVVDSAGTLVGIISRAKSCDAGNYPGVETQVDAYLDWINSKL A ...
Vehicle). Results are expressed as means ± SD for the number of animals shown inside in parenthesis. Differences in experimental groups were determined by two-tailed Analysis of Variance (ANOVA ...
Respiratory syncytial virus (RSV) is an enveloped virus that assembles into filamentous virus particles on the surface of infected cells. Morphogenesis of RSV is dependent upon cholesterol-rich (lipid raft) membrane microdomains, but the specific role of individual raft molecules in RSV assembly is not well defined. Here we show that RSV morphogenesis occurs within caveolar membranes and that both caveolin-1 and cavin-1, the two major structural and functional components of caveolae, are actively recruited to and incorporated into the RSV envelope. The recruitment of caveolae occurred just prior to the initiation of RSV filament assembly, and was dependent upon an intact actin network as well as a direct physical interaction between caveolin-1 and the viral G protein. Moreover, cavin-1 protein levels were significantly increased in RSV-infected cells, leading to a virus-induced change in the stoichiometry and biophysical properties of the caveolar coat complex. Our data indicate that RSV ...
Desert rose tree (Adenium obesum sokotranum) flowers. This subspecies of the desert rose is endemic to the Socotran archipelago of islands, meaning that it is found nowhere else. The flowers are produced on branches at the top of a thick, bottle-shaped trunk (not seen). Socotra is located in the Indian Ocean at the mouth of the Gulf of Aden, 340 kilometres (km) from mainland Yemen and 250km from the coast of Somalia. Its isolation has led to the evolution of a unique flora and fauna. - Stock Image B760/0497
TABLE-US-00001 TABLE 1 Example 1 Example 2 Example 3 Example 4 Example 5 Example 6 Example 7 Example 8 Example 9 PASTING TEMPERATURE [° C.] 75 75 75 75 100 65 75 75 50 SUPPORT MATERIAL PET PET PET PET PET PET PET PET PET BASE THICKNESS (μm) 50 50 50 50 50 50 50 50 50 ADHE- TYPE OF A A A A A A A A A SIVE SOLUTION LAYER THICKNESS 30 60 30 60 30 30 30 30 30 ULTRAVIOLET 0 0 400 400 400 400 400 400 400 RAY IRRADIA- TION INTEN- SITY (mJ/cm2) SHEAR MODULUS 3.8 × 104 3.8 × 104 5.7 × 105 5.7 × 105 4.5 × 104 2.9 × 105 5.7 × 105 5.7 × 105 1.2 × 106 (Pa) AT PASTING TEMPERATURE THERMO- TYPE OF a a a a a a a a a SETTING SOLUTION RESIN THICKNESS (μm) 40 40 40 40 40 40 60 5 40 LAYER MELT VISCOSITY 1.5 × 103 1.5 × 103 1.5 × 103 1.5 × 103 4.5 × 102 1.2 × 104 1.5 × 103 1.5 × 103 1.7 × 104 (Pa S) AT PASTING TEM- PERATURE INITIAL PEEL STRENGTH (N/20 mm) ,2 ,2 0.04 0.03 0.04 0.04 0.04 0.04 0.04 OF ADHESIVE LAYER ON THERMO- SETTING RESIN LAYER IRRADIATION WITH ULTRAVIOLET YES YES NO NO NO NO NO NO ...
This article deals with the design of a new class of dual-responsive coumarin-based copolymers, sensitive to temperature and light (UV and near infrared). These well-defined random copolymers, composed of triethylene glycol methyl ether methacrylate (TEGMA) and 6-bromo-4-hydroxymethyl-7-coumarinyl methacryla
An important characteristic of the acidophilic chemolithotrophs is their general tolerance of high concentrations of metallic and other ions. The levels of resistance of several acidophilic bacteria and archaea to As3+, Cu2+, Zn2+, Cd2+ and Ni+ have recently been reviewed and will not be covered here in detail [25]. As may be predicted, levels of resistance show considerable strain variation. Adaptation to high levels of metal resistance on exposure to a metal is likely to be responsible for much of the variation. At. ferrooxidans appears to be particularly resistant to metals and the bacterium has been reported to grow in medium containing Co2+ (30 g/l), Cu2+ (55 g/l), Ni2+ (72 g/l), Zn2+ (120 g/l), U3O8 (12 g/l) and Fe2+ (160 g/l). In a comparative study of two At. ferrooxidans, two L. ferrooxidans and an At. thiooxidans strain, it was found that At. ferrooxidans and L. ferrooxidans were approximately equally resistant to Cu2+, Zn2+, Al3+, Ni2+ and Mn2+, but that L. ferrooxidans was more ...
What Existential Dread said (and linked to) but also: Dont ignore things if theres no pain where there used to be. My offending tender bit used to be just that, always the more susceptible of the two to be screaming in agony when coming into contact with solid objects at speed (couldve made out like a bandit on AFV if any had ever had a camera running). However, and I didnt realize this until after the diagnosis of TC was confirmed though an orchiectomy, at some point in the second half of last year it stopped being as sensitive as it once was. Lack of pain can be just as much of an indicator for a problem as excruciating pain, but its not something that we generally associate with having to make a trip to the doctor for ...
A sample of n=9 scores is obtained from a normal population distribution with o-=12. The sample mean is M=60. a- with a two-tailed test and o=.05,use the sample data to test the hypothesis that the population mean is u=65. b- with a two-tailed test and o=.05, use the ample data to test the hypothesis that the population me ...
Significant associations are highlighted in bold. a Two-tailed P values were calculated by home-made program written in R language. b Corrected P values Pcorr - after Bonferroni correction- are shown in brackets.. ...
Metagenomic sequencing is an important tool that often uses next generation amplicon sequencing to target specific hypervariable regions of the microbial 16S rRNA gene. This is used to identify any relative abundance calculation of bacteria and archaea present in heterogeneous samples, such as soil, marine, or gut microbiome.. 16S MetaVx™ is a proprietary, patent-pending assay that improves upon current 16S metagenomics techniques with significant sensitivity and specificity. Compared side-by-side with the most commonly used 16S metagenomics assays, 16S MetaVx™ has the ability to detect more bacterial and archaeal genera with a lower limit of detection.. ...
Metagenomic sequencing is an important tool that often uses next generation amplicon sequencing to target specific hypervariable regions of the microbial 16S rRNA gene. This is used to identify any relative abundance calculation of bacteria and archaea present in heterogeneous samples, such as soil, marine, or gut microbiome.. 16S MetaVx™ is a proprietary, patent-pending assay that improves upon current 16S metagenomics techniques with significant sensitivity and specificity. Compared side-by-side with the most commonly used 16S metagenomics assays, 16S MetaVx™ has the ability to detect more bacterial and archaeal genera with a lower limit of detection.. ...
Rudiviridae es una familia de virus que comprende un sólo género, Rudivirus,[1]​ que infecta a la arquea Sulfolobus.[2]​ Comparten características con la familia Lipothrixviridae pues ambos son virus filamentosos con genomas ADN bicatenarios lineales que infectan arqueas termófilas[3]​ del filo Crenarchaeota.[4]​ Por ello pertenecen al Grupo I de la Clasificación de Baltimore. No presentan envoltura.[5]​ La replicación y topología del genoma de los miembros de la familia Rudiviridae son similares a los de Poxviridae.[6]​[7]​[8]​ George Rice, Kenneth Stedman, Jamie Snyder, Blake Wiedenheft, Debbie Willits, Susan Brumfield, Timothy McDermott, and Mark J. Young "Viruses from extreme thermal environments" Proc Natl Acad Sci U S A. 2001 November 6; 98(23): 13341-13345. Published online 2001 October 23 Zillig, W., Prangishvili, D., Schleper, C., Elferink, M., Holz, I., Albers, S., Janekovic, D. and Götz, D. (1996). Viruses, plasmids and other genetic elements of thermophilic ...
Im Rahmen dieser Arbeit wurde versucht, die A1AO ATP-Synthase von I. hospitalis zu reinigen und die Untereinheitenzusammensetzung des Komplexes zu bestimmen. Obwohl der gekoppelte Komplex erfolgreich durch das Detergenz DDM (n-Dodecyl-β-D-Maltopyranosid) aus der Membran herausgelöst werden konnte, war eine Reinigung des Gesamtkomplexes bisher nicht möglich. Zahlreiche Versuche, das Enzym über säulenchromatographische Verfahren zu reinigen, führten lediglich zu einer Anreicherung der dissoziierten A1- und AO-Subkomplexe der ATP-Synthase. Eine Identifizierung der Untereinheiten war durch eine Kombination von 2D-Native/SDS-PAGE, Western-Blot-Analysen und MALDI-TOF MS/MS möglich. So konnte die in vivo Expression von acht annotierten Untereinheiten der ATP-Synthase (A, B, C, D, E, F, a(I) und c(K)) bestätigt und das Protein Igni1215 als Bestandteil der ATP-Synthase (Untereinheit H) identifiziert werden. Die beiden erhaltenen Subkomplexe bestanden aus A, B, E und F (A1) und aus C, D, H und a ...
Since humans activities contribute to climate change it is important to change behavior. Switching to a hybrid/plugin/electric vehicle (HEV/PHEV/EV) for personal transport can be one way. In this study the intention to switch to a HEV/PHEV/EV is studied from the theoretical framework of the moral norm-activation theory of altruism (Schwartz, 1977) and the Value-Belief-Norm (VBN) Theory of environmentalism (Stern et al., 1999). Data was collected using a survey to three groups, alternative fuel vehicle owners (AFV, mainly E85/ethanol), fossil fuel vehicle owners (conventional vehicles, CV), and hybrid/plugin/electric vehicle owners (HEV/PHEV/EV). A SEM model was proposed, and tested on the subsamples of CV and AFV owners, of a hierarchical process of influence from the more general (e.g. values) to the more specific (e.g. beliefs, norms) and finally the intention. The results supported the proposed norm-activation model and showed that problem awareness was more influential in the AFV than in ...
Using AIUââ?¬â?¢s survey responses from the AIU data set, complete the following requirements in the form of a report: TEST #1 Perform the following two-tailed hypothesis test, using a .05 significance level: ââ?¬¢.
In the 12 years from 1975 to 1987, 55 patients had open pulmonary valve surgery for isolated congenital stenosis of the pulmonary valve. Three types of pulmonary stenosis were seen: (a) dome-shaped pulmonary stenosis (34 patients); (b) dysplastic pulmonary valves with thick cauliflower-like cusps (12 patients), and (c) hour-glass deformity of the pulmonary valve, with "bottle-shaped" sinuses (nine patients). This third type has not been described before. Preoperative identification of the valve structure is important because the choice of treatment (balloon dilatation for some dome-shaped valves and excision for dysplastic and hour-glass valves) depends on the type of stenosis. ...
Thermostable esterases screened on hyperthermophilic archaeal and bacterial strains isolated from deep-sea hydrothermal vents : Characterization of esterase activity of a hyperthermophilic archaeum, Pyrococcus abyssi ...
The question of which proteins are involved in the interaction cell-cell contact and in transport between these two archaea cannot be addressed, at least presently, by genetics, such as mutagenesis or knockouts. We have therefore chosen the direct approach, by isolating a complex of membrane and membrane-associated proteins, using detergent-induced solubilization, followed by size-exclusion chromatography.. In the analysis of all proteins identified to be present in the detergent-solubilized membranes, approx. 26% of the I. hospitalis proteins, but only 4.2% of the N. equitans proteins belong to the category Transport and metabolism. This reflects the known difference between both organisms in their physiology and genome capacity: whereas I. hospitalis has the ability to grow alone and has a genome with full capacity for all biosynthetic pathways, N. equitans is not able to thrive alone and its genome is very compact and highly reduced; enzymes involved in many biosynthetic pathways cannot be ...
The remarkable diversity of the morphologies of viruses found in terrestrial hydrothermal environments with temperatures ,80°C is unprecedented for aquatic ecosystems. The best-studied viruses from these habitats have been assigned to novel viral families: Fuselloviridae, Lipothrixviridae and Rudiviridae. They all have double-stranded DNA genomes and infect hyperthermophilic crenarchaea of the orders Sulfolobales and Thermoproteales. Representatives of the different viral families share a few homologous ORFs (open reading frames). However, about 90% of all ORFs in the seven sequenced genomes show no significant matches to sequences in public databases. This suggests that these hyperthermophilic viruses have exceptional biochemical solutions for biological functions. Specific features of genome organization, as well as strategies for DNA replication, suggest that phylogenetic relationships exist between crenarchaeal rudiviruses and the large eukaryal DNA viruses: poxviruses, the African swine ...
The grotto of Posillipo is an artificial tunnel, cut out of the homonymous hill between Naples and Pozzuoli on orders from the emperor Augustus. A motif as fascinating as it is inspiring, the site was considered - at least since the seventeenth century (see cat. no. 83) - a must-see for any traveller or artist performing the Grand Tour. Suvée, a native of Bruges, awarded the Grand Prix de Rome in 1771, was one of them. It was in 1775, during an excursion in Campania, that he came upon this antique vestige, and immortalised it working from life, in red chalk.1. Carved directly out of the rock, the entrance to the tunnel, seen here on the Naples side - the most frequently depicted - is off-centred to the right of the sheet, allowing the artist to describe the sheer wall bordering the passage on the left side. The distant tunnel opening, a tiny rectangle of untouched paper, shows the scale of the grotto, thereby dizzyingly shortening the 705-metres length. With broad strokes of hatching, ...
Responsive supramolecular gels were constructed from crown ether terminated four-arm star poly(ε-caprolactone) (PCL-DB24C8) and dibenzylammonium-terminated two-arm PCL-DBAS (see scheme), exploiting the formation of pseudorotaxane linkages between crown ether and ammonium moieties. The resultant supramolecular gels exhibit thermo- and pH-induced reversible gel-sol transition. ...
The [http://mathworld.wolfram.com/F-Distribution.html Fishers F Distribution], and the corresponding F-test, is used to test if the variances of two populations are equal. Depending on the alternative hypothesis, we can use either a two-tailed test or a one-tailed test. The two-tailed version tests against an alternative that the standard deviations are not equal (,math,H_1: \sigma_1^2 \not= \sigma_2^2,/math,). The one-tailed version only tests in one direction (,math,H_1: \sigma_1^2 , \sigma_2^2,/math, or ,math,H_1: \sigma_1^2 , \sigma_2^2,/math,). The choice is determined by the [[AP_Statistics_Curriculum_2007_IntroDesign , study design]] before any data is analyzed. For example, if a modification to an existent medical treatment is proposed, we may only be interested in knowing if the new treatment is more consistent and less variable than the established medical intervention ...
Write the null and alternative hypotheses for the given claim. The claim could be about one or two means, proportions, variances or standard deviations. Also identify whether the test is a left-tailed, right-tailed, or two-tailed test (based on the alternative hypothesis). Six parts. If you have two samples, be sure to define your subscripts or use appropriate letters (ex: M for male, F for Female ...
A radioaktív bomlás során az instabil atommag szerkezete változik meg A radioaktív bomlás során az instabil atommag szerkezete változik meg. BOMLÁS = új atommag keletkezik, amely részecskesugárzás kibocsátása révén stabilizálódik, tehát a radioaktivitás és a sugárzás összetartoznak. Radioaktív nuklidok keletkezése: magreakciók által, melyekben „célmagok
A method, and system, to induce remission in diseases characterized by excess production of sTNR and interleukin 2 has been developed. In the most preferred embodiment, the system consists of antibodies to sTNFR1, sTNFR2 and sIL2R immobilized in a column containing a material such as SEPHAROSE™. The patient is connected to a pheresis machine which separates the blood into the plasma and red cells, and the plasma is circulated through the column until the desired reduction in levels of sTNFR1, sTNFR2, and IL2 is achieved, preferably to less than normal levels. In the preferred method, patients are treated three times a week for four weeks. This process can be repeated after a period of time. Clinical studies showed reduction in tumor burden in patients having failed conventional chemotherapy and radiation treatments.
Aquaporin-1 or Aquaporin1, Aqp1, of 258 aas and 6 TMSs. Three Aqp1 isoforms are differentially regluated by the function of the vasotocin (AVTR) and isotocin (ITR) receptors (Martos-Sitcha et al. 2015). Aqp1aa, one of two isoforms in teleosts, may play a role in spermatogenesis in Cynoglossus semilaevis (Guo et al. 2017 ...
Back , Main menu , PSLC In 1839 Charles Goodyear invented a process called vulcanization, which made rubber more durable and more useful at hot and cold temperatures. Vulcanization crosslinks rubber. That is, it ties all the chainlike rubber molecules together to form one big molecule. This does a lot for the rubber, but it can also make rubber difficult to process. Think about it. A material made of one molecule cant really flow into a mold, and it cant be shaped or worked very easily. A material made of crosslinked rubber has to be shaped before it is crosslinked. Crosslinking also makes rubber difficult to recycle. Some kinds of synthetic rubber arent crosslinked, however. They can be molded and remolded again and again. They are called thermoplastic elastomers. Thermo- means "heat", and plastic means "moldable". Elastomer is just a fancy word that means "rubber." So a thermoplastic elastomer is a rubber that can be molded when it is heated. While it is wonderful that thermoplastic ...
Zn-Mobil is produced from a beneficial autotrophic and acidophilic bacterium Thiobacillus thiooxidans. Zinc (Zn) is one of the essential micronutrient...
Find the Maier Red Standard ATV Front Fender - 120502 at Dennis Kirk. Shop our complete selection of ATV & UTV parts and accessories including the Maier Red Standard ATV Front Fender - 120502.
Sulfolobus Micrographie électronique dune cellule de Sulfolobus infectée par le virus STSV1 (Sulfolobus tengchongensis spindle-shaped virus 1). Genre Sulfolobus Brock et al., 1972 Espèces de rang inférieur Sulfolobus acidocaldarius Sulfolobus beitou Sulfolobus islandicus Sulfolobus metallicus Sulfolobus neozealandicus Sulfolobus shibatae Sulfolobus solfataricus Sulfolobus tengchongensis Sulfolobus thuringiensis Sulfolobus tokodaii Sulfolobus vallisabyssus Sulfolobus yangmingensis Sulfolobus est un genre darchées de la famille des Sulfolobaceae. Ce sont des cellules coccoïdes, irrégulières et flagellées. Ces microorganismes sont à la fois hyperthermophiles (avec un optimum de croissance de 75 à 80 °C) et acidophiles (pH optimal de croissance proche de 2 ou 3) ; cest par exemple le cas de Sulfolobus acidocaldarius, isolé de sources chaudes acides. Ils sont hétérotrophes ou autotrophes, leur énergie provenant de loxydation du soufre et/ou par respiration utilisant le soufre ...
Whereas the infection cycles of many bacterial and eukaryotic viruses have been characterized in detail, those of archaeal viruses remain largely unexplored. Recently, studies on a few model archaeal viruses such as SIRV2 (Sulfolobus islandicus rod-shaped virus) have revealed an unusual lysis mechanism that involves the formation of pyramidal egress structures on the host cell surface. To expand understanding of the infection cycle of SIRV2, we aimed to functionally characterize gp1, which is a SIRV2 gene with unknown function. The SIRV2_Gp1 protein is highly expressed during early stages of infection and it is the only protein that is encoded twice on the viral genome. It harbours a helix-turn-helix motif and was therefore hypothesized to bind DNA. The DNA-binding behavior of SIRV2_Gp1 was characterized with electrophoretic mobility shift assays and atomic force microscopy. We provide evidence that the protein interacts with DNA and that it forms large aggregates, thereby causing extreme condensation
Page contains details about giant cage catenane mesoporous assembly . It has composition images, properties, Characterization methods, synthesis, applications and reference articles : nano.nature.com
Swap CDIs. If you already know how, thats good. Youll need to remove your original CDI from your ATV. To do this, pull the CDI unit out of your ATV so that it is only connected by the cable. Now, pull out the cable that is connected to the CDI from the ATV. Move your unplugged CDI out of the way. Install the spare CDI into your ATV. Take your working CDI and plug its cable into the input on the ATV. Since youll be using it for testing, theres not need to put it into place on the ATV ...
But lets just focus first on the individual tags. I compiled a master list of all tags that were expressed in any region at any age, and then made a chart of the frequency of expression in each brain region/age. I excluded any tags where the total expression count on both sides was three or less, as this is too small to show lateralisation, and this left me with 3800 to 4600 tags for analysis in each brain region. I did compute chi square as described by Sun et al, but this is not recommended for small numbers, and so I also evaluated the significance of asymmetry using a two-tailed binomial test. This doesnt make a huge difference, but is more accurate when comparing small numbers. Figure 1 shows the proportion of the sample for each brain region where the binomial test gives a p-value of a given size. If the distribution of expression in left and right was purely determined by chance, wed expect the points to fall on the line. If there were genes for asymmetry we would expect the observed ...
Betalipothrixvirus - Wikipedia  Betalipothrixvirus - Wikipedia
Acidianus filamentous virus 3 Acidianus filamentous virus 6 Acidianus filamentous virus 7 Acidianus filamentous virus 8 ... Acidianus filamentous virus 9 Sulfolobus islandicus filamentous virus Viruses in Betalipothrixvirus are enveloped, with rod- ...
more infohttps://en.wikipedia.org/wiki/Betalipothrixvirus
Acidianus Segerer & al., 1986  Acidianus Segerer & al., 1986
... Dataset GBIF Backbone Taxonomy Rank GENUS Published in Int. J. Syst. Bacteriol. 36::559 ...
more infohttps://www.gbif.org/species/1000044
Acidianus - Wikipedia  Acidianus - Wikipedia
... pages for Acidianus Search Species2000 page for Acidianus MicrobeWiki page for Acidianus LPSN page for Acidianus Acidianus at ... PubMed references for Acidianus PubMed Central references for Acidianus Google Scholar references for Acidianus NCBI taxonomy ... Segerer A; Neuner AM; Kristjansson JK; Stetter KO (1986). "Acidianus infernus gen. nov., sp. nov., and Acidianus brierleyi comb ... In taxonomy, Acidianus is a genus of the Sulfolobaceae. List of bacterial genera named after mythological figures See the NCBI ...
more infohttps://en.wikipedia.org/wiki/Acidianus
Acidianus sulfidivorans - Wikipedia  Acidianus sulfidivorans - Wikipedia
Acidianus sulfidivorans at the Encyclopedia of Life LPSN Type strain of Acidianus sulfidivorans at BacDive - the Bacterial ... The type strain is JP7(T) (=DSM 18786(T)=JCM 13667(T)). Plumb JJ; Haddad CM; Gibson JA; Franzmann PD (July 2007). "Acidianus ... Acidianus sulfidivorans is a species of archaeon. It is an extremely thermoacidophilic, obligately chemolithotrophic archaeon. ... Plumb, J., Haddad, C., and Franzmann, P. (2008). A novel extremophile Acidianus sulfidivorans sp. nov. from island paradise to ...
more infohttps://en.wikipedia.org/wiki/Acidianus_sulfidivorans
Frontiers | An Extracellular Tetrathionate Hydrolase from the Thermoacidophilic Archaeon Acidianus Ambivalens with an Activity...  Frontiers | An Extracellular Tetrathionate Hydrolase from the Thermoacidophilic Archaeon Acidianus Ambivalens with an Activity...
The thermoacidophilic and chemolithotrophic archaeon Acidianus ambivalens is routinely grown with sulfur and CO2-enriched air. ... The thermoacidophilic and chemolithotrophic archaeon Acidianus ambivalens is routinely grown with sulfur and CO2-enriched air. ... Acidianus ambivalens is Growing with Tetrathionate as Sole Sulfur Source. Acidianus ambivalens grown aerobically with 10 mM ... Acidithiobacillus and Acidianus TTHs are Similar Enzymes. The extracellular location of the A. ambivalens enzyme is consistent ...
more infohttps://www.frontiersin.org/articles/10.3389/fmicb.2011.00068/full
Protein-protein, protein-RNA and protein-lipid interactions of signal-recognition particle components in the...  Protein-protein, protein-RNA and protein-lipid interactions of signal-recognition particle components in the...
Acidianus ambivalens, archaeon, Crenarchaea, hyperthermoacidophile, signal-recognition-particle (SRP) components, tetraether ... The signal-recognition particle (SRP) of one of the most acidophilic and hyperthermophilic archaeal cells, Acidianus ambivalens ... and protein-lipid interactions of signal-recognition particle components in the hyperthermoacidophilic archaeon Acidianus ... and protein-lipid interactions of signal-recognition particle components in the hyperthermoacidophilic archaeon Acidianus ...
more infohttps://portlandpress.com/biochemj/article/374/1/247/43656/Protein-protein-protein-RNA-and-protein-lipid
Acidianus, Sulfolobus and Metallosphaera surface layers: structure, composition and gene expression  - University of Regensburg...  Acidianus, Sulfolobus and Metallosphaera surface layers: structure, composition and gene expression - University of Regensburg...
We isolated the large S-layer protein of Acidianus ambivalens and both S-layer subunits of Sulfolobus solfataricus and ... We isolated the large S-layer protein of Acidianus ambivalens and both S-layer subunits of Sulfolobus solfataricus and ... Acidianus, Sulfolobus and Metallosphaera surface layers: structure, composition and gene expression. Molecular microbiology 73 ...
more infohttps://epub.uni-regensburg.de/13690/
Genome of the Acidianus bottle-shaped virus and insights into the replication and packaging mechanisms. - Semantic Scholar  Genome of the Acidianus bottle-shaped virus and insights into the replication and packaging mechanisms. - Semantic Scholar
... infects strains of the hyperthermophilic archaeal genus Acidianus and is morphologically distinct from all other known viruses ... The Acidianus bottle-shaped virus, ABV, infects strains of the hyperthermophilic archaeal genus Acidianus and is ... Genome of the Acidianus bottle-shaped virus and insights into the replication and packaging mechanisms.. @article{ ... Viral diversity in hot springs of Pozzuoli, Italy, and characterization of a unique archaeal virus, Acidianus bottle-shaped ...
more infohttps://www.semanticscholar.org/paper/Genome-of-the-Acidianus-bottle-shaped-virus-and-the-Peng-Basta/af4dbc231185dcf8e738a21170f34d9cf940cdbc
Vol 2: Draft Genome Sequence of the Novel Thermoacidophilic Archaeon Acidianus copahuensis Strain ALE1, Isolated from the...  Vol 2: Draft Genome Sequence of the Novel Thermoacidophilic Archaeon Acidianus copahuensis Strain ALE1, Isolated from the...
Vol 2: Draft Genome Sequence of the Novel Thermoacidophilic Archaeon Acidianus copahuensis Strain ALE1, Isolated from the ... Vol 2: Draft Genome Sequence of the Novel Thermoacidophilic Archaeon Acidianus copahuensis Strain ALE1, Isolated from the ... Vol 2: Draft Genome Sequence of the Novel Thermoacidophilic Archaeon Acidianus copahuensis Strain ALE1, Isolated from the ... Draft Genome Sequence of the Novel Thermoacidophilic Archaeon Acidianus copahuensis Strain ALE1, Isolated from the Copahue ...
more infohttp://libros.duhnnae.com/2017/may/149442826273-Vol-2-Draft-Genome-Sequence-of-the-Novel-Thermoacidophilic-Archaeon-Acidianus-copahuensis-Strain-.php
Extremophiles Page 1  Extremophiles Page 1
Acidianus ambivalens (Zillig and Bock) Fuchs et al. (ATCC® 49204™) ATCC® Number: 49204™ Deposited As Desulfurolobus ambivalens ...
more infohttps://www.atcc.org/en/Products/Cells_and_Microorganisms/Bacteria/Extremophiles.aspx?dsNav=Ro:0,Up:Page_Product_Listing&slp=1
Extremophiles Page 1  Extremophiles Page 1
Acidianus ambivalens (Zillig and Bock) Fuchs et al. (ATCC® 49204™) ATCC® Number: 49204™ Deposited As Desulfurolobus ambivalens ...
more infohttps://www.atcc.org/en/Products/Cells_and_Microorganisms/Bacteria/Extremophiles.aspx?dsNav=Ro:0&slp=1
Proteins matched: Mevalonate kinase (MF 00217) | InterPro | EMBL-EBI  Proteins matched: Mevalonate kinase (MF 00217) | InterPro | EMBL-EBI
Candidatus Acidianus copahuensis. Loading... A0A060HIS7 Mevalonate kinase. Nitrososphaera viennensis EN76. Loading... ...
more infohttp://www.ebi.ac.uk/interpro/ISignatureProteins?sig=MF_00217&query=Q
Bacteriophage - Wikipedia  Bacteriophage - Wikipedia
Acidianus filamentous virus 1 Rudiviridae. Nonenveloped, rod-shaped. Linear dsDNA. Sulfolobus islandicus rod-shaped virus 1 ...
more infohttps://en.wikipedia.org/wiki/Phage
SacN8 10890 - Acyl-CoA synthetase - Sulfolobus acidocaldarius N8 - SacN8 10890 gene & protein  SacN8 10890 - Acyl-CoA synthetase - Sulfolobus acidocaldarius N8 - SacN8 10890 gene & protein
Acidianus manzaensis. 622. Acyl-CoA synthetase. Sulfolobus acidocaldarius Ron12/I. 619. Acyl-CoA synthetase. SULAC ...
more infohttps://www.uniprot.org/uniprot/M1IY50
SacN8 01980 - Asparaginase - Sulfolobus acidocaldarius N8 - SacN8 01980 gene & protein  SacN8 01980 - Asparaginase - Sulfolobus acidocaldarius N8 - SacN8 01980 gene & protein
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
more infohttps://www.uniprot.org/uniprot/M1IN77
Desulfurolobus ambivalens Zillig & Böck, 1987  Desulfurolobus ambivalens Zillig & Böck, 1987
Acidianus species Acidianus ambivalens Name. Homonyms. Desulfurolobus ambivalens Zillig & Böck, 1987. What is GBIF? API FAQ ...
more infohttps://www.gbif.org/species/1000049
Patent US5246486 - Biooxidation process for recovery of gold from heaps of low-grade sulfidic ... - Google Patents  Patent US5246486 - Biooxidation process for recovery of gold from heaps of low-grade sulfidic ... - Google Patents
Sulfolobus solfataricus and Acidianus brierleyi and the like.______________________________________. The above bacteria are ...
more infohttp://www.google.com/patents/US5246486?dq=U.S.+Patent+
Frontiers | Sulfur Metabolisms in Epsilon- and Gamma-Proteobacteria in Deep-Sea Hydrothermal Fields | Microbiology  Frontiers | Sulfur Metabolisms in Epsilon- and Gamma-Proteobacteria in Deep-Sea Hydrothermal Fields | Microbiology
Sulfolobus and Acidianus; Friedrich, 1998; Kletzin et al., 2004; Friedrich et al., 2005; Frigaard and Dahl, 2009). Bacterial ...
more infohttps://www.frontiersin.org/articles/10.3389/fmicb.2011.00192/full
  • For example, a microscopic organism known as Acidianus hospitalis thrives in highly acidic environments that are hotter than 80°C, conditions that would kill humans and many other species. (elifesciences.org)