A genus of facultatively anaerobic coccoid ARCHAEA, in the family SULFOLOBACEAE. Cells are highly irregular in shape and thermoacidophilic. Lithotrophic growth occurs aerobically via sulfur oxidation in some species. Distribution includes solfataric springs and fields, mudholes, and geothermically heated acidic marine environments.
Family of enveloped, lipid-containing, filamentous DNA viruses that infect ARCHAEA.
A family of SULFOLOBALES consisting of aerobic or facultatively anaerobic chemolithotrophic cocci, usually occurring singly. They grow best at a pH of about 2.
Viruses whose hosts are in the domain ARCHAEA.
Proteins found in any species of archaeon.
An order of CRENARCHAEOTA consisting of aerobic or facultatively aerobic, chemolithotrophic cocci which are extreme thermoacidophiles. They lack peptidoglycan in their cell walls.
Ribonucleic acid in archaea having regulatory and catalytic roles as well as involvement in protein synthesis.
An element that is a member of the chalcogen family. It has an atomic symbol S, atomic number 16, and atomic weight [32.059; 32.076]. It is found in the amino acids cysteine and methionine.
A genus of gram-negative, straight or curved rods which are motile by means of a single, polar flagellum. Members of this genus are found in coastal waters and the open ocean. (From Bergey's Manual of Determinative Bacteriology, 9th ed)
Software application for retrieving, presenting and traversing information resources on the World Wide Web.
A loose confederation of computer communication networks around the world. The networks that make up the Internet are connected through several backbone networks. The Internet grew out of the US Government ARPAnet project and was designed to facilitate information exchange.
The portion of an interactive computer program that issues messages to and receives commands from a user.
Scattering of a beam of electromagnetic or acoustic RADIATION, or particles, at small angles by particles or cavities whose dimensions are many times as large as the wavelength of the radiation or the de Broglie wavelength of the scattered particles. Also know as low angle scattering. (McGraw-Hill Dictionary of Scientific and Technical Terms, 6th ed) Small angle scattering (SAS) techniques, small angle neutron (SANS), X-ray (SAXS), and light (SALS, or just LS) scattering, are used to characterize objects on a nanoscale.
Models used experimentally or theoretically to study molecular shape, electronic properties, or interactions; includes analogous molecules, computer-generated graphics, and mechanical structures.
The study of crystal structure using X-RAY DIFFRACTION techniques. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
Habitat of hot water naturally heated by underlying geologic processes. Surface hot springs have been used for BALNEOLOGY. Underwater hot springs are called HYDROTHERMAL VENTS.
A genus of gram-negative rod-shaped bacteria in the class GAMMAPROTEOBACTERIA. They are obligately acidophilic and aerobic, using reduced SULFUR COMPOUNDS to support AUTOTROPHIC GROWTH.
A species of aerobic, chemolithotrophic ARCHAEA consisting of coccoid cells that utilize sulfur as an energy source. The optimum temperature for growth is 70-75 degrees C. They are isolated from acidic fields.
One of the three domains of life (the others being BACTERIA and Eukarya), formerly called Archaebacteria under the taxon Bacteria, but now considered separate and distinct. They are characterized by: (1) the presence of characteristic tRNAs and ribosomal RNAs; (2) the absence of peptidoglycan cell walls; (3) the presence of ether-linked lipids built from branched-chain subunits; and (4) their occurrence in unusual habitats. While archaea resemble bacteria in morphology and genomic organization, they resemble eukarya in their method of genomic replication. The domain contains at least four kingdoms: CRENARCHAEOTA; EURYARCHAEOTA; NANOARCHAEOTA; and KORARCHAEOTA.
An order of extremely halophilic archaea, in the kingdom EURYARCHAEOTA. They occur ubiquitously in nature where the salt concentration is high, and are chemoorganotrophic, using amino acids or carbohydrates as a carbon source.
A benign tumor, usually found in the anterior lobe of the pituitary gland, whose cells stain with acid dyes. Such pituitary tumors may give rise to excessive secretion of growth hormone, resulting in gigantism or acromegaly. A specific type of acidophil adenoma may give rise to nonpuerperal galactorrhea. (Dorland, 27th ed)
A genus of gram-negative, aerobic bacteria in the family MORAXELLACEAE, associated with processed MEAT; FISH PRODUCTS; and POULTRY PRODUCTS.
An absence of warmth or heat or a temperature notably below an accustomed norm.
Usually a hydroxide of lithium, sodium, potassium, rubidium or cesium, but also the carbonates of these metals, ammonia, and the amines. (Grant & Hackh's Chemical Dictionary, 5th ed)
The state of weariness following a period of exertion, mental or physical, characterized by a decreased capacity for work and reduced efficiency to respond to stimuli.
Databases containing information about PROTEINS such as AMINO ACID SEQUENCE; PROTEIN CONFORMATION; and other properties.
A process that includes the determination of AMINO ACID SEQUENCE of a protein (or peptide, oligopeptide or peptide fragment) and the information analysis of the sequence.
The procedures involved in combining separately developed modules, components, or subsystems so that they work together as a complete system. (From McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
Linear POLYPEPTIDES that are synthesized on RIBOSOMES and may be further modified, crosslinked, cleaved, or assembled into complex proteins with several subunits. The specific sequence of AMINO ACIDS determines the shape the polypeptide will take, during PROTEIN FOLDING, and the function of the protein.
Chemical groups containing the covalent sulfur bonds -S-. The sulfur atom can be bound to inorganic or organic moieties.
A species of gram-negative bacteria of the family ACETOBACTERACEAE found in FLOWERS and FRUIT. Cells are ellipsoidal to rod-shaped and straight or slightly curved.
A tree of the family Sterculiaceae (or Byttneriaceae), usually Theobroma cacao, or its seeds, which after fermentation and roasting, yield cocoa and chocolate.
Discarded electronic devices containing valuable and sometimes hazardous materials such as LEAD, NICKEL, CADMIUM, and MERCURY. (from http://www.epa.gov/osw/conserve/materials/ecycling/faq.htm#impact accessed 4/25/2010)
A species of gram-positive, rod-shaped bacteria associated with DENTAL CARIES.
A photographic fixative used also in the manufacture of resins. According to the Fourth Annual Report on Carcinogens (NTP 85-002, 1985), this substance may reasonably be anticipated to be a carcinogen (Merck Index, 9th ed). Many of its derivatives are ANTITHYROID AGENTS and/or FREE RADICAL SCAVENGERS.
A pyrrolo-quinoline having two adjacent keto-groups at the 4 and 5 positions and three acidic carboxyl groups. It is a coenzyme of some DEHYDROGENASES.
A species of thermoacidophilic ARCHAEA in the family Sulfolobaceae, found in volcanic areas where the temperature is about 80 degrees C and SULFUR is present.
A genus of aerobic, chemolithotrophic, coccoid ARCHAEA whose organisms are thermoacidophilic. Its cells are highly irregular in shape, often lobed, but occasionally spherical. It has worldwide distribution with organisms isolated from hot acidic soils and water. Sulfur is used as an energy source.
A procedure consisting of a sequence of algebraic formulas and/or logical steps to calculate or determine a given task.
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
Proteins that are involved in the peptide chain termination reaction (PEPTIDE CHAIN TERMINATION, TRANSLATIONAL) on RIBOSOMES. They include codon-specific class-I release factors, which recognize stop signals (TERMINATOR CODON) in the MESSENGER RNA; and codon-nonspecific class-II release factors.
The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.
A large group of bacteria including those which oxidize ammonia or nitrite, metabolize sulfur and sulfur compounds, or deposit iron and/or manganese oxides.
Inorganic or organic compounds that contain sulfur as an integral part of the molecule.
Hot springs on the ocean floor. They are commonly found near volcanically active places such as mid-oceanic ridges.
A phylum of gram-negative bacteria containing seven class-level groups from a wide variety of environments. Most members are chemoheterotrophs.
A group of proteobacteria consisting of chemoorganotrophs usually associated with the DIGESTIVE SYSTEM of humans and animals.
A group of the proteobacteria comprised of facultatively anaerobic and fermentative gram-negative bacteria.
An island in the Lesser Antilles, one of the Windward Islands. Its capital is Fort-de-France. It was discovered by Columbus in 1502 and from its settlement in 1635 by the French it passed into and out of Dutch and British hands. It was made a French overseas department in 1946. One account of the name tells of native women on the shore calling "Madinina" as Columbus approached the island. The meaning was never discovered but was entered on early charts as Martinique, influenced by the name of St. Martin. (From Webster's New Geographical Dictionary, 1988, p734 & Room, Brewer's Dictionary of Names, 1992, p339)
Widely scattered islands in the Atlantic Ocean as far north as the AZORES and as far south as the South Sandwich Islands, with the greatest concentration found in the CARIBBEAN REGION. They include Annobon Island, Ascension, Canary Islands, Falkland Islands, Fernando Po (also called Isla de Bioko and Bioko), Gough Island, Madeira, Sao Tome and Principe, Saint Helena, and Tristan da Cunha.
A condition in which closely related persons, usually in the same family, share the same delusions.
Heat- and storage-labile plasma glycoprotein which accelerates the conversion of prothrombin to thrombin in blood coagulation. Factor V accomplishes this by forming a complex with factor Xa, phospholipid, and calcium (prothrombinase complex). Deficiency of factor V leads to Owren's disease.
A plasma protein that is the inactive precursor of thrombin. It is converted to thrombin by a prothrombin activator complex consisting of factor Xa, factor V, phospholipid, and calcium ions. Deficiency of prothrombin leads to hypoprothrombinemia.
Cylindrical epithelial cells in the innermost layer of the ENAMEL ORGAN. Their functions include contribution to the development of the dentinoenamel junction by the deposition of a layer of the matrix, thus producing the foundation for the prisms (the structural units of the DENTAL ENAMEL), and production of the matrix for the enamel prisms and interprismatic substance. (From Jablonski's Dictionary of Dentistry, 1992)

Membrane-bound hydrogenase and sulfur reductase of the hyperthermophilic and acidophilic archaeon Acidianus ambivalens. (1/31)

A sulfur reductase (SR) and a hydrogenase were purified from solubilized membrane fractions of anaerobically grown cells of the sulfur-dependent archaeon Acidianus ambivalens and the corresponding genes were sequenced. The SR reduced elemental sulfur with hydrogen as electron donor [45 U (mg protein)(-1)] in the presence of hydrogenase and either 2,3-dimethylnaphthoquinone (DMN) or cytochrome c in the enzyme assay. The SR could not be separated from the hydrogenase during purification without loss of activity, whereas the hydrogenase could be separated from the SR. The specific activity of the hydrogenase was 170 U (mg protein)(-1) with methyl viologen and 833 U (mg protein)(-1) with DMN as electron acceptors. Both holoenzymes showed molecular masses of 250 kDa. In SDS gels of active fractions, protein bands with apparent masses of 110 (SreA), 66 (HynL), 41 (HynS) and 29 kDa were present. Enriched hydrogenase fractions contained 14 micro mol Fe and 2 micromol Ni (g protein)(-1); in addition, 2.5 micromol Mo (g protein)(-1) was found in the membrane fraction. Two overlapping genomic cosmid clones were sequenced, encoding a five-gene SR cluster (sre) including the 110 kDa subunit gene (sreA), and a 12-gene hydrogenase cluster (hyn) including the large and small subunit genes and genes encoding proteins required for the maturation of NiFe hydrogenases. A phylogenetic analysis of the SR amino acid sequence revealed that the protein belonged to the DMSO reductase family of molybdoenzymes and that the family showed a novel clustering. A model of sulfur respiration in Acidianus developed from the biochemical results and the data of the amino acid sequence comparisons is discussed.  (+info)

AFV1, a novel virus infecting hyperthermophilic archaea of the genus acidianus. (2/31)

We describe a novel virus, AFV1, of the hyperthermophilic archaeal genus Acidianus. Filamentous virions are covered with a lipid envelope and contain at least five different proteins with molecular masses in the range of 23-130 kDa and a 20.8-kb-long linear double-stranded DNA. The virus has been assigned to the family Lipothrixviridae on the basis of morphotypic characteristics. Host range is confined to several strains of Acidianus and the virus persists in its hosts in a stable carrier state. The latent period of virus infection is about 4 h. Viral DNA was sequenced and sequence similarities were found to the lipothrixvirus SIFV, the rudiviruses SIRV1 and SIRV2, as well as to conjugative plasmids and chromosomes of the genus Sulfolobus. Exceptionally for the linear genomes of archaeal viruses, many short direct repeats, with the sequence TTGTT or close variants thereof, are closely clustered over 300 bp at each end of the genome. They are reminiscent of the telomeric ends of linear eukaryal chromosomes.  (+info)

The sulphur oxygenase reductase from Acidianus ambivalens is a multimeric protein containing a low-potential mononuclear non-haem iron centre. (3/31)

The SOR (sulphur oxygenase reductase) is the initial enzyme in the sulphur-oxidation pathway of Acidianus ambivalens. Expression of the sor gene in Escherichia coli resulted in active, soluble SOR and in inclusion bodies from which active SOR could be refolded as long as ferric ions were present in the refolding solution. Wild-type, recombinant and refolded SOR possessed indistinguishable properties. Conformational stability studies showed that the apparent unfolding free energy in water is approx. 5 kcal x mol(-1) (1 kcal=4.184 kJ), at pH 7. The analysis of the quaternary structures showed a ball-shaped assembly with a central hollow core probably consisting of 24 subunits in a 432 symmetry. The subunits form homodimers as the building blocks of the holoenzyme. Iron was found in the wild-type enzyme at a stoichiometry of one iron atom/subunit. EPR spectroscopy of the colourless SOR resulted in a single isotropic signal at g=4.3, characteristic of high-spin ferric iron. The signal disappeared upon reduction with dithionite or incubation with sulphur at elevated temperature. Thus both EPR and chemical analysis indicate the presence of a mononuclear iron centre, which has a reduction potential of -268 mV at pH 6.5. Protein database inspection identified four SOR protein homologues, but no other significant similarities. The spectroscopic data and the sequence comparison led to the proposal that the Acidianus ambivalens SOR typifies a new type of non-haem iron enzyme containing a mononuclear iron centre co-ordinated by carboxylate and/or histidine ligands.  (+info)

Active site structure of the aa3 quinol oxidase of Acidianus ambivalens. (4/31)

The membrane bound aa(3)-type quinol:oxygen oxidoreductase from the hyperthermophilic archaeon, Acidianus ambivalens, which thrives at a pH of 2.5 and a temperature of 80 degrees C, has several unique structural and functional features as compared to the other members of the heme-copper oxygen reductase superfamily, but shares the common redox-coupled, proton-pumping function. To better understand the properties of the heme a(3)-Cu(B) catalytic site, a resonance Raman spectroscopic study of the enzyme under a variety of conditions and in the presence of various ligands was carried out. Assignments of several heme vibrational modes as well as iron-ligand stretching modes are made to serve as a basis for comparing the structure of the enzyme to that of other oxygen reductases. The CO-bound oxidase has conformations that are similar to those of other oxygen reductases. However, the addition of CO to the resting enzyme does not generate a mixed valence species as in the bovine aa(3) enzyme. The cyanide complex of the oxidized enzyme of A. ambivalens does not display the high stability of its bovine counterpart, and a redox titration demonstrates that there is an extensive heme-heme interaction reflected in the midpoint potentials of the cyanide adduct. The A. ambivalens oxygen reductase is very stable under acidic conditions, but it undergoes an earlier alkaline transition than the bovine enzyme. The A. ambivalens enzyme exhibits a redox-linked reversible conformational transition in the heme a(3)-Cu(B) center. The pH dependence and H/D exchange demonstrate that the conformational transition is associated with proton movements involving a group or groups with a pK(a) of approximately 3.8. The observed reversibility and involvement of protons in the redox-coupled conformational transition support the proton translocation model presented earlier. The implications of such conformational changes are discussed in relation to general redox-coupled proton pumping mechanisms in the heme-copper oxygen reductases.  (+info)

Theoretical identification of proton channels in the quinol oxidase aa3 from Acidianus ambivalens. (5/31)

Heme-copper oxidases are membrane proteins found in the respiratory chain of aerobic organisms. They are the terminal electron acceptors coupling the translocation of protons across the membrane with the reduction of oxygen to water. Because the catalytic process occurs in the heme cofactors positioned well inside the protein matrix, proton channels must exist. However, due to the high structural divergence among this kind of proteins, the proton channels previously described are not necessarily conserved. In this work we modeled the structure of the quinol oxidase from Acidianus ambivalens using comparative modeling techniques for identifying proton channels. Additionally, given the high importance that water molecules may have in this process, we have developed a methodology, within the context of comparative modeling, to identify high water probability zones and to deconvolute them into chains of ordered water molecules. From our results, and from the existent information from other proteins from the same superfamily, we were able to suggest three possible proton channels: one K-, one D-, and one Q-spatial homologous proton channels. This methodology can be applied to other systems where water molecules are important for their biological function.  (+info)

Key role of cysteine residues in catalysis and subcellular localization of sulfur oxygenase-reductase of Acidianus tengchongensis. (6/31)

Analysis of known sulfur oxygenase-reductases (SORs) and the SOR-like sequences identified from public databases indicated that they all possess three cysteine residues within two conserved motifs (V-G-P-K-V-C(31) and C(101)-X-X-C(104); numbering according to the Acidianus tengchongensis numbering system). The thio-modifying reagent N-ethylmaleimide and Zn(2+) strongly inhibited the activities of the SORs of A. tengchongensis, suggesting that cysteine residues are important. Site-directed mutagenesis was used to construct four mutant SORs with cysteines replaced by serine or alanine. The purified mutant proteins were investigated in parallel with the wild-type SOR. Replacement of any cysteine reduced SOR activity by 98.4 to 100%, indicating that all the cysteine residues are crucial to SOR activities. Circular-dichroism and fluorescence spectrum analyses revealed that the wild-type and mutant SORs have similar structures and that none of them form any disulfide bond. Thus, it is proposed that three cysteine residues, C(31) and C(101)-X-X-C(104), in the conserved domains constitute the putative binding and catalytic sites of SOR. Furthermore, enzymatic activity assays of the subcellular fractions and immune electron microscopy indicated that SOR is not only present in the cytoplasm but also associated with the cytoplasmic membrane of A. tengchongensis. The membrane-associated SOR activity was colocalized with the activities of sulfite:acceptor oxidoreductase and thiosulfate:acceptor oxidoreductase. We tentatively propose that these enzymes are located in close proximity on the membrane to catalyze sulfur oxidation in A. tengchongensis.  (+info)

The sulfur oxygenase reductase from Acidianus ambivalens is an icosatetramer as shown by crystallization and Patterson analysis. (7/31)

The sulfur oxygenase reductase (SOR) is the initial enzyme in the aerobic sulfur metabolism of the thermoacidophilic and chemolithoautotrophic crenarchaeote Acidianus ambivalens. Single colorless polyhedral crystals were obtained under two crystallization conditions from SOR preparations heterologously overproduced in Escherichia coli. They belonged to space-group I4 and diffraction data were collected up to 1.7 A resolution. Their Patterson symmetry shows additional 4-, 3- and 2-fold non-crystallographic symmetry rotation axes, characteristic of the point group 432. Taking into account the molecular mass of SOR, the crystal unit cell volume, the non-crystallographic symmetry operators and previous electron microscopy studies of the SOR, it was deduced that the quaternary structure of the functionally active enzyme is an icosatetramer with 871 kDa molecular mass.  (+info)

A Rieske ferredoxin typifying a subtype within Rieske proteins: spectroscopic, biochemical and stability studies. (8/31)

A new subtype of archaeal Rieske ferredoxin (RFd) has been identified in the genome of the thermoacidophilic archaeon Acidianus ambivalens. The gene is inserted in an atypical genomic context in a gene cluster encoding a NiFe hydrogenase. Sequence and phyletic analysis showed that the protein is related to bacterial RFd but not to any of the known archaeal Rieske proteins. The recombinant 14 kDa protein isolated from Escherichia coli behaved as a dimer in solution. It contained approximately 2 Fe/mol and all visible and EPR spectroscopic features typical of Rieske centre-containing proteins. However, its redox potential (+170 mV) was significantly higher than those of canonical RFd. This difference is rationalized in terms of the protein structure environment, as discrete amino acid substitutions in key positions around the metal centre account for the higher potential.  (+info)

Betalipothrixvirus is a genus of viruses in the order Ligamenvirales, in the family Lipothrixviridae. Archaea serve as natural hosts. There are currently six species in this genus including the type species Sulfolobus islandicus filamentous virus. Group: dsDNA Order: Ligamenvirales Family: Lipothrixviridae Genus: Betalipothrixvirus Acidianus filamentous virus 3 Acidianus filamentous virus 6 Acidianus filamentous virus 7 Acidianus filamentous virus 8 Acidianus filamentous virus 9 Sulfolobus islandicus filamentous virus Viruses in Betalipothrixvirus are enveloped, with rod-shaped geometries. The diameter is around 24 nm, with a length of 2000 nm. Genomes are linear, around 40.5kb in length. The genome has 67 open reading frames. Viral replication is cytoplasmic. Entry into the host cell is achieved by adsorption into the host cell. Dna templated transcription is the method of transcription. Archaea serve as the natural host. Transmission routes are passive diffusion. Viral Zone. ExPASy. ...
Acidianus two-tailed virus (ATV) infects crenarchaea of the genus Acidianus living in terrestrial thermal springs at extremely high temperatures and low pH. ATV is a member of the Bicaudaviridae virus family and undergoes extra-cellular development of two tails, a process that is unique in the viral world. To understand this intriguing phenomenon, we have undertaken structural studies of ATV virion proteins and here we present the crystal structure of one of these proteins, ATV. ATV forms tetramers in solution and a molecular envelope is provided for the tetramer, computed from small-angle X-ray scattering (SAXS) data. The crystal structure has properties typical of hyperthermostable proteins, including a relatively high number of salt bridges. However, the protein also exhibits flexible loops and surface pockets. Remarkably, ATV displays a new protein fold, consistent with the absence of homologues of this protein in public sequence databases.
This is a list of biological viruses. See also Comparison of computer viruses Excluded are other ranks of virus, viroids and prions. Also excluded are more recently discovered viruses such as Bourbon Virus, common names and obsolete names for viruses. For a list of virus genera, see List of genera of viruses. For a list of virus families and subfamilies, see List of virus families and subfamilies. For a taxonomic list, see Taxonomic list of viruses. Contents Top 0-9 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z Abaca bunchy top virus Abutilon golden mosaic virus Abutilon mosaic Bolivia virus Abutilon mosaic Brazil virus Abutilon mosaic virus Abutilon yellows virus Acanthamoeba polyphaga mimivirus Acanthocystis turfacea chlorella virus 1 Acara orthobunyavirus Acerodon celebensis polyomavirus 1 Acerodon celebensis polyomavirus 2 Acholeplasma virus L2 Acholeplasma virus MV-L51 Acidianus bottle-shaped virus Acidianus filamentous virus 1 Acidianus filamentous virus 2 Acidianus filamentous virus ...
Gudbergsdóttir, S. R., Menzel, P., Krogh, A., Young, M. & Peng, X. (2016). Novel viral genomes identified from six metagenomes reveal wide distribution of archaeal viruses and high viral diversity in terrestrial hot springs. Environ Microbiol 18, 863-874. [PubMed]. Häring, M., Rachel, R., Peng, X., Garrett, R. A. & Prangishvili, D. (2005). Viral diversity in hot springs of Pozzuoli, Italy, and characterization of a unique archaeal virus, Acidianus bottle-shaped virus, from a new family, the Ampullaviridae. J Virol 79, 9904-9911. [PubMed]. Krupovic, M., Cvirkaite-Krupovic, V., Iranzo, J., Prangishvili, D. & Koonin, E. V. (2018). Viruses of archaea: Structural, functional, environmental and evolutionary genomics. Virus Res 244, 181-193. [PubMed]. Peng, X., Basta, T., Häring, M., Garrett, R. A. & Prangishvili, D. (2007). Genome of the Acidianus bottle-shaped virus and insights into the replication and packaging mechanisms. Virology 364, 237-243. [PubMed]. Prangishvili, D. (2015). Archaeal ...
Several archaeal species from the order Sulfolobales are interesting from the biotechnological point of view due to their biomining capacities. Within this group, the genus Acidianus contains four biomining species (from ten known Acidianus species), but none of these have their genome sequenced. To get insights into the genetic potential and metabolic pathways involved in the biomining activity of this group, we sequenced the genome of Acidianus copahuensis ALE1 strain, a novel thermoacidophilic crenarchaeon (optimum growth: 75 °C, pH 3) isolated from the volcanic geothermal area of Copahue at Neuquén province in Argentina. Previous experimental characterization of A. copahuensis revealed a high biomining potential, exhibited as high oxidation activity of sulfur and sulfur compounds, ferrous iron and sulfide minerals (e.g.: pyrite). This strain is also autotrophic and tolerant to heavy metals, thus, it can grow under adverse conditions for most forms of life with a low nutrient demand, conditions
Electron microscopic studies of the viruses in two hot springs (85 degrees C, pH 1.5-2.0, and 75-93 degrees C, pH 6.5) in Yellowstone National Park revealed particles with twelve different morphotypes. This diversity encompassed known viruses of hyperthermophilic archaea, filamentous Lipothrixviridae, rod-shaped Rudiviridae, and spindle-shaped Fuselloviridae, and novel morphotypes previously not observed in nature. Two virus types resembled head-and-tail bacteriophages from the families Siphoviridae and Podoviridae, and constituted the first observation of these viruses in a hydrothermal environment. Viral hosts in the acidic spring were members of the hyperthermophilic archaeal genus Acidianus. ...
1J8M: The crystal structure of the conserved GTPase of SRP54 from the archaeon Acidianus ambivalens and its comparison with related structures suggests a model for the SRP-SRP receptor complex.
Our website has detected that you are using an outdated insecure browser that will prevent you from using the site. We suggest you upgrade to a modern browser. ...
0064]As described above, the inner diameter at the reduced diameter section 15 is somewhat smaller than an outer diameter (x) of the bead ring 6 immediately after the completion of the heating step, and is (x-0.1) mm to (x-0.4) mm. If the inner diameter of the reduced diameter section 15 is larger than (x-0.1) mm (for example, (x-0.05) mm), the inner diameter of the reduced diameter section 15 does not show a significant difference from the outer diameter of the bead ring 6, so that the latter would not be squeezed satisfactorily. If, the inner diameter of the reduced diameter section 15 is smaller than (x-0.4) mm (for example, (x-0.5) mm), the reduced diameter section 15 would crush the bead ring 6 to deform the bead ring 6. Since the tapered section 16 is outwardly expanding toward the lower end of the cylinder 14, the threads 8 and the bead ring 6 do not contact with the lower end of the cylinder 14 to deform neither the threads 8 nor the bead ring 6, when the cylinder 14 is engaged with the ...
The main aim of this study was determination of thermo- radio- and photostability ofperindopril tert-butyloamine (PER) therefore the efficiency and safety of the therapy could bemaintained.A chromatographic method (RP-HPLC) had been validated before use to determinePER loss. The evaluation of stability properties of PER in solid state under the influence ofisothermal condition, relative humidity - RH = 0% and 76.4%, exposure to 6 mln lux h andionizing radiation generated by beam of electrons of 25-400 kGy was investigated.Studies pointed out that presence of moisture changes a kinetic model of PER degradation;lack of moisture in the air generates a first-order kinetic model of the reaction, increasehumidity generates the autocatalytic model. PER proved to be resistant for ionizing radiation. Itis possible to use radiation sterilization and decontamination (dose 25 kGy) with no significantloss of content. Investigation of PER photostability proved, that after exposure to 6 mln lux hphysicochemical
url=http://longchampsoldesa.webs.com/]sacs longchamp[/url] Most women make blunder of buying a handbag which is larger than their body The latest and best Mulberry Outlet Medium Alexa Leather Satchel Blue Bag sale unique size, which could have an unfavorable consequence on their overall prospects when they go to show the new purchase. Women should select a bottle-shaped purse or a backpack that is not awfully bulky. However, if you have a Betty Boop Handbags model similar to the figure, large and thin, you should go for round or square-shaped handbags... Buy from an online abundance that offers a defended transaction and supply method. A lot of of these shops acquire specific bureau of online transaction methods such. The bazaar buyer gucci continental should aswell agreement safe and defended shipping. Its gross profit margins exceed 67%, vs. 54% five years ago. And Coach stores have incredibly high [annual] sales per square foot, roughly $865, compared with a traditional retailer like the ...
url=http://longchampsoldesa.webs.com/]sacs longchamp[/url] Most women make blunder of buying a handbag which is larger than their body The latest and best Mulberry Outlet Medium Alexa Leather Satchel Blue Bag sale unique size, which could have an unfavorable consequence on their overall prospects when they go to show the new purchase. Women should select a bottle-shaped purse or a backpack that is not awfully bulky. However, if you have a Betty Boop Handbags model similar to the figure, large and thin, you should go for round or square-shaped handbags... Buy from an online abundance that offers a defended transaction and supply method. A lot of of these shops acquire specific bureau of online transaction methods such. The bazaar buyer gucci continental should aswell agreement safe and defended shipping. Its gross profit margins exceed 67%, vs. 54% five years ago. And Coach stores have incredibly high [annual] sales per square foot, roughly $865, compared with a traditional retailer like the ...
Identification of plasmid pTC1 from Sulfolobus tengchongensis RT8-4. (a) Restriction digestion of the total DNA from S. tengchongensis RT8-4 containing pTC1. Th
Need a Hotel near Lago dAverno? We offer the CLOSEST Hotels with 24/7 Social Support. Find a Lower Price? Well Refund the Difference!
Close The Infona portal uses cookies, i.e. strings of text saved by a browser on the users device. The portal can access those files and use them to remember the users data, such as their chosen settings (screen view, interface language, etc.), or their login data. By using the Infona portal the user accepts automatic saving and using this information for portal operation purposes. More information on the subject can be found in the Privacy Policy and Terms of Service. By closing this window the user confirms that they have read the information on cookie usage, and they accept the privacy policy and the way cookies are used by the portal. You can change the cookie settings in your browser. ...
This page details the development and operational history of the Alvis FV4333 Stormer Armored Personnel Carrier (APC) / Multirole Armored Fighting Vehicle (AFV) including technical specifications and pictures.
Spin crossover (SCO) complexes form a large group of thermo-, photo-, magneto-, piezo- and chemo-switchable compounds. Recent...
T01090 (acav,adh,amin,apom,arn,asoc,ato,balt,bara,bko,camg,cmb,def,fln,gli,gtm,lagl,les,mbov,mee,ntp,ntt,parb,part,pcx,pht,ppoa,ptu,rhu,sbj,sgv,smal,sscu,sya,tpaf,trl : calculation not yet completed ...
In the previous post we learnt about one-tailed tests. What about two-tailed tests? In this case we split the total alpha error equally, so that half the alpha error falls to the left, and the other half falls to the right of the midline (mean). What does this imply? It implies that we feel the…
A virus isolate causing mosaic disease of commercial sugarcane was purified to homogeneity. Electron microscopy revealed flexuous filamentous virus particles of ca 890*15 nm. The virus isolate reacted positively with heterologous antiserum to narcissus latent virus form UK, but failed to react with potyvirus group specific antiserum. N-terminal sequencing of the intact coat protein (CP) and the tryptic peptides indicated that the virus was probably a potyvirus but distinct from several reported potyviruses. Comparison of the 30-terminal 1084 nucleotide sequence of the RNA genome of this virus revealed 93.6% sequence identity in the coat protein coding region with the recently described sugarcane streak mosaic virus (Pakistani isolate). The molecular weight of the coat protein (40 kDa) was higher than that deduced from the amino acid sequence (34 kDa). The apparent increase in size was shown to be due to glycosylation of the coat protein which has not been reported thus far in the family, ...
Many biopolymers share the properties of being only slightly flexible and having a high negative surface charge. These general properties of the single filaments have many implications for the structure and mechanical properties of the macroscopic networks they form in physiologic settings. Two biochemically distinct polymers, F-actin and the filamentous viruses fD, M13, and
Lipid rafts are hypothesized to facilitate protein interaction, tension regulation, and trafficking in biological membranes, but the mechanisms responsible for their formation and maintenance are not clear. Recently, experiments showed that bidisperse mixtures of filamentous viruses can self-assemble into colloidal monolayers with thermodynamically stable rafts that exhibit chiral structure and repulsive interactions. We quantitatively explain these observations by modeling the membrane particles as chiral liquid crystals. Chiral twist promotes the formation of finite-sized rafts by decreasing the effective interfacial tension between rafts and background membrane. It also mediates a repulsion that distributes rafts evenly throughout the membrane. Although this system is composed of filamentous viruses whose aggregation is entropically driven by dextran depletants instead of phospholipids and cholesterol with prominent electrostatic interactions, colloidal and biological membranes share many of ...
Acetobacter ghanensis Cleenwerck et al. 2007, sp. nov. (Part 7) Acetobacter senegalensis Ndoye et al. 2007, sp. nov. (Part 7) Acidaminococcus Rogosa 1969 emend. Jumas-Bilak et al. 2007. (Part 10) Acidaminococcus intestini Jumas-Bilak et al. 2007, sp. nov. (Part 10) Acidianus Segerer et al. 1986 emend. Plumb et al. 2007. (Part 7) Acidianus sulfidivorans Plumb et al. 2007, sp. nov. (Part 7) Actinobacillus capsulatus Arseculeratne 1962 (Approved Lists 1980) emend. Kuhnert et al. 2007. (Part 3) Actinocatenispora sera Matsumoto et al. 2007, sp. nov. (Part 11) Actinocorallia aurea Tamura et al. 2007, sp. nov. (Part 9) Actinomadura alba Wang et al. 2007, sp. nov. (Part 8) Actinomadura rudentiformis Le Roes and Meyers 2007, sp. nov. (Part 1) Actinoplanes couchii Kämpfer et al. 2007, sp. nov. (Part 4) Actinotalea Yi et al. 2007, gen. nov. (Part 1) Actinotalea fermentans (Bagnara et al. 1985) Yi et al. 2007, comb. nov. - Basonym: Cellulomonas fermentans Bagnara et al. 1985. (Part 1) Aerococcus suis Vela ...
ID K4L035_9FIRM Unreviewed; 324 AA. AC K4L035; DT 09-JAN-2013, integrated into UniProtKB/TrEMBL. DT 09-JAN-2013, sequence version 1. DT 25-OCT-2017, entry version 32. DE SubName: Full=Chromosomal replication initiator protein DnaA {ECO:0000313,EMBL:AFV04880.1}; GN Name=dnaA {ECO:0000313,EMBL:AFV04880.1}; GN ORFNames=DCF50_p873 {ECO:0000313,EMBL:AFV04880.1}; OS Dehalobacter sp. CF. OC Bacteria; Firmicutes; Clostridia; Clostridiales; Peptococcaceae; OC Dehalobacter. OX NCBI_TaxID=1131462 {ECO:0000313,EMBL:AFV04880.1, ECO:0000313,Proteomes:UP000000482}; RN [1] {ECO:0000313,EMBL:AFV04880.1, ECO:0000313,Proteomes:UP000000482} RP NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. RC STRAIN=CF {ECO:0000313,EMBL:AFV04880.1}; RX PubMed=23284863; DOI=10.1371/journal.pone.0052038; RA Tang S., Gong Y., Edwards E.A.; RT Semi-automatic in silico gap closure enabled de novo assembly of two RT dehalobacter genomes from metagenomic data.; RL PLoS ONE 7:E52038-E52038(2012). CC -!- SIMILARITY: Belongs to the DnaA ...
R. Osellame,1 N. Chiodo,1 V. Maselli,1 A. Yin,1 M. Zavelani-Rossi,1 G. Cerullo, P. Laporta,1 L. Aiello,2 S. De Nicola,2 P. Ferraro,2 A. Finizio,2 and G. Pierattini2 1Istituto di Fotonica e Nanotecnologie del CNR - Dipartimento di Fisica del Politecnico di Milano P.zza L. da Vinci 32, 20133 Milano, Italy. 2Istituto Nazionale di Ottica Applicata - Istituto di Cibernetica del CNR E. Caianiello Via Campi Flegrei 34 80078 Pozzuoli (Napoli) ...
19-00037). Ana Neiva Pegmatite Thematic Issue (currently accepting submissions). Submission deadline: December 31, 2019 extended to January 31, 2020. Elena Sokolova Thematic Issue (currently accepting submissions). Submission deadline: May 15, 2020. FERROEFREMOVITE, (NH4)2Fe2+2(SO4)3, A NEW MINERAL FROM SOLFATARA DI POZZUOLI, CAMPANIA, ...
GPE5 Home | GPE5 Services | GPE5 Download | GPE5 Publications 2011 K. Holladay, J.M. Sharp, and M. Janssens, Automatic Pyrolysis Mass Loss Modeling from Thermo- Gravimetric Analysis Data Using Genetic Programming, presented at ACM Genetic and Evolutionary Computation Conference, Dublin, Ireland, July 2011
With the practical 3 piece Temeo Hygro Indicator Set Thermo-/Hygrometer you have now the control over the room climate in all the rooms you spend most of your time in (e.g. living room, sleeping room and childrens room). ...
Read Characterization of a filamentous virus from Bermuda grass and its molecular, serological and biological comparison with Spartina mottle virus, Archives of Virology on DeepDyve, the largest online rental service for scholarly research with thousands of academic publications available at your fingertips.
Potexviruses and carlaviruses are plant‐infectingviruses belonging to the family Aphaflexiviridae and Betaflexiviridae, respectively
Smart polymers represent a new class of advanced materials with a wide range of applications. The stimuli responsive polymers respond to external stimuli, such as heat or light, by a change of physical properties. The self-healing polymers belong to the most promising applications of a smart behavior. They are stimuli responsive and possess the ability to self-heal when damaged. The project involves the synthesis and characterization of the novel smart polymers with enhanced mechanical properties. The thermo- or photo sensitive systems and self-healing materials will be studied and reinforced by application of polymer nanocomposites. The sensitive unit is presented by physical supramolecular structures or by reversible covalent bonds containing moieties. The project will be focused on (i) study and understanding of the response mechanism to the thermo- and photo-stimuli in smart polymer nanocomposites, and on (ii) thermo- and photo induced self-healing of materials with a high mechanical ...
Mycoplasmas are the smallest self-replicating prokaryotes. They are devoid of cell walls, with the plasticity of their outer membrane favouring pleomorphism, although some have a characteristic bottle-shaped appearance. Mycoplasmas recovered from humans belong to the genera Mycoplasma (14 species) and Ureaplasma (2 species). They are predominantly found in the respiratory and genital tracts, but sometimes invade the bloodstream and thus gain access to joints and other organs.... ...
Atherosclerosis of aorta abdominal region arises among the first complications of increased cholesterol level in an organism. Danger of disease is that at initial stages it is practically not distinguished, complaints of the patient are absent. When the state worsens there is an abdominal pain of various intensity that depends on the volume of vessels lesion. There is a feeling of gravity and dyspepsia: appetite loss, excessive flatulency, weight loss.. Development of abdominal aorta atherosclerosis leads to more terrible complications. The most dangerous is aneurysm. This is a uniform bottle-shaped expansion of whole vessel with a thinning of its walls or local protruding aorta wall.. Such patients have nagging pains in stomach; they are localized in the left half of stomach or near umbilicus, sometimes in loin, seldom inguinal area. Pains begin from attack-like usually right after meal, then in two-three hours stop without assistance.. Feeling of pulsation in stomach is a one more diagnostic ...
by Mike Arnold. Conflicting Opinions. Beginning in the mid-1990s, the issue of stomach distension became an area of criticism among traditionalists, with many in the bodybuilding community voicing disapproval over its presence within the upper echelons of the sport. Ever since then various events have continued to transpire, thrusting the issue back into the spotlight and each time, speculation regarding the reasons for its appearance has run rampant. Most recently, it was Arnold Schwarzenegger who, during an interview with Bob Chicerillo at the annual Arnold Classic, decided to voice his displeasure over the problem. Referring to modern physiques as bottle-shaped and ridiculing head judge Jim Manion for his complacency in allowing the sport to depart from traditional aesthetic standards, Arnolds words were heard loud and clear all around the world. Within one day of his comments making headlines, we started seeing threads pop up all over the place, asking why todays bodybuilders dont have ...
The Bacillus cereus Group consists of closely-related bacteria, including pathogenic or harmless strains, and whose species can be positioned along the seven phylogenetic groups of Guinebretière et al. (I-VII). They exhibit different growth-temperature ranges, through thermotolerant to psychrotolerant thermotypes. Among these, B. cytotoxicus is an atypical thermotolerant and food-poisoning agent affiliated to group VII whose thermotolerance contrasts with the mesophilic and psychrotolerant thermotypes associated to the remaining groups I-VI. To understand the role of fatty acid (FA) composition in these variable thermotypes (i.e. growth behavior vs temperatures), we report specific features differentiating the FA pattern of B. cytotoxicus (group VII) from its counterparts (groups I-VI). The FA pattern of thermotolerant group VII (B. cytotoxicus) displayed several specific features. Most notably, we identified a high ratio of the branched-chain FAs iso-C15/iso-C13 (i15/i13) and the absence of the
In this study, the collective microbial diversity in the rumen was examined by performing a meta-analysis of all the curated 16S rRNA gene (rrn) sequences deposited in the RDP database. As of November 2010, 13478 bacterial and 3516 archaeal rrn sequences were found. The bacterial sequences were assigned to 5271 operation taxonomic units (OTUs) at species level (0.03 phylogenetic distance) representing 19 existing phyla, of which the Firmicutes (2958 OTUs), Bacteroidetes (1610 OTUs) and Proteobacteria (226 OTUs) were the most predominant. These bacterial sequences were grouped into more than 3500 OTUs at genus level (0.05 distance), but only 180 existing genera were represented. Nearly all the archaeal sequences were assigned to 943 species-level OTUs in phylum Euryarchaeota. Although clustered into 670 genus-level OTUs, only 12 existing archaeal genera were represented. Based on rarefaction analysis, the current percent coverage at species level reached 71% for bacteria and 65% for archaea. At ...
Nano-biotechnology in medical sciences renders some highly convincible outcomes in which few are only envisioned, while others are at different phases of clinical trials or already in practice. Nano-biotechnology in regenerative medicine includes utilization of nano-particles which are being designed now-a-days and envisioned research that involves usage of nano-robots to imply changes at cellular and molecular level. Recently, it is being used for drug-delivery, thermo- and laser therapy for cancer treatment. Particles are designed in such a way that they are easily being recognized by surface receptors of target cells to ensure direct treatment and least possible damage to unaffected cells. This technology is also exploited for detection of diseases in initial phases for devising an effective therapy ...
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP ...
Aaron dont worry about what your standard of modeling is. Build what you want. Experiance comes with age and practice. We all cant be number one. Some of us a better at other things. I built my MGS with BAR Armor I think 2 years ago. I found as many pics as I could on the internet and I live 15 miles from FT Knox the once great home of Armor. Hard to get close to the things. I did as best as I could , use Evergreen strip styrene. I think it came out pretty good. I put a .50 cal on the gun mantle for counter sniper operations. Hey its my model ...
afv:AFLA_018910 K01312 trypsin [EC:3.4.21.4] , (RefSeq) elastase, putative (A) MHVVPFTSLLLAIASFANAIVNGVEATKDQAPFTVGLSGTRLFCAGSLIGEKSVITAASC VKDKDATSINVRLGSLQHASGGTVIGVASIDIHPQYDADSLDNDIAFLALADSYSGATPA QLPTKQKALGYGSSVQIFGWGETSKGASFSRTLKTASVNIISRSNCQNIYGPITTITRRE FCVITKDGKGACQADQGGPVVDSAGTLVGIISRAKSCDAGNYPGVETQVDAYLDWINSKL A ...
View Vipas39/Vipas39 Gt(ROSA)26Sor/Gt(ROSA)26Sor involves: C57BL/6 * C57BL/6J * C57BL/6N: phenotypes, images, diseases, and references.
Vehicle). Results are expressed as means ± SD for the number of animals shown inside in parenthesis. Differences in experimental groups were determined by two-tailed Analysis of Variance (ANOVA ...
Në Repartin e Emergjencës të Spitalit të Përgjithshëm - Mitrovicë, për 2 ditë kanë marr trajtim mjekësor 129 pacientë.
The basic replication cycle of crenarchaeal viruses, including Fuselloviruses, has yet to be determined. There are, however, some trends which have been reported. It is thought that members of the Fuselloviridae family, as well as members of the Rudiviridae, Lipothrixviridae, and Guttaviridae families, associate with host cells by tail fibers which are present on one or both ends of the virion. Some viruses integrate their genome into the host cells chromosome, while others maintain their genomes as extrachromosomal elements. Assembly and release of most known crenarchaeal viruses, do not require cell lysis. Most crenarchaeal viruses, twith the exception of the Bicaudaviridae member ATV, appear to set up chronic infections, either continually producing virus particles or doing so in short events resulting in growth inhibition. These long-term chronic infections are thought to be an adaptation to the extremely hot and acidic environments crenarchaeal viruses inhabit. (source: Ortmann et al.) ...
showing that the chemical shifts of the ring protons moved downfield as the oxidation state increased and the substituent became more electron-withdrawing (Figure 1).Similarly, the effect on purine proton resonances of 8-fluoro substitution has … Microchim Acta 103:235-243. The discovery of hydroxyl radical (OH*) formation on pyrite surfaces (Borda et al., 2003) suggests hydroxyl radicals may affect the oxidation kinetics of intermediate sulfur species such as tetrathionate. The SoxXAYZB(CD) 2-mediated pathway of bacterial sulfur-chemolithotrophy explains the oxidation of thiosulfate, sulfide, sulfur and sulfite but not tetrathionate.Advenella kashmirensis, which oxidizes tetrathionate to sulfate, besides forming it as an intermediate during thiosulfate oxidation, possesses a soxCDYZAXOB operon. 2012) predict sulfide oxidation by Sqr, tetrathionate hydrolysis by TetH, thiosulfate oxidation by Tqo, sulfur metabolism by sulfur oxygenase reductase (Sor) and sulfite oxidation by Sat. Reduced ...
Respiratory syncytial virus (RSV) is an enveloped virus that assembles into filamentous virus particles on the surface of infected cells. Morphogenesis of RSV is dependent upon cholesterol-rich (lipid raft) membrane microdomains, but the specific role of individual raft molecules in RSV assembly is not well defined. Here we show that RSV morphogenesis occurs within caveolar membranes and that both caveolin-1 and cavin-1, the two major structural and functional components of caveolae, are actively recruited to and incorporated into the RSV envelope. The recruitment of caveolae occurred just prior to the initiation of RSV filament assembly, and was dependent upon an intact actin network as well as a direct physical interaction between caveolin-1 and the viral G protein. Moreover, cavin-1 protein levels were significantly increased in RSV-infected cells, leading to a virus-induced change in the stoichiometry and biophysical properties of the caveolar coat complex. Our data indicate that RSV ...
The comparison of pore size distributions obtained with the use of two porosimetric methods: low temperature nitrogen sorption (LN2) and positron annihilation lifetime spectroscopy (PALS), was performed for porous silica monoliths. Four investigated samples were prepared under various synthesis conditions. Nitrogen sorption showed the presence of bottle-shaped pores in all investigated samples. In addition, it seems that the presence of methanol during synthesis influences porosity to a greater extent than organic additives. Quite good agreement between the LN2 and PALS results was observed only for the silica monolith synthesized with β-cyclodextrins as pore directing agent. The biggest discrepancy in the results obtained from these two techniques was observed for the silica gel synthesized with no additives. The origin of such discrepancies, taking into account the shape of pore size distribution and deficiencies of data analysis techniques, is discussed ...
Viruses infecting the Archaea exhibit a tremendous amount of morphological and genetic diversity. This is especially true for crenarchaeal viruses from the family Fuselloviridae, which possess spindle-shaped capsids and genomes that harbor a great number of uncharacterized genes. The functions of these unidentified gene products are of interest as they have the potential to provide valuable insights into the fusellovirus infection cycle and archaeal viruses in general. In an effort to better characterize the genetic requirements of the Fuselloviridae, we have performed genetic and biochemical experiments using the best studied fusellovirus, Sulfolobus spindle-shaped virus 1 (SSV1). A comprehensive genetic analysis of SSV1 was conducted using long inverse PCR and transposon mutagenesis. The results of this work illustrate that SSV1 is highly tolerant of mutagenesis. A robust protocol for the purification of recombinant VP2 protein from E. coli was developed and should be useful for future studies aimed
An important characteristic of the acidophilic chemolithotrophs is their general tolerance of high concentrations of metallic and other ions. The levels of resistance of several acidophilic bacteria and archaea to As3+, Cu2+, Zn2+, Cd2+ and Ni+ have recently been reviewed and will not be covered here in detail [25]. As may be predicted, levels of resistance show considerable strain variation. Adaptation to high levels of metal resistance on exposure to a metal is likely to be responsible for much of the variation. At. ferrooxidans appears to be particularly resistant to metals and the bacterium has been reported to grow in medium containing Co2+ (30 g/l), Cu2+ (55 g/l), Ni2+ (72 g/l), Zn2+ (120 g/l), U3O8 (12 g/l) and Fe2+ (160 g/l). In a comparative study of two At. ferrooxidans, two L. ferrooxidans and an At. thiooxidans strain, it was found that At. ferrooxidans and L. ferrooxidans were approximately equally resistant to Cu2+, Zn2+, Al3+, Ni2+ and Mn2+, but that L. ferrooxidans was more ...
Mange af Williams sange handler om ham selv og hans indre konflikter - ikke mindst på hans senere album. Nogle sangtekster hentyder kraftigt til en, i det mindste tilsyneladende, stor selvindsigt og -kritik. Robbie Williams har hele sit liv kæmpet med væsentlige psykiske problemer som alkoholisme (han har dog været ædru siden 2001[kilde mangler]) og misbrug af forskellige stoffer. Problemer som i hvert fald delvist kan tilskrives hans øvrige psykologiske problemer som lavt selvværd, selvhad, tankemylder og klinisk depression. Williams har gennem hele sin professionelle karriere desuden kæmpet med sceneskræk. Et problem som ikke er blevet mindre med tiden.[kilde mangler] Disse personlige problematikker har medført flere kortvarige ophold på psykiatriske hospitaler og afvænningsklinikker. Senest februar til marts 2007, da Williams indlagde sig selv til afvænning på sin 33-års fødselsdag, 13.februar. Den officielle årsag var afhængighed af seroxat, en type anti-depressiv medicin. ...
What Existential Dread said (and linked to) but also: Dont ignore things if theres no pain where there used to be. My offending tender bit used to be just that, always the more susceptible of the two to be screaming in agony when coming into contact with solid objects at speed (couldve made out like a bandit on AFV if any had ever had a camera running). However, and I didnt realize this until after the diagnosis of TC was confirmed though an orchiectomy, at some point in the second half of last year it stopped being as sensitive as it once was. Lack of pain can be just as much of an indicator for a problem as excruciating pain, but its not something that we generally associate with having to make a trip to the doctor for ...
A sample of n=9 scores is obtained from a normal population distribution with o-=12. The sample mean is M=60. a- with a two-tailed test and o=.05,use the sample data to test the hypothesis that the population mean is u=65. b- with a two-tailed test and o=.05, use the ample data to test the hypothesis that the population me ...
BioVendor - BioVendor Research and Diagnostic Products is a developer and manufacturer of immunoassays, recombinant proteins, antibodies and endotoxin-removal products.
Uporaba mikroorganizmov pri pridobivanju kovin iz mineralnih rud oz. biorudarstvo se je v preteklih nekaj letih razvilo v uspešno in rastočo biotehnološko panogo, kljub temu pa je bila selekcija in spremljanje mikrobnih kultur za optimalno izluževanje minimalna[3]. Vprašanje torej ostaja, ali so trenutne mikrobne populacije v komercialnih postopkih dovolj primerne ali pa bi lahko z umetnim sestavljanjem bakterijskih sevov ustvarili še bolj učinkovite konzorcije[3]. Raziskave so pokazale, da imajo konzorciji različnih bakterij, ki se nahajajo v naravi, večjo sposobnost izluževanja kot čiste kulture[1]. Razlog je v sinergijskih učinkih posameznih vrst bakterij, ki imajo sicer različne funkcije, a skupaj omogočajo izvajanje večstopenjskih procesov[1]. Mešana kultura A. ferroxidans in A. thiooxidans je npr. veliko bolj učinkovita pri izluževanju kalkopirita (mineral CuFeS2), saj A. thiooxidans preprečuje nastajanje inhibitornih jarozitnih plasti, ki so pogosto posledica sprememb v ...
Significant associations are highlighted in bold. a Two-tailed P values were calculated by home-made program written in R language. b Corrected P values Pcorr - after Bonferroni correction- are shown in brackets.. ...
Archaea acidianus serve as natural hosts. There is currently only one species in this genus: the type species Acidianus ... Archaea acidianus serve as the natural host. Transmission routes are passive diffusion. "Viral Zone". ExPASy. Retrieved 15 June ... filamentous virus 1. Group: dsDNA Order: Ligamenvirales Family: Lipothrixviridae Genus: Gammalipothrixvirus Acidianus ...
Archaea acidianus serve as natural hosts. There is, as of 2015[update], only one species in this genus: the type species ... Archaea acidianus serve as the natural host. Transmission routes are through passive diffusion. "Viral Zone". ExPASy. Retrieved ... Acidianus filamentous virus 2. Viruses in Deltalipothrixvirus are enveloped, with rod-shaped geometries. The diameter is around ...
Acidianus rod-shaped virus 1 is 610 nm long and 22 nm wide, also has the three tail fibers protruding at each end and the same ... Acidianus rod-shaped virus 1, ARV1, the first member of the family Rudiviridae infecting hyperthermophilic archaea of the genus ... Acidianus rod-shaped virus 1, ARV1; genome sequence accession no. AJ875026. Other species Stygiolobus rod-shaped virus, SRV, ... of the hyperthermophilic archaeal genus Acidianus". Virology. 336 (1): 83-92. doi:10.1016/j.virol.2005.02.025. PMID 15866073. ...
Acidianus copahuensis" Giaveno et al. 2013 "Ca. Aciduliprofundum boonei" Schouten et al. 2008 "Ca. Accumulibacter phosphatis" ...
Members of the genus Acidianus serve as natural hosts. There is currently only one genus (Bicaudavirus) and one species in this ... Group: dsDNA Order: Unassigned Family: Bicaudaviridae Genus: Bicaudavirus Acidianus two-tailed virus Viruses in Bicaudaviridae ... family: the type species Acidianus two-tailed virus. However, Sulfolobus tengchongensis spindle-shaped viruses 1 and 2 (STSV1 ...
Acidianus filamentous virus 1 Rudiviridae. Nonenveloped, rod-shaped. Linear dsDNA. Sulfolobus islandicus rod-shaped virus 1 ...
... is a family of viruses that infect archaea of the genus Acidianus. Only one genus in this family has been ... Peng, X; Basta, T; Häring, M; Garrett, R. A.; Prangishvili, D (2007). "Genome of the Acidianus bottle-shaped virus and insights ... Archaea of the genus Acidianus serve as the natural host. Transmission routes are passive diffusion. Häring, M; Rachel, R; Peng ... Acidianus bottle-shaped virus, from a new family, the Ampullaviridae". Journal of Virology. 79 (15): 9904-11. doi:10.1128/JVI. ...
Betalipothrixvirus Acidianus filamentous virus 3 Acidianus filamentous virus 6 Acidianus filamentous virus 7 Acidianus ... Deltalipothrixvirus Acidianus filamentous virus 2 Genus: Gammalipothrixvirus Acidianus filamentous virus 1 The family consists ... Acidianus filamentous virus 1 was found to bind to cellular pili-like appendages. DNA templated transcription is the method of ... a novel virus infecting hyperthermophilic archaea of the genus Acidianus. Virology, 315, 68-79. Häring M, Vestergaard G, ...
Acidianus and Janibacter: Janus, a god in Roman mythology with two faces. Amphritea: Amphitrite ('Αμφιτρίτη), a sea-goddess and ...
The hyperthermophilic Acidianus strain was found to convert CS2 into H2S and CO2. The enzyme is similar to that of carbonic ...
... prefer low sodium chloride environments, with the exception of the Acidianus genus. Glycogen is used as long-term ...
The archaeon Acidianus ambivalens appears to possess both an ADP-dependent and an ADP independent pathway for the oxidation of ... and Acidianus, a facultative anaerobe (i.e. an organism that can obtain energy either by aerobic or anaerobic respiration). ... "16S rDNA-based Phylogeny of the Archaeal Order Sulfolobales and Reclassification of Desulfurolobus ambivalens as Acidianus ... "Two modes of sulfite oxidation in the extremely thermophilic and acidophilic archaeon acidianus ambivalens". Archives of ...
July 2011). "Genomic analysis of Acidianus hospitalis W1 a host for studying crenarchaeal virus and plasmid life cycles". ...
Acidianus), like those that live around hydrothermal vents, are able to survive independent of a source of oxygen. So the caves ...
Genus Acidianus Genus Metallosphaera Genus Stygiolobus Genus Sulfolobus Genus Sulfurisphaera This section lists the genera of ...
... a novel virus infecting hyperthermophilic archaea of the genus Acidianus". Virology 315: 68-79. 12. Prangishvili D. (2013) "The ...
... in the Euryarchaeota branch of Archaea Acidianus brierleyi, A. infernus, facultatively anaerobic thermoacidophilic ...
... acidianus MeSH B07.075.725.725.725 - sulfolobus MeSH B07.075.725.725.725.070 - sulfolobus acidocaldarius MeSH B07.075.725.725. ...
Goulet A, Blangy S, Redder P, Prangishvili D, Felisberto-Rodrigues C, Forterre P, Campanacci V, Cambillau C (2009) Acidianus ...
... Acidianus filamentous virus 3 Acidianus filamentous virus 6 Acidianus filamentous virus 7 Acidianus ... filamentous virus 8 Acidianus filamentous virus 9 Sulfolobus islandicus filamentous virus Viruses in Betalipothrixvirus are ...
Betafusellovirus Acidianus spindle-shaped virus 1 Sulfolobus spindle-shaped virus 6 Take care: The abbreviation SSV is also ...
... filamentous virus 8 Acidianus filamentous virus 9 Acidianus rod-shaped virus 1 Acidianus spindle-shaped virus 1 Acidianus two- ... Achromobacter virus JWX Acidianus bottle-shaped virus Acidianus filamentous virus 1 Acidianus filamentous virus 2 Acidianus ... filamentous virus 3 Acidianus filamentous virus 6 Acidianus filamentous virus 7 Acidianus ...
... pages for Acidianus Search Species2000 page for Acidianus MicrobeWiki page for Acidianus LPSN page for Acidianus Acidianus at ... PubMed references for Acidianus PubMed Central references for Acidianus Google Scholar references for Acidianus NCBI taxonomy ... In taxonomy, Acidianus is a genus of the Sulfolobaceae. List of bacterial genera named after mythological figures See the NCBI ... nov., and Acidianus brierleyi comb. nov.: facultatively aerobic, extremely acidophilic thermophilic sulfur-metabolizing ...
"Acidianus sulfidivorans" at the Encyclopedia of Life LPSN Type strain of Acidianus sulfidivorans at BacDive - the Bacterial ... The type strain is JP7(T) (=DSM 18786(T)=JCM 13667(T)). Plumb JJ; Haddad CM; Gibson JA; Franzmann PD (July 2007). "Acidianus ... Acidianus sulfidivorans is a species of archaeon. It is an extremely thermoacidophilic, obligately chemolithotrophic archaeon. ... Plumb, J., Haddad, C., and Franzmann, P. (2008). A novel extremophile Acidianus sulfidivorans sp. nov. from island paradise to ...
Its only known host is the Archaea, Acidianus sp. Acii26. "Acidianus rod-shaped virus 1". GenomeNet. GenomeNet. Retrieved ... Acidianus rod-shaped virus 1 is a species of Bacteriophage in the order Ligamenvirales and family Rudiviridae. ...
Acidianus brierleyi, A. infernus, facultatively anaerobic thermoacidophilic archaebacteria. *Halarchaeum acidiphilum, ...
Acidianus brierleyi, A. infernus, arqueas termoacidófilas anaerobias facultativas.. *Halarchaeum acidiphilum, unha arquea da ...
... pages for Acidianus Search Species2000 page for Acidianus MicrobeWiki page for Acidianus LPSN page for Acidianus Acidianus at ... PubMed references for Acidianus PubMed Central references for Acidianus Google Scholar references for Acidianus NCBI taxonomy ... In taxonomy, Acidianus is a genus of the Sulfolobaceae. List of bacterial genera named after mythological figures See the NCBI ... nov., and Acidianus brierleyi comb. nov.: facultatively aerobic, extremely acidophilic thermophilic sulfur-metabolizing ...
Acidianus bottle-shaped virus, complete genome Acidianus bottle-shaped virus, complete genome. gi,146411811,ref,NC_009452.1,, ...
"Acidianus sulfidivorans" at the Encyclopedia of Life LPSN Type strain of Acidianus sulfidivorans at BacDive - the Bacterial ... The type strain is JP7(T) (=DSM 18786(T)=JCM 13667(T)). Plumb JJ; Haddad CM; Gibson JA; Franzmann PD (July 2007). "Acidianus ... Acidianus sulfidivorans is a species of archaeon. It is an extremely thermoacidophilic, obligately chemolithotrophic archaeon. ... Plumb, J., Haddad, C., and Franzmann, P. (2008). A novel extremophile Acidianus sulfidivorans sp. nov. from island paradise to ...
... Dataset GBIF Backbone Taxonomy Rank GENUS Published in Int. J. Syst. Bacteriol. 36::559 ...
Acidianus species Acidianus infernus Name. Homonyms. Acidianus infernus Segerer et al., 1986. Bibliographic References. * (2012 ... Acidianus infernus Segerer et al., 1986 Dataset GBIF Backbone Taxonomy Rank SPECIES Published in Int. J. Syst. Bacteriol. 36:: ...
"AFV1, a novel virus infecting hyperthermophilic archaea of the genus acidianus.". Bettstetter M., Peng X., Garrett R.A., ... Proteomes - Acidianus filamentous virus 1 (isolate United States/Yellowstone) (AFV-1). Basket 0 ...
The thermoacidophilic and chemolithotrophic archaeon Acidianus ambivalens is routinely grown with sulfur and CO2-enriched air. ... The thermoacidophilic and chemolithotrophic archaeon Acidianus ambivalens is routinely grown with sulfur and CO2-enriched air. ... Acidianus ambivalens is Growing with Tetrathionate as Sole Sulfur Source. Acidianus ambivalens grown aerobically with 10 mM ... Acidithiobacillus and Acidianus TTHs are Similar Enzymes. The extracellular location of the A. ambivalens enzyme is consistent ...
Acidianus ambivalens, archaeon, Crenarchaea, hyperthermoacidophile, signal-recognition-particle (SRP) components, tetraether ... The signal-recognition particle (SRP) of one of the most acidophilic and hyperthermophilic archaeal cells, Acidianus ambivalens ... and protein-lipid interactions of signal-recognition particle components in the hyperthermoacidophilic archaeon Acidianus ... and protein-lipid interactions of signal-recognition particle components in the hyperthermoacidophilic archaeon Acidianus ...
... infects crenarchaea of the genus Acidianus living in terrestrial thermal springs at extremely high temperatures and low pH. ATV ...
Within this group, the genus Acidianus contains four biomining species (from ten known Acidianus species), but none of these ... In this work we analyzed the genome of Acidianus copahuensis and describe the genetic pathways involved in biomining processes ... we sequenced the genome of Acidianus copahuensis ALE1 strain, a novel thermoacidophilic crenarchaeon (optimum growth: 75 °C, pH ... Acidianus ambivalens Homologs in A. copahuensis Gene Protein acc. Number (NCBI) ORF (aa) ORF (aa) Protein acc. Number (NCBI) Aa ...
We isolated the large S-layer protein of Acidianus ambivalens and both S-layer subunits of Sulfolobus solfataricus and ... We isolated the large S-layer protein of Acidianus ambivalens and both S-layer subunits of Sulfolobus solfataricus and ... Acidianus, Sulfolobus and Metallosphaera surface layers: structure, composition and gene expression. Molecular microbiology 73 ...
... infects strains of the hyperthermophilic archaeal genus Acidianus and is morphologically distinct from all other known viruses ... The Acidianus bottle-shaped virus, ABV, infects strains of the hyperthermophilic archaeal genus Acidianus and is ... Genome of the Acidianus bottle-shaped virus and insights into the replication and packaging mechanisms.. @article{ ... Viral diversity in hot springs of Pozzuoli, Italy, and characterization of a unique archaeal virus, Acidianus bottle-shaped ...
... from Acidianus hospitalis W1. Plus protein sequence and external database links. ... Domain assignment for gi,332797933,ref,YP_004459433.1, from Acidianus hospitalis W1. Domain architecture ... pyruvate kinase [Acidianus hospitalis W1]. Sequence. MRKTKIIATLGPSSIDKVKELSQYVDIFRINFAHGDTKSHKEYFEKIKEYSDASILVDLP ...
Acidianus ambivalens (Zillig and Bock) Fuchs et al. (ATCC® 49204™) ATCC® Number: 49204™ Deposited As Desulfurolobus ambivalens ...
Two modes of sulfite oxidation in the extremely thermophilic and acidophilic archaeon acidianus ambivalens.. In: Archives of ... Sulfite-oxidizing enzyme activities were analyzed in cell-free extracts of aerobically grown cells of Acidianus ambivalens, an ... Sulfite-oxidizing enzyme activities were analyzed in cell-free extracts of aerobically grown cells of Acidianus ambivalens, an ... Two modes of sulfite oxidation in the extremely thermophilic and acidophilic archaeon acidianus ambivalens ...
Acidianus filamentous virus 1 Rudiviridae. Nonenveloped, rod-shaped. Linear dsDNA. Sulfolobus islandicus rod-shaped virus 1 ...
Candidatus Acidianus copahuensis. Loading... A0A060HIS7 Mevalonate kinase. Nitrososphaera viennensis EN76. Loading... ...
The SRPs of the Crenarchaeotum Acidianus ambivalens and the Euryarchaeota Archaeoglobus fulgidus, Pyrococcus furiosus and ... R. Moll, S. Schmidtke, and G. Schäfer, "Domain structure, GTP-hydrolyzing activity and 7S RNA binding of Acidianus ambivalens ... "The crystal structure of the conserved GTPase of SRP54 from the archaeon Acidianus ambivalens and its comparison with related ...
Sulfolobus solfataricus and Acidianus brierleyi and the like.______________________________________. The above bacteria are ...
The sulfur oxygenase reductase (SOR) is the initial enzyme in the sulfur oxidation pathway of Acidianus ambivalens. The SOR is ... The sulfur oxygenase reductase (SOR) is the initial enzyme in the sulfur oxidation pathway of Acidianus ambivalens. The SOR is ... Identification of core active site residues of the sulfur oxygenase reductase from Acidianus ambivalens by site-directed ... Identification of core active site residues of the sulfur oxygenase reductase from Acidianus ambivalens by site-directed ...
Vol 2: Draft Genome Sequence of the Novel Thermoacidophilic Archaeon Acidianus copahuensis Strain ALE1, Isolated from the ... Vol 2: Draft Genome Sequence of the Novel Thermoacidophilic Archaeon Acidianus copahuensis Strain ALE1, Isolated from the ... Vol 2: Draft Genome Sequence of the Novel Thermoacidophilic Archaeon Acidianus copahuensis Strain ALE1, Isolated from the ... Draft Genome Sequence of the Novel Thermoacidophilic Archaeon Acidianus copahuensis Strain ALE1, Isolated from the Copahue ...
Therefore, it is described here as a member of the genus Acidianus. The following species are assigned to the genus Acidianus: ... Acidianus infernus sp. nov. (type strain, strain DSM 3191) and Acidianus brierleyi comb. nov. (type strain, strain DSM 1651). ... The Acidianus isolates have a deoxyribonucleic acid guanine-plus-cytosine content of 31 mol%. In contrast, two of three ... Acidianus, is characterized from studies of 26 isolates of thermoacidophilic archaebacteria from different solfatara fields and ...
Fullscreen (supported by IE11, latest versions of Firefox, Chrome, Safari (not including iOS Safari), Edge, Chrome for Android, Samsung Internet) ...
Acidianus hospitalis. 361. Radical SAM/SPASM domain-containing protein. Acidianus brierleyi. 367. ...
Genome: Acidianus hospitalis W1. This database allows retrieval of precomputed tandem repeats from the selected genome. It also ...
Sulfolobus and Acidianus; Friedrich, 1998; Kletzin et al., 2004; Friedrich et al., 2005; Frigaard and Dahl, 2009). Bacterial ...
1996) Autotrophic carbon dioxide fixation in Acidianus brierleyi. Arch Microbiol 166:368-371. ...
Genus Acidianus. *Genus Sulfolobus [I]. *Order Thermoproteales [II] *Family Desulfurococcaceae [II] *Genus Desulfurococcus ...
Segerer, A., A Neuner, JK Kristjansson & KO Stetter, "Acidianus infernus gen. nov., sp. nov., and Acidianus brierleyi comb. nov ... For example, some bacteria in use today are: Acidianus brierleyi ( Sulfolobus brierleyi ), an aerobic, extremely acidophilic, ... 19 Acidianus infernos, useful to 88°C (190°F), that was developed from mud from the crater of the Solfatara volcano in Italy; ...
Segerer A, Neuner A, Kristjansson JK, Stetter KO (1986) Acidianus infernus gen. nov., sp. nov., and Acidianus brierleyi comb. ...
  • The thermoacidophilic and chemolithotrophic archaeon Acidianus ambivalens is routinely grown with sulfur and CO 2 -enriched air. (frontiersin.org)
  • The signal-recognition particle (SRP) of one of the most acidophilic and hyperthermophilic archaeal cells, Acidianus ambivalens , and its putative receptor component, FtsY (prokaryotic SRP receptor), were investigated in detail. (portlandpress.com)
  • We isolated the large S-layer protein of Acidianus ambivalens and both S-layer subunits of Sulfolobus solfataricus and Metallosphaera sedula, respectively. (uni-regensburg.de)
  • Acidianus ambivalens (Zillig and Bock) Fuchs et al. (atcc.org)
  • Sulfite-oxidizing enzyme activities were analyzed in cell-free extracts of aerobically grown cells of Acidianus ambivalens, an extremely thermophilic and chemolithoautotrophic archaeon. (tu-darmstadt.de)
  • Identification of core active site residues of the sulfur oxygenase reductase from Acidianus ambivalens by site-directed mutagenesis. (tu-darmstadt.de)
  • The sulfur oxygenase reductase (SOR) is the initial enzyme in the sulfur oxidation pathway of Acidianus ambivalens. (tu-darmstadt.de)
  • Substrate pathways and mechanisms of inhibition in the sulfur oxygenase reductase of Acidianus ambivalens. (tu-darmstadt.de)
  • Fuchs T, Huber H, Burggraf S and Stetter KO (1996) 16S rRNA‐based phylogeny of the archaeal order Sulfolobales and reclassification of Desulfurolobus ambivalens as Acidianus ambivalens comb. (els.net)
  • In taxonomy, Acidianus is a genus of the Sulfolobaceae. (wikipedia.org)
  • The Acidianus bottle-shaped virus, ABV, infects strains of the hyperthermophilic archaeal genus Acidianus and is morphologically distinct from all other known viruses. (semanticscholar.org)
  • Therefore, it is described here as a member of the genus Acidianus. (microbiologyresearch.org)
  • The following species are assigned to the genus Acidianus: Acidianus infernus sp. (microbiologyresearch.org)
  • Group: dsDNA Order: Ligamenvirales Family: Lipothrixviridae Genus: Betalipothrixvirus Acidianus filamentous virus 3 Acidianus filamentous virus 6 Acidianus filamentous virus 7 Acidianus filamentous virus 8 Acidianus filamentous virus 9 Sulfolobus islandicus filamentous virus Viruses in Betalipothrixvirus are enveloped, with rod-shaped geometries. (wikipedia.org)
  • The sequence data groups Acidianus infernus with the genus Sulfolobus on the sulfur-dependent branch of the archaebacterial tree. (illinois.edu)
  • Viral hosts in the acidic spring were members of the hyperthermophilic archaeal genus Acidianus. (uni-regensburg.de)
  • The family Ampullaviridae includes viruses with linear dsDNA genomes that replicate in hyperthermophilic archaea from the genus Acidianus . (ictvonline.org)
  • The Acidianus genus consists of acidothermophiles which grow optimally and slowly in the temperature range 65-95 degrees C and at pH 2-4 and belongs to the order Sulfolobales. (up.ac.za)
  • Acidianus rod-shaped virus 1, ARV1, the first member of the family Rudiviridae infecting hyperthermophilic archaea of the genus Acidianus, was isolated from a hot spring in Pozzuoli , Italy in 2005. (ipfs.io)
  • Acidianus brierleyi DSM 1651 T ( 21 ) and Sulfolobus acidocaldarius DSM 639 T ( 31 ) were grown at 65 to 70°C in DSM medium no. 150 ( http://www.dsmz.de/media/med150.htm ) and ATCC medium no. 1723 ( http://www.atcc.org/SearchCatalogs/Search.cfm ), respectively. (asm.org)
  • The vast majority of hyperthermophilic viruses were isolated from the Crenarchaeota infecting in particular the genera Sulfolobus , Thermoproteus , Acidianus, Pyrobaculum, Stygiolobus, and Aeropyrum [ 1 , 2 ]. (hindawi.com)
  • A large number of plasmids and viruses have been isolated from hyperthermophilic archaea of the genera Sulfolobus and Acidianus ( 38 , 58 ). (asm.org)
  • The pRN plasmid family, which includes a group of nonconjugative plasmids from Sulfolobus and Acidianus , encodes a novel RepA protein represented by ORF904 of pRN1 from Sulfolobus islandicus . (asm.org)
  • Many double-stranded DNA viruses which parasitize such hosts, including the filamentous virus AFV1 of Acidianus hospitalis , are enveloped with a lipid-containing membrane. (elifesciences.org)
  • For example, a microscopic organism known as Acidianus hospitalis thrives in highly acidic environments that are hotter than 80°C, conditions that would kill humans and many other species. (elifesciences.org)
  • Acidianus hospitalis has many adaptations that allow it to survive in its extreme environment. (elifesciences.org)
  • Genome of the Acidianus bottle-shaped virus and insights into the replication and packaging mechanisms. (semanticscholar.org)
  • Viral diversity in hot springs of Pozzuoli, Italy, and characterization of a unique archaeal virus, Acidianus bottle-shaped virus, from a new family, the Ampullaviridae. (semanticscholar.org)
  • The virion of Acidianus bottle shaped virus (ABV) is enveloped, resembles in its shape a bottle and has an overall length of about 230 nm and a width varying from about 75 nm, at the broad end, to 4 nm, at the pointed end (Figure 1 .Ampullaviridae ). (ictvonline.org)
  • Negative-contrast electron micrographs of native (left) and partially degraded (right) virions of an isolate of Acidianus bottle-shaped virus. (ictvonline.org)
  • All these proteins are conserved in the two other, as yet unclassified, ampullavirus genomes (Acidianus bottle-shaped virus 2 , ABV2 and Acidianus bottle-shaped virus 3, ABV3) described in metagenomics studies (Figure 2. (ictvonline.org)
  • Acidianus infernus gen. nov., sp. (wikipedia.org)
  • Acidianus infernus is an archaebacterium which is capable of utilizing sulfur in two ways: aerobically by the oxidation of elemental sulfur or strictly anaerobically by sulfur reduction. (illinois.edu)
  • Vol 2: Draft Genome Sequence of the Novel Thermoacidophilic Archaeon Acidianus copahuensis Strain ALE1, Isolated from the Copahue Volcanic Area in Neuqun, Argentina. (duhnnae.com)
  • Acidianus sulfidivorans is a species of archaeon. (wikipedia.org)
  • This superfamily also includes the Bacillus subtilis protein YbcF that does not seem to be able to bind zinc, which all carbonic anhydrases are thought to require, and a carbon disulfide hydrolase from acidothermophilic archaeon Acidianus, which has a typical carbonic anhydrase fold and active site but does not use CO(2) as a substrate [ PMID: 22012399 ]. (ebi.ac.uk)
  • With potential applications in medicine and biotechnology, the paper specifically focuses on the Acidianus tailed spindle virus, or Acidianus virus for short. (eurekalert.org)
  • Hochstein and her collaborators from MSU, the University of California, Los Angeles, and the Max Planck Institute of Biochemistry in Germany learned more about the structure of the Acidianus virus by using a combination of cryo-electron microscopy and X-ray crystallography. (eurekalert.org)
  • Structural studies of Acidianus tailed spindle virus reveal a structural paradigm used in the assembly of spindle- shaped viruses. (mpg.de)
  • Chaperone role for proteins p618 and p892 in the extracellular tail development of Acidianus two-tailed virus. (semanticscholar.org)
  • Acidianus rod-shaped virus 1 is 610 nm long and 22 nm wide, also has the three tail fibers protruding at each end and the same central channel encapsidating the genome. (ipfs.io)
  • Here we describe the structure, the proposed mechanism and evolution of a CS(2) hydrolase from Acidianus A1-3. (sigmaaldrich.com)
  • The hyperthermophilic Acidianus strain A1-3, which was isolated from the fumarolic, ancient sauna building at the Solfatara volcano (Naples, Italy), was shown to rapidly convert CS(2) into H(2)S and carbon dioxide (CO(2)), but nothing has been known about the modes of action and the evolution of the enzyme(s) involved. (sigmaaldrich.com)
  • Here we describe an Acidianus strain which carries naturally a novel 28 kb conjugative plasmid-like element, pAH1, and also serves as a laboratory host for lipothrixvirus AFV1. (pasteur.fr)
  • List of bacterial genera named after mythological figures See the NCBI webpage on Acidianus. (wikipedia.org)