A genus of gram-negative bacteria in the family ACIDAMINOCOCCACEAE, isolated from the INTESTINES of PIGS and humans.
A family of gram-negative bacteria, in the phylum FIRMICUTES.
Enzymes which transfer coenzyme A moieties from acyl- or acetyl-CoA to various carboxylic acceptors forming a thiol ester. Enzymes in this group are instrumental in ketone body metabolism and utilization of acetoacetate in mitochondria. EC 2.8.3.
Aconitic Acid is a weak organic acid, naturally found in some fruits and vegetables, that metabolizes to citric acid in the body and has been used in traditional medicine but can be toxic in high concentrations.
A large group of anaerobic bacteria which show up as pink (negative) when treated by the Gram-staining method.
A group of anaerobic coccoid bacteria that show up as pink (negative) when treated by the gram-staining method.
Glutarates are organic compounds, specifically carboxylic acids, that contain a five-carbon chain with two terminal carboxyl groups and a central methyl group, playing a role in various metabolic processes, including the breakdown of certain amino acids. They can also refer to their salts or esters. Please note that this definition is concise and may not cover all aspects of glutarates in depth.
A genus of gram-negative, anaerobic cocci parasitic in the mouth and in the intestinal and respiratory tracts of man and other animals.
'Anaerobic Bacteria' are types of bacteria that do not require oxygen for growth and can often cause diseases in humans, including dental caries, gas gangrene, and tetanus, among others.
Enzymes that catalyze the breakage of a carbon-oxygen bond leading to unsaturated products via the removal of water. EC 4.2.1.
Enzymes that catalyze the addition of a carboxyl group to a compound (carboxylases) or the removal of a carboxyl group from a compound (decarboxylases). EC 4.1.1.
A water-soluble, enzyme co-factor present in minute amounts in every living cell. It occurs mainly bound to proteins or polypeptides and is abundant in liver, kidney, pancreas, yeast, and milk.
A genus of motile or nonmotile gram-positive bacteria of the family Clostridiaceae. Many species have been identified with some being pathogenic. They occur in water, soil, and in the intestinal tract of humans and lower animals.
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.

Structural basis for stereo-specific catalysis in NAD(+)-dependent (R)-2-hydroxyglutarate dehydrogenase from Acidaminococcus fermentans. (1/5)

NAD(+)-dependent (R)-2-hydroxyglutarate dehydrogenase (HGDH) catalyses the reduction of 2-oxoglutarate to (R)-2-hydroxyglutarate and belongs to the d-2-hydroxyacid NAD(+)-dependent dehydrogenase (d-2-hydroxyacid dehydrogenase) protein family. Its crystal structure was determined by phase combination to 1.98 A resolution. Structure-function relationships obtained by the comparison of HGDH with other members of the d-2-hydroxyacid dehydrogenase family give a chemically satisfying view of the substrate stereoselectivity and catalytic requirements for the hydride transfer reaction. A model for substrate recognition and turnover is discussed. The HGDH active site architecture is structurally optimized to recognize and bind the negatively charged substrate 2-oxoglutarate. The structural position of the side chain of Arg52, and its counterparts in other family members, strongly correlates with substrate specificity towards substitutions at the C3 atom (linear or branched substrates). Arg235 interacts with the substrate's alpha-carboxylate and carbonyl groups, having a dual role in both substrate binding and activation, and the gamma-carboxylate group can dock at an arginine cluster. The proton-relay system built up by Glu264 and His297 permits His297 to act as acid-base catalyst and the 4Re-hydrogen from NADH is transferred as hydride to the carbonyl group Si-face leading to the formation of the correct enantiomer (R)-2-hydroxyglutarate.  (+info)

Acidaminococcus intestini sp. nov., isolated from human clinical samples. (2/5)

Eleven strains of a hitherto unknown, Gram-negative, anaerobic coccus were recovered from various human clinical samples of patients hospitalized in two geographically distant French hospitals. These strains displayed the morphology and growth characteristics of those related to the genus Acidaminococcus. The clinical isolates shared at least 99.9 and 99.7 % of their nucleotide positions in the 16S and 23S rRNA gene sequences, respectively. They displayed 95.6 and 88.9 % 16S and 23S rRNA gene sequence similarities, respectively, with Acidaminococcus fermentans. The 16S rRNA-based phylogeny revealed that all the clinical isolates grouped in a statistically well supported cluster separate from A. fermentans. Enzymic activity profiles as well as metabolic end product patterns, including propionic acid production, differentiated the novel bacteria from A. fermentans. Finally, phenotypic, genotypic and phylogenetic data, including large-scale chromosome structure and DNA G+C content, supported the proposal of a novel species of the genus Acidaminococcus, for which the name Acidaminococcus intestini sp. nov. is proposed. The type strain is ADV 255.99(T) (=AIP 283.01(T)=CIP 108586(T)=CCUG 50930(T)).  (+info)

Spectroscopic evidence for an all-ferrous [4Fe-4S]0 cluster in the superreduced activator of 2-hydroxyglutaryl-CoA dehydratase from Acidaminococcus fermentans. (3/5)

 (+info)

An asymmetric model for Na+-translocating glutaconyl-CoA decarboxylases. (4/5)

 (+info)

Complete genome sequence of Acidaminococcus intestini RYC-MR95, a Gram-negative bacterium from the phylum Firmicutes. (5/5)

 (+info)

'Acidaminococcus' is a genus of bacteria that are gram-negative, non-spore forming, and obligate anaerobes. They are commonly found in the human gastrointestinal tract and can also be found in other environments such as soil and water. These bacteria are able to metabolize certain amino acids and produce acidic byproducts, hence their name 'Acidaminococcus'.

The genus Acidaminococcus includes several species, with the most well-known being Acidaminococcus fermentans. This bacterium is capable of fermenting a variety of amino acids and other organic compounds, producing acetic acid, formic acid, and hydrogen as byproducts.

Acidaminococcus species have been associated with various human infections, particularly in immunocompromised individuals or those with underlying medical conditions. However, they are not typically considered to be highly pathogenic organisms. Nonetheless, the presence of Acidaminococcus species in clinical specimens may indicate an underlying infection or disturbance in the normal microbial community.

Veillonellaceae is a family of Gram-negative, anaerobic bacteria found in various environments, including the human mouth and gut. The bacteria are known for their ability to produce acetic and lactic acid as end products of their metabolism. They are often part of the normal microbiota of the body, but they can also be associated with certain infections, particularly in individuals with weakened immune systems.

It's important to note that while Veillonellaceae bacteria are generally considered to be commensal organisms, meaning they exist harmoniously with their human hosts, they have been implicated in some disease states, such as periodontitis (gum disease) and bacterial pneumonia. However, more research is needed to fully understand the role of these bacteria in health and disease.

Coenzyme A-transferases are a group of enzymes that catalyze the transfer of Coenzyme A (CoA) from one molecule to another. CoA is a coenzyme that plays a crucial role in various metabolic processes, including the oxidation of carbohydrates, fatty acids, and amino acids.

Coenzyme A-transferases can be further classified into several subfamilies based on their specific functions and the types of molecules they act upon. For example, some CoA-transferases transfer CoA to acyl groups, forming acyl-CoAs, which are important intermediates in fatty acid metabolism. Other CoA-transferases transfer CoA to pyruvate, forming pyruvate dehydrogenase complexes that play a key role in glucose metabolism.

These enzymes are essential for maintaining the proper functioning of various metabolic pathways and are involved in a wide range of physiological processes, including energy production, lipid synthesis, and detoxification. Defects in CoA-transferases can lead to several metabolic disorders, such as fatty acid oxidation disorders and pyruvate dehydrogenase deficiency.

Aconitic acid is a type of organic acid that is found naturally in some plants, including Aconitum napellus (monkshood or wolf's bane). It is a white crystalline powder with a sour taste and is soluble in water. In the human body, aconitic acid is produced as a byproduct of energy metabolism and can be found in small amounts in various tissues.

Aconitic acid has three carboxylic acid groups, making it a triprotic acid, which means that it can donate three protons (hydrogen ions) in solution. It is a strong acid and is often used as a laboratory reagent for various chemical reactions. In the food industry, aconitic acid may be used as a food additive or preservative.

It's important to note that some species of Aconitum plants contain highly toxic compounds called aconitines, which can cause serious harm or even death if ingested. Therefore, these plants should not be consumed or handled without proper knowledge and precautions.

Gram-negative anaerobic bacteria are a type of bacteria that do not require oxygen to grow and are characterized by their cell wall structure, which does not retain crystal violet dye in the Gram staining procedure. This is because they lack a thick peptidoglycan layer in their cell walls, which is typically stained dark purple in Gram-positive bacteria. Instead, gram-negative bacteria have an outer membrane that contains lipopolysaccharides (LPS), which can be toxic to human cells and contribute to the pathogenicity of these organisms.

Examples of gram-negative anaerobic bacteria include Bacteroides fragilis, Prevotella species, and Porphyromonas species. These bacteria are commonly found in the human mouth, gastrointestinal tract, and genitourinary tract, and can cause a variety of infections, including abscesses, wound infections, and bacteremia.

It's important to note that while gram-negative anaerobic bacteria do not require oxygen to grow, some may still tolerate or even prefer oxygen-rich environments. Therefore, the term "anaerobe" can be somewhat misleading when used to describe these organisms.

"Gram-Negative Anaerobic Cocci" refer to a specific group of anaerobic bacteria that are spherical in shape (cocci) and do not stain gram-negative due to the absence of a thick peptidoglycan layer in their cell walls. These bacteria are strict anaerobes, meaning they cannot grow in the presence of oxygen. They can be pathogenic and are often found in various human body sites, such as the oral cavity, gastrointestinal tract, and female genital tract. Some examples of Gram-negative anaerobic cocci include species of the genera Veillonella, Megasphaera, and Selenomonas.

Glutarates are compounds that contain a glutaric acid group. Glutaric acid is a carboxylic acid with a five-carbon chain and two carboxyl groups at the 1st and 5th carbon positions. Glutarates can be found in various substances, including certain foods and medications.

In a medical context, glutarates are sometimes used as ingredients in pharmaceutical products. For example, sodium phenylbutyrate, which is a salt of phenylbutyric acid and butyric acid, contains a glutaric acid group and is used as a medication to treat urea cycle disorders.

Glutarates can also be found in some metabolic pathways in the body, where they play a role in energy production and other biochemical processes. However, abnormal accumulation of glutaric acid or its derivatives can lead to certain medical conditions, such as glutaric acidemia type I, which is an inherited disorder of metabolism that can cause neurological symptoms and other health problems.

Veillonella is a genus of Gram-negative, anaerobic, non-spore-forming, coccoid or rod-shaped bacteria. These bacteria are commonly found as normal flora in the human mouth, intestines, and female genital tract. They are known to be obligate parasites, meaning they rely on other organisms for nutrients and energy. Veillonella species are often associated with dental caries and have been implicated in various infections such as bacteremia, endocarditis, pneumonia, and wound infections, particularly in immunocompromised individuals or those with underlying medical conditions. Proper identification of Veillonella species is important for the diagnosis and treatment of these infections.

Anaerobic bacteria are a type of bacteria that do not require oxygen to grow and survive. Instead, they can grow in environments that have little or no oxygen. Some anaerobic bacteria can even be harmed or killed by exposure to oxygen. These bacteria play important roles in many natural processes, such as decomposition and the breakdown of organic matter in the digestive system. However, some anaerobic bacteria can also cause disease in humans and animals, particularly when they infect areas of the body that are normally oxygen-rich. Examples of anaerobic bacterial infections include tetanus, gas gangrene, and dental abscesses.

I'm sorry for any confusion, but "Hydro-Lyases" is not a recognized medical term or category in biochemistry. It seems like there might be a misunderstanding or a typo in the term.

In biochemistry, "lyases" are enzymes that catalyze the removal of groups from substrates by means other than hydrolysis or oxidation, often forming a double bond or a ring-forming reaction. They are classified and named based on the type of bond they break.

If you meant to ask about a specific enzyme or reaction, could you please provide more context or clarify the term? I'd be happy to help further with accurate information.

Carboxy-lyases are a class of enzymes that catalyze the removal of a carboxyl group from a substrate, often releasing carbon dioxide in the process. These enzymes play important roles in various metabolic pathways, such as the biosynthesis and degradation of amino acids, sugars, and other organic compounds.

Carboxy-lyases are classified under EC number 4.2 in the Enzyme Commission (EC) system. They can be further divided into several subclasses based on their specific mechanisms and substrates. For example, some carboxy-lyases require a cofactor such as biotin or thiamine pyrophosphate to facilitate the decarboxylation reaction, while others do not.

Examples of carboxy-lyases include:

1. Pyruvate decarboxylase: This enzyme catalyzes the conversion of pyruvate to acetaldehyde and carbon dioxide during fermentation in yeast and other organisms.
2. Ribulose-1,5-bisphosphate carboxylase/oxygenase (RuBisCO): This enzyme is essential for photosynthesis in plants and some bacteria, as it catalyzes the fixation of carbon dioxide into an organic molecule during the Calvin cycle.
3. Phosphoenolpyruvate carboxylase: Found in plants, algae, and some bacteria, this enzyme plays a role in anaplerotic reactions that replenish intermediates in the citric acid cycle. It catalyzes the conversion of phosphoenolpyruvate to oxaloacetate and inorganic phosphate.
4. Aspartate transcarbamylase: This enzyme is involved in the biosynthesis of pyrimidines, a class of nucleotides. It catalyzes the transfer of a carboxyl group from carbamoyl aspartate to carbamoyl phosphate, forming cytidine triphosphate (CTP) and fumarate.
5. Urocanase: Found in animals, this enzyme is involved in histidine catabolism. It catalyzes the conversion of urocanate to formiminoglutamate and ammonia.

Biotin is a water-soluble vitamin, also known as Vitamin B7 or Vitamin H. It is a cofactor for several enzymes involved in metabolism, particularly in the synthesis and breakdown of fatty acids, amino acids, and carbohydrates. Biotin plays a crucial role in maintaining healthy skin, hair, nails, nerves, and liver function. It is found in various foods such as nuts, seeds, whole grains, milk, and vegetables. Biotin deficiency is rare but can occur in people with malnutrition, alcoholism, pregnancy, or certain genetic disorders.

'Clostridium' is a genus of gram-positive, rod-shaped bacteria that are widely distributed in nature, including in soil, water, and the gastrointestinal tracts of animals and humans. Many species of Clostridium are anaerobic, meaning they can grow and reproduce in environments with little or no oxygen. Some species of Clostridium are capable of producing toxins that can cause serious and sometimes life-threatening illnesses in humans and animals.

Some notable species of Clostridium include:

* Clostridium tetani, which causes tetanus (also known as lockjaw)
* Clostridium botulinum, which produces botulinum toxin, the most potent neurotoxin known and the cause of botulism
* Clostridium difficile, which can cause severe diarrhea and colitis, particularly in people who have recently taken antibiotics
* Clostridium perfringens, which can cause food poisoning and gas gangrene.

It is important to note that not all species of Clostridium are harmful, and some are even beneficial, such as those used in the production of certain fermented foods like sauerkraut and natto. However, due to their ability to produce toxins and cause illness, it is important to handle and dispose of materials contaminated with Clostridium species carefully, especially in healthcare settings.

Molecular sequence data refers to the specific arrangement of molecules, most commonly nucleotides in DNA or RNA, or amino acids in proteins, that make up a biological macromolecule. This data is generated through laboratory techniques such as sequencing, and provides information about the exact order of the constituent molecules. This data is crucial in various fields of biology, including genetics, evolution, and molecular biology, allowing for comparisons between different organisms, identification of genetic variations, and studies of gene function and regulation.

... is a genus in the phylum Bacillota (Bacteria), whose members are anaerobic diplococci that can use amino acids ... The name Acidaminococcus derives from: Neo-Latin noun acidum (from Latin adjective acidus, sour), an acid; Neo-Latin adjective ... "Acidaminococcus". List of Prokaryotic names with Standing in Nomenclature (LPSN). Retrieved 2022-09-09. Sayers; et al. " ... "Acidaminococcus". National Center for Biotechnology Information (NCBI) taxonomy database. Retrieved 2022-09-09. "The LTP". ...
Buckel W, Dorn U, Semmler R (1981). "Glutaconate CoA-transferase from Acidaminococcus fermentans". Eur. J. Biochem. 118 (2): ...
Two candidate enzymes from Acidaminococcus and Lachnospiraceae display efficient genome-editing activity in human cells. A ...
Campbell C, Sutcliffe IC, Gupta RS (2014). "Comparative proteome analysis of Acidaminococcus intestini supports a relationship ...
Campbell C, Sutcliffe IC, Gupta RS (2014). "Comparative proteome analysis of Acidaminococcus intestini supports a relationship ...
Campbell C, Sutcliffe IC, Gupta RS (2014). "Comparative proteome analysis of Acidaminococcus intestini supports a relationship ...
... cluster-containing ferredoxin as an alternative electron donor for 2-hydroxyglutaryl-CoA dehydratase from Acidaminococcus ...
The high resolution crystal structure of the α-subunit of the glutaconyl-CoA decarboxylase (Gcdα) of Acidaminococcus fermentans ... "The sodium ion translocating glutaconyl-CoA decarboxylase from Acidaminococcus fermentans: cloning and function of the genes ...
Ability of Acidaminococcus fermentans to oxidize trans-aconitate and decrease the accumulation of tricarballylate, a toxic end ...
... of Acidaminococcus fermentans". The Journal of Biological Chemistry. 289 (8): 5145-5157. doi:10.1074/jbc.M113.521013. PMC ...
Amino acid fermenting anaerobes such as Clostridium species, Peptostreptococcus asacchaarolyticus, Acidaminococcus fermentans ...
Acidaminococcus MeSH B03.440.425.410.096.755 - Pectinatus MeSH B03.440.425.410.096.877 - Selenomonas MeSH B03.440.425.410. ...
Acidaminococcus is a genus in the phylum Bacillota (Bacteria), whose members are anaerobic diplococci that can use amino acids ... The name Acidaminococcus derives from: Neo-Latin noun acidum (from Latin adjective acidus, sour), an acid; Neo-Latin adjective ... "Acidaminococcus". List of Prokaryotic names with Standing in Nomenclature (LPSN). Retrieved 2022-09-09. Sayers; et al. " ... "Acidaminococcus". National Center for Biotechnology Information (NCBI) taxonomy database. Retrieved 2022-09-09. "The LTP". ...
... and Acidaminococcus spp. and lower levels or species from the Lachnospiraceae family as well as Bifidobacterium pseudolongum. ...
Campbell, Chantal, Sutcliffe, Iain and Gupta, Radhey (2014) Comparative proteome analysis of Acidaminococcus intestini supports ... Comparative proteome analysis of Acidaminococcus intestini supports a relationship between outer membrane biogenesis in ... we have performed a whole proteome BLAST analysis of Acidaminococcus intestini, which indicates that a substantial proportion ( ...
Linear growth faltering in infants is associated with Acidaminococcus sp. and community-level changes in the gut microbiota. ...
Acidaminococcus fermentans (951). Finegoldia magna (1260). PB-001. Probiotics 1. DMA00177-F. DMA00185-T. DMA00061-C. DMA00137-R ...
D-2-Hydroxyglutarate Dehydrogenase (D2HGDH) from Acidaminococcus fermentans. View Price and Availability. ...
... a mutant of Acidaminococcus sp. BV3L6 Cas12a (Cpf1), from IDT for therapeutic applications. ... The new enzyme, Alt-R Cas12a (Cpf1) Ultra is a mutant of Acidaminococcus sp. BV3L6 Cas12a (Cpf1) that has enhanced editing ...
Acidaminococcus fermentans. Pig gut. ATCC, Rockville, USA. 1980-07-15. 50930T. Acidaminococcus intestini. Human peritoneal ...
The high resolution crystal structure of the α-subunit of the glutaconyl CoA decarboxylase (Gcdα) of Acidaminococcus fermentans ... 1999). The sodium ion translocating glutaconyl-CoA decarboxylase from Acidaminococcus fermentans: cloning and function of the ...
Firmicutes Acidaminococcus (RA = 0.3%), h2 = 0.54, BF = 8.82 × 10+5) and archaea (e.g. hydrogenotrophic methanogen ...
Acidaminococcus RSV_genus721 Bacteria;Firmicutes;Negativicutes;Selenomonadales;Acidaminococcaceae;NA RSV_genus722 Bacteria; ...
Acidaminococcus fermentans T. Reported in. Unknown Status. Valid (ICNP) Registered by. Excubia Bot about 2 years ago ...
Linear growth faltering in infants is associated with Acidaminococcus sp. and community-level changes in the gut microbiota. ...
The prefix Lb, As, and Fn stand for Lachnospiraceae bacterium, Acidaminococcus, and Francisella novicida, respectively. (k) ...
Acidaminococcus. ↑. Actinobacteria ↑. Actinobacteria. Bifidobacteriales. Bifidobacteriaceae. Phascolarctobacterium. ↓. ...
Host Lineage: Acidaminococcus intestini; Acidaminococcus; Acidaminococcaceae; Selenomonadales; Firmicutes; Bacteria. General ... Query: NC_016077:1278104:1288219 Acidaminococcus intestini RyC-MR95 chromosome, complete genome. Start: 1288219, End: 1288797, ... Information: The organisms of the genus Acidaminococcus are normal members of microbiota of human and warm-blooded animals, and ...
MTQFEGFTNLYQVSKTLRFELIPQGKTLKHIQEQGFIEEDKARNDHYKELKPIIDRIYKTYADQCLQLVQLDWENLSAA DSYRKEKTEETRNALIEEQATYRNAIHDYFIGRTDNLTDAINKRHAEIYKGLFKAELFNGKVLKQLGTVTTTEHENALL SFDKFTTYFSGFYENRKNVFSAEDISTAIPHRIVQDNFPKFKENCHIFTRLITAVPSLREHFENVKKAIGIFVSTSIEE FSFPFYNQLLTQTQIDLYNQLLGGISREAGTEKIKGLNEVLNLAIQKNDETAHIIASLPHRFIPLFKQILSDRNTLSFI EEFKSDEEVIQSFCKYKTLLRNENVLETAEALFNELNSIDLTHIFISHKKLETISSALCDHWDTLRNALYERRISELTG ITKSAKEKVQRSLKHEDINLQEIISAAGKELSEAFKQKTSEILSHAHAALDQPLPTTLKKQEEKEILKSQLDSLLGLYH LDWFAVDESNEVDPEFSARLTGIKLEMEPSLSFYNKARNYATKKPYSVEKFKLNFQMPTLASGWDVNKEKNNGAILFVK GLYYLGIMPKQKGRYKALSFEPTEKTSEGFDKMYYDYFPDAAKMIPKCSTQLKAVTAHFQTHTTPILLSNNFIEPLEIT EIYDLNNPEKEPKKFQTAYAKKTGDQKGYREALCKWIDFTRDFLSKYTKTTSIDLSSLRPSSQYKDLGEYYAELNPLLY ISFQRIAEKEIMDAVETGKLYLFQIYNKDFAKGHHGKPNLHTLYWTGLFSPENLAKTSIKLNGQAELFYRPKSRMKRMA RLGEKMLNKKLKDQKTPIPDTLYQELYDYVNHRLSHDLSDEARALLPNVITKEVSHEIIKDRRFTSDKFFFHVPITLNY AANSPSKFNQRVNAYLKEHPETPIIGIDRGERNLIYITVIDSTGKILEQRSLNTIQQFDYQKKLDNREKERVAARQAWS ...
Acidaminococcus 0.01 Taxa found in my father but not in me.. Me Species(%) ...
Acidaminococcus. genus. 984. 2304. 4664.6. 9773.8. 105. 707. Bacteroidales. order. 426327. 369089. 188681.8. 168273.3. 152. 995 ... Acidaminococcus intestini. species. 300. 799. 1051.3. 2292.1. 37. 222. Acholeplasma hippikon. species. 426. 812. 1052.5. 2058.9 ...
Acidaminococcus sp. BV3L6. Bacteria. Crystal structure of the Acidaminococcus sp. BV3L6 Cpf1 RR variant in complex with crRNA ... Acidaminococcus sp. BV3L6. Bacteria. Crystal structure of the Acidaminococcus sp. BV3L6 Cpf1 RVR variant in complex with crRNA ... Crystal structure of the Acidaminococcus sp. BV3L6 Cpf1 RR variant in complex with crRNA and target DNA (TCCA PAM). X-RAY ... Crystal structure of the Acidaminococcus sp. BV3L6 Cpf1 RVR variant in complex with crRNA and target DNA (TATA PAM). X-RAY ...
Acidaminococcus95 *Actinobacteria96 *Collinsella96 *Agathobacter95 * korrelierte mit Entzugserscheinungen und Depressionen ...
Dive into the research topics of Temporal metagenomic and metabolomic characterization of fresh perennial ryegrass degradation by rumen bacteria. Together they form a unique fingerprint. ...
Zheng, J., Hoffman, K. L., Chen, J. S., Shivappa, N., Sood, A., Browman, G. J., Dirba, D. D., Hanash, S., Wei, P., Hebert, J. R., Petrosino, J. F., Schembre, S. M. & Daniel, C. R., Nov 14 2020, In: British Journal of Nutrition. 124, 9, p. 931-942 12 p.. Research output: Contribution to journal › Article › peer-review ...
Acidaminococcus homini s sp. nov., Amedibacillus hominis sp. nov., Lientehia hominis gen. nov. sp. nov., Merdimmobilis hominis ... They are Acidaminococcus hominis sp. nov. (type strain NSJ-142T=CGMCC 1.17903T=KCTC 25346T), Amedibacillus hominis sp. nov. ( ... Actinobacteria , Tenericutes , Humanos , Ácidos Graxos/química , Acidaminococcus , Filogenia , DNA Bacteriano/genética , RNA ...
2015, 2017). Up to now, Cas12a proteins from Acidaminococcus sp. BV3L6 (AsCpf1/Cas12a), Francisella novicida (FnCpf1/Cas12a), ... Though three Cas12a proteins, namely Acidaminococcus sp. BV3L6 Cas12a (AsCas12a), Francisella novicidain U112 Cas12a (FnCas12a ...
2022-04-26 17:01:39 INFO::Creating scatter plot for continuous data, age vs Acidaminococcus.unclassified. ## `geom_smooth()` ... Acidaminococcus.unclassified. ## Warning in checkConv(attr(opt, derivs), opt$par, ctrl = control$checkConv, : ## Model failed ...
2022-11-01 17:55:21 INFO::Creating scatter plot for continuous data, age vs Acidaminococcus.unclassified. ## `geom_smooth()` ... Acidaminococcus.unclassified. ## Warning in checkConv(attr(opt, derivs), opt$par, ctrl = control$checkConv, : ## Model failed ...
  • Acidaminococcus intestini sp. (wikipedia.org)
  • To explore the relationships of a representative member of Negativicutes, we have performed a whole proteome BLAST analysis of Acidaminococcus intestini, which indicates that a substantial proportion (7 %) of the A. intestini proteome is closely related to sequences from members of the phylum Proteobacteria. (northumbria.ac.uk)
  • Carcinogenesis 2001 Feb;22:257-63 Galan JC, Reig M, Navas A, Baquero F, Blazquez J. ACI-1 from Acidaminococcus fermentans: characterization of the first beta-lactamase in Anaerobic cocci. (kyoto-u.ac.jp)
  • Here, we demonstrate that removal of most of the 20-nucleotide scaffold has only a slight effect on in vitro target DNA cleavage by a Cas12a ortholog from Acidaminococcus sp. (unistra.fr)
  • Order your Recombinant CRISPR Cas9 Protein and AsCas12a (CRISPR-associated nuclease Acidaminococcus sp. (lifetein.com)
  • Acidaminococcus is a genus in the phylum Bacillota (Bacteria), whose members are anaerobic diplococci that can use amino acids as the sole energy source for growth. (wikipedia.org)
  • AsCas12a (CRISPR-associated nuclease Acidaminococcus sp. (watson-bio.cn)
  • 您现在的位置: 主页 / 其他重组蛋白 / AsCas12a (CRISPR-associated nuclease Acidaminococcus sp. (watson-bio.cn)
  • https://www.watson-bio.cn/wp-content/uploads/2022/03/New-logo-chi.png 0 0 great_watson-int https://www.watson-bio.cn/wp-content/uploads/2022/03/New-logo-chi.png great_watson-int 2023-09-05 13:17:51 2023-09-05 13:17:51 AsCas12a (CRISPR-associated nuclease Acidaminococcus sp. (watson-bio.cn)
  • Order your Recombinant CRISPR Cas9 Protein and AsCas12a (CRISPR-associated nuclease Acidaminococcus sp. (lifetein.com)
  • Additionally, we offer SaCas9 derived from Staphylococcus aureus for applications requiring a shorter Cas9 variant compared to Spcas9 and AsCpf1 derived from Acidaminococcus for achieving DNA cleavage via staggered DNA double stand breaks. (vectorbuilder.cn)
  • Relative abundance of genus Acidaminococcus and family Ruminococcaceae were also associated with several measurements. (nih.gov)
  • The positive associations of the genus Acidaminococcus with BMI, as well as waist and hip circumferences, were stronger in women than in men. (nih.gov)
  • much Acidaminococcus hydrogenate, proto help order cyclobenzaprine buy dallas saint louis anybody dyshematopoietic airboats out cheap valproic acid cost on prescription of a digamy. (xtrapages.ie)