A structurally-diverse family of intracellular-signaling adaptor proteins that selectively tether specific protein kinase A subtypes to distinct subcellular sites. They play a role in focusing the PROTEIN KINASE A activity toward relevant substrates. Over fifty members of this family exist, most of which bind specifically to regulatory subunits of CYCLIC AMP-DEPENDENT PROTEIN KINASE TYPE II such as CAMP PROTEIN KINASE RIIALPHA or CAMP PROTEIN KINASE RIIBETA.
A type II cAMP-dependent protein kinase regulatory subunit that plays a role in confering CYCLIC AMP activation of protein kinase activity. It has a lower affinity for cAMP than the CYCLIC-AMP-DEPENDENT PROTEIN KINASE RIIALPHA SUBUNIT. Binding of this subunit by A KINASE ANCHOR PROTEINS may play a role in the cellular localization of type II protein kinase A.
A type II cAMP-dependent protein kinase regulatory subunit that plays a role in confering CYCLIC AMP activation of protein kinase activity. It has a higher affinity for cAMP than that of the CYCLIC-AMP-DEPENDENT PROTEIN KINASE RIIBETA SUBUNIT. Binding of this subunit by A KINASE ANCHOR PROTEINS may play a role in the cellular localization of type II protein kinase A.
A group of enzymes that are dependent on CYCLIC AMP and catalyze the phosphorylation of SERINE or THREONINE residues on proteins. Included under this category are two cyclic-AMP-dependent protein kinase subtypes, each of which is defined by its subunit composition.
A broad category of carrier proteins that play a role in SIGNAL TRANSDUCTION. They generally contain several modular domains, each of which having its own binding activity, and act by forming complexes with other intracellular-signaling molecules. Signal-transducing adaptor proteins lack enzyme activity, however their activity can be modulated by other signal-transducing enzymes
Transport proteins that carry specific substances in the blood or across cell membranes.
A cyclic AMP-dependent protein kinase subtype primarily found in particulate subcellular fractions. They are tetrameric proteins that contain two catalytic subunits and two type II-specific regulatory subunits.
A subclass of alpha-amylase ISOENZYMES that are secreted into SALIVA.
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
Proteins found in SEMEN. Major seminal plasma proteins are secretory proteins from the male sex accessory glands, such as the SEMINAL VESICLES and the PROSTATE. They include the seminal vesicle-specific antigen, an ejaculate clotting protein; and the PROSTATE-SPECIFIC ANTIGEN, a protease and an esterase.
The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.
Phosphotransferases that catalyzes the conversion of 1-phosphatidylinositol to 1-phosphatidylinositol 3-phosphate. Many members of this enzyme class are involved in RECEPTOR MEDIATED SIGNAL TRANSDUCTION and regulation of vesicular transport with the cell. Phosphatidylinositol 3-Kinases have been classified both according to their substrate specificity and their mode of action within the cell.
An intracellular signaling system involving the MAP kinase cascades (three-membered protein kinase cascades). Various upstream activators, which act in response to extracellular stimuli, trigger the cascades by activating the first member of a cascade, MAP KINASE KINASE KINASES; (MAPKKKs). Activated MAPKKKs phosphorylate MITOGEN-ACTIVATED PROTEIN KINASE KINASES which in turn phosphorylate the MITOGEN-ACTIVATED PROTEIN KINASES; (MAPKs). The MAPKs then act on various downstream targets to affect gene expression. In mammals, there are several distinct MAP kinase pathways including the ERK (extracellular signal-regulated kinase) pathway, the SAPK/JNK (stress-activated protein kinase/c-jun kinase) pathway, and the p38 kinase pathway. There is some sharing of components among the pathways depending on which stimulus originates activation of the cascade.
Proteins which are found in membranes including cellular and intracellular membranes. They consist of two types, peripheral and integral proteins. They include most membrane-associated enzymes, antigenic proteins, transport proteins, and drug, hormone, and lectin receptors.
The process in which substances, either endogenous or exogenous, bind to proteins, peptides, enzymes, protein precursors, or allied compounds. Specific protein-binding measures are often used as assays in diagnostic assessments.
A family of enzymes that catalyze the conversion of ATP and a protein to ADP and a phosphoprotein.
A group of enzymes that catalyzes the phosphorylation of serine or threonine residues in proteins, with ATP or other nucleotides as phosphate donors.
Semiautonomous, self-reproducing organelles that occur in the cytoplasm of all cells of most, but not all, eukaryotes. Each mitochondrion is surrounded by a double limiting membrane. The inner membrane is highly invaginated, and its projections are called cristae. Mitochondria are the sites of the reactions of oxidative phosphorylation, which result in the formation of ATP. They contain distinctive RIBOSOMES, transfer RNAs (RNA, TRANSFER); AMINO ACYL T RNA SYNTHETASES; and elongation and termination factors. Mitochondria depend upon genes within the nucleus of the cells in which they reside for many essential messenger RNAs (RNA, MESSENGER). Mitochondria are believed to have arisen from aerobic bacteria that established a symbiotic relationship with primitive protoeukaryotes. (King & Stansfield, A Dictionary of Genetics, 4th ed)
The intracellular transfer of information (biological activation/inhibition) through a signal pathway. In each signal transduction system, an activation/inhibition signal from a biologically active molecule (hormone, neurotransmitter) is mediated via the coupling of a receptor/enzyme to a second messenger system or to an ion channel. Signal transduction plays an important role in activating cellular functions, cell differentiation, and cell proliferation. Examples of signal transduction systems are the GAMMA-AMINOBUTYRIC ACID-postsynaptic receptor-calcium ion channel system, the receptor-mediated T-cell activation pathway, and the receptor-mediated activation of phospholipases. Those coupled to membrane depolarization or intracellular release of calcium include the receptor-mediated activation of cytotoxic functions in granulocytes and the synaptic potentiation of protein kinase activation. Some signal transduction pathways may be part of larger signal transduction pathways; for example, protein kinase activation is part of the platelet activation signal pathway.
Collections of illustrative plates, charts, etc., usually with explanatory captions.
Compounds that are designed to mimic the 3D structure of a natural peptide or protein.
The introduction of a phosphoryl group into a compound through the formation of an ester bond between the compound and a phosphorus moiety.
An adenine nucleotide containing one phosphate group which is esterified to both the 3'- and 5'-positions of the sugar moiety. It is a second messenger and a key intracellular regulator, functioning as a mediator of activity for a number of hormones, including epinephrine, glucagon, and ACTH.
The interaction of two or more substrates or ligands with the same binding site. The displacement of one by the other is used in quantitative and selective affinity measurements.
Injuries to DNA that introduce deviations from its normal, intact structure and which may, if left unrepaired, result in a MUTATION or a block of DNA REPLICATION. These deviations may be caused by physical or chemical agents and occur by natural or unnatural, introduced circumstances. They include the introduction of illegitimate bases during replication or by deamination or other modification of bases; the loss of a base from the DNA backbone leaving an abasic site; single-strand breaks; double strand breaks; and intrastrand (PYRIMIDINE DIMERS) or interstrand crosslinking. Damage can often be repaired (DNA REPAIR). If the damage is extensive, it can induce APOPTOSIS.
Lists of words, usually in alphabetical order, giving information about form, pronunciation, etymology, grammar, and meaning.
Compounds containing carbohydrate or glycosyl groups linked to phosphatidylinositols. They anchor GPI-LINKED PROTEINS or polysaccharides to cell membranes.
Cellular uptake of extracellular materials within membrane-limited vacuoles or microvesicles. ENDOSOMES play a central role in endocytosis.
White blood cells formed in the body's lymphoid tissue. The nucleus is round or ovoid with coarse, irregularly clumped chromatin while the cytoplasm is typically pale blue with azurophilic (if any) granules. Most lymphocytes can be classified as either T or B (with subpopulations of each), or NATURAL KILLER CELLS.
A CELL LINE derived from human T-CELL LEUKEMIA and used to determine the mechanism of differential susceptibility to anti-cancer drugs and radiation.
Endocytic/exocytic CELL MEMBRANE STRUCTURES rich in glycosphingolipids, cholesterol, and lipid-anchored membrane proteins that function in ENDOCYTOSIS (potocytosis), transcytosis, and SIGNAL TRANSDUCTION. Caveolae assume various shapes from open pits to closed vesicles. Caveolar coats are composed of CAVEOLINS.
Macrolide antifungal antibiotic complex produced by Streptomyces noursei, S. aureus, and other Streptomyces species. The biologically active components of the complex are nystatin A1, A2, and A3.
A plant genus of the family FABACEAE that contains gleditsiosides (triterpenoid SAPONINS).
An serine-threonine protein kinase that requires the presence of physiological concentrations of CALCIUM and membrane PHOSPHOLIPIDS. The additional presence of DIACYLGLYCEROLS markedly increases its sensitivity to both calcium and phospholipids. The sensitivity of the enzyme can also be increased by PHORBOL ESTERS and it is believed that protein kinase C is the receptor protein of tumor-promoting phorbol esters.
A CALMODULIN-dependent enzyme that catalyzes the phosphorylation of proteins. This enzyme is also sometimes dependent on CALCIUM. A wide range of proteins can act as acceptor, including VIMENTIN; SYNAPSINS; GLYCOGEN SYNTHASE; MYOSIN LIGHT CHAINS; and the MICROTUBULE-ASSOCIATED PROTEINS. (From Enzyme Nomenclature, 1992, p277)
Proteins encoded by the mitochondrial genome or proteins encoded by the nuclear genome that are imported to and resident in the MITOCHONDRIA.

The type and the localization of cAMP-dependent protein kinase regulate transmission of cAMP signals to the nucleus in cortical and cerebellar granule cells. (1/496)

cAMP signals are received and transmitted by multiple isoforms of cAMP-dependent protein kinases, typically determined by their specific regulatory subunits. In the brain the major regulatory isoform RIIbeta and the RII-anchor protein, AKAP150 (rat) or 75 (bovine), are differentially expressed. Cortical neurons express RIIbeta and AKAP75; conversely, granule cerebellar cells express predominantly RIalpha and RIIalpha. Cortical neurons accumulate PKA catalytic subunit and phosphorylated cAMP responsive element binding protein very efficiently into nuclei upon cAMP induction, whereas granule cerebellar cells fail to do so. Down-regulation of RIIbeta synthesis by antisense oligonucleotides inhibited cAMP-induced nuclear signaling in cortical neurons. Expression in cerebellar granule cells of RIIbeta and AKAP75 genes by microinjection of specific expression vectors, markedly stimulated cAMP-induced transcription of the lacZ gene driven by a cAMP-responsive element promoter. These data indicate that the composition of PKA in cortical and granule cells underlies the differential ability of these cells to transmit cAMP signals to the nucleus.  (+info)

Cloning and characterization of a cDNA encoding an A-kinase anchoring protein located in the centrosome, AKAP450. (2/496)

A combination of protein kinase A type II (RII) overlay screening, database searches and PCR was used to identify a centrosomal A-kinase anchoring protein. A cDNA with an 11.7 kb open reading frame was characterized and found to correspond to 50 exons of genomic sequence on human chromosome 7q21-22. This cDNA clone encoded a 3908 amino acid protein of 453 kDa, that was designated AKAP450 (DDBJ/EMBL/GenBank accession No. AJ131693). Sequence comparison demonstrated that the open reading frame contained a previously characterized cDNA encoding Yotiao, as well as the human homologue of AKAP120. Numerous coiled-coil structures were predicted from AKAP450, and weak homology to pericentrin, giantin and other structural proteins was observed. A putative RII-binding site was identified involving amino acid 2556 of AKAP450 by mutation analysis combined with RII overlay and an amphipatic helix was predicted in this region. Immunoprecipitation of RII from RIPA-buffer extracts of HeLa cells demonstrated co-precipitation of AKAP450. By immunofluorecent labeling with specific antibodies it was demonstrated that AKAP450 localized to centrosomes. Furthermore, AKAP450 was shown to co-purify in centrosomal preparations. The observation of two mRNAs and several splice products suggests additional functions for the AKAP450 gene.  (+info)

Association of the type 1 protein phosphatase PP1 with the A-kinase anchoring protein AKAP220. (3/496)

The cyclic AMP (cAMP)-dependent protein kinase (PKA) and the type 1 protein phosphatase (PP1) are broad-specificity signaling enzymes with opposing actions that catalyze changes in the phosphorylation state of cellular proteins. Subcellular targeting to the vicinity of preferred substrates is a means of restricting the specificity of each enzyme [1] [2]. Compartmentalization of the PKA holoenzyme is mediated through association of the regulatory subunits with A-kinase anchoring proteins (AKAPs), whereas a diverse family of phosphatase-targeting subunits directs the location of the PP1 catalytic subunit (PP1c) [3] [4]. Here, we demonstrate that the PKA-anchoring protein, AKAP220, binds PP1c with a dissociation constant (KD) of 12.1 +/- 4 nM in vitro. Immunoprecipitation of PP1 from cell extracts resulted in a 10.4 +/- 3.8-fold enrichment of PKA activity. AKAP220 co-purified with PP1c by affinity chromatography on microcystin sepharos Immunocytochemical analysis demonstrated that the kinase, the phosphatase and the anchoring protein had distinct but overlapping staining patterns in rat hippocampal neurons. Collectively, these results provide the first evidence that AKAP220 is a multivalent anchoring protein that maintains a signaling scaffold of PP1 and the PKA holoenzyme.  (+info)

NH2-Terminal targeting motifs direct dual specificity A-kinase-anchoring protein 1 (D-AKAP1) to either mitochondria or endoplasmic reticulum. (4/496)

Subcellular localization directed by specific targeting motifs is an emerging theme for regulating signal transduction pathways. For cAMP-dependent protein kinase (PKA), this is achieved primarily by its association with A-kinase-anchoring proteins (AKAPs). Dual specificity AKAP1, (D-AKAP1) binds to both type I and type II regulatory subunits and has two NH2-terminal (N0 and N1) and two COOH-terminal (C1 and C2) splice variants (. J. Biol. Chem. 272:8057). Here we report that the splice variants of D-AKAP1 are expressed in a tissue-specific manner with the NH2-terminal motifs serving as switches to localize D-AKAP1 at different sites. Northern blots showed that the N1 splice is expressed primarily in liver, while the C1 splice is predominant in testis. The C2 splice shows a general expression pattern. Microinjecting expression constructs of D-AKAP1(N0) epitope-tagged at either the NH2 or the COOH terminus showed their localization to the mitochondria based on immunocytochemistry. Deletion of N0(1-30) abolished mitochondrial targeting while N0(1-30)-GFP localized to mitochondria. Residues 1-30 of N0 are therefore necessary and sufficient for mitochondria targeting. Addition of the 33 residues of N1 targets D-AKAP1 to the ER and residues 1-63 fused to GFP are necessary and sufficient for ER targeting. Residues 14-33 of N1 are especially important for targeting to ER; however, residues 1-33 alone fused to GFP gave a diffuse distribution. N1(14-33) thus serves two functions: (a) it suppresses the mitochondrial-targeting motif located within residues 1-30 of N0 and (b) it exposes an ER-targeting motif that is at least partially contained within the N0(1-30) motif. This represents the first example of a differentially targeted AKAP and adds an additional level of complexity to the PKA signaling network.  (+info)

Characterization of a novel giant scaffolding protein, CG-NAP, that anchors multiple signaling enzymes to centrosome and the golgi apparatus. (5/496)

A novel 450-kDa coiled-coil protein, CG-NAP (centrosome and Golgi localized PKN-associated protein), was identified as a protein that interacted with the regulatory region of the protein kinase PKN, having a catalytic domain homologous to that of protein kinase C. CG-NAP contains two sets of putative RII (regulatory subunit of protein kinase A)-binding motif. Indeed, CG-NAP tightly bound to RIIalpha in HeLa cells. Furthermore, CG-NAP was coimmunoprecipitated with the catalytic subunit of protein phosphatase 2A (PP2A), when one of the B subunit of PP2A (PR130) was exogenously expressed in COS7 cells. CG-NAP also interacted with the catalytic subunit of protein phosphatase 1 in HeLa cells. Immunofluorescence analysis of HeLa cells revealed that CG-NAP was localized to centrosome throughout the cell cycle, the midbody at telophase, and the Golgi apparatus at interphase, where a certain population of PKN and RIIalpha were found to be accumulated. These data indicate that CG-NAP serves as a novel scaffolding protein that assembles several protein kinases and phosphatases on centrosome and the Golgi apparatus, where physiological events, such as cell cycle progression and intracellular membrane traffic, may be regulated by phosphorylation state of specific protein substrates.  (+info)

Regulation of NMDA receptors by an associated phosphatase-kinase signaling complex. (6/496)

Regulation of N-methyl-D-aspartate (NMDA) receptor activity by kinases and phosphatases contributes to the modulation of synaptic transmission. Targeting of these enzymes near the substrate is proposed to enhance phosphorylation-dependent modulation. Yotiao, an NMDA receptor-associated protein, bound the type I protein phosphatase (PP1) and the adenosine 3',5'-monophosphate (cAMP)-dependent protein kinase (PKA) holoenzyme. Anchored PP1 was active, limiting channel activity, whereas PKA activation overcame constitutive PP1 activity and conferred rapid enhancement of NMDA receptor currents. Hence, yotiao is a scaffold protein that physically attaches PP1 and PKA to NMDA receptors to regulate channel activity.  (+info)

Conservation and function of a bovine sperm A-kinase anchor protein homologous to mouse AKAP82. (7/496)

Protein kinase A regulates sperm motility through the cAMP-dependent phosphorylation of proteins. One mechanism to direct the activity of the kinase is to localize it near its protein substrates through the use of anchoring proteins. A-Kinase anchoring proteins (AKAPs) act by binding the type II regulatory subunit of protein kinase A and tethering it to a cellular organelle or cytoskeletal element. We showed previously that mAKAP82, the major protein of the fibrous sheath of the mouse sperm flagellum, is an AKAP. The available evidence indicates that protein kinase A is compartmentalized to the fibrous sheath by binding mAKAP82. To characterize AKAP82 in bovine sperm, a testicular cDNA library was constructed and used to isolate a clone encoding bAKAP82, the bovine homologue. Sequence analysis showed that the primary structure of bAKAP82 was highly conserved. In particular, the amino acid sequence corresponding to the region of mAKAP82 responsible for binding the regulatory subunit of protein kinase A was identical in the bull. Bovine AKAP82 was present in both epididymal and ejaculated sperm and was localized to the entire principal piece of the flagellum, the region in which the fibrous sheath is located. Finally, bAKAP82 bound the regulatory subunit of protein kinase A. These data support the idea that bAKAP82 functions as an anchoring protein for the subcellular localization of protein kinase A in the flagellum.  (+info)

mAKAP: an A-kinase anchoring protein targeted to the nuclear membrane of differentiated myocytes. (8/496)

The compartmentalization of second messenger-activated protein kinases contributes to the fidelity of hormone-mediated signal transduction events. For example, the cAMP-dependent protein kinase is tethered at specific intracellular locations through association with A-kinase anchoring proteins (AKAPs). We now report the cloning of mAKAP, an anchoring protein found predominantly in heart, skeletal muscle and brain, and whose expression is induced in neonatal ventriculocytes by treatment with hypertrophic stimuli. mAKAP is targeted to the nuclear membrane of differentiated myocytes. Analysis of mAKAP-green fluorescent protein (GFP) fusion constructs revealed that nuclear membrane targeting is conferred by two regions of the protein, between residues 772-915 and 915-1065, which contain spectrin-like repeat sequences. Heterologous expression of the mAKAP targeting sequences displaced the endogenous anchoring protein from the nuclear membrane, demonstrating that mAKAP targeting is saturable. Collectively, these data suggest that a domain containing spectrin-like repeats mediates targeting of the anchoring protein mAKAP and the cAMP-dependent protein kinase holoenzyme to the nuclear membrane in response to differentiation signals.  (+info)

TY - JOUR. T1 - Protein kinase A-anchoring inhibitor peptides arrest mammalian sperm motility. AU - Vijayaraghavan, Srinivasan. AU - Goueli, Said A.. AU - Davey, Michael. AU - Carr, Daniel. PY - 1997/2/21. Y1 - 1997/2/21. N2 - Cyclic AMP-dependent protein kinase (PKA) is anchored at specific subcellular sites through the interaction of the regulatory subunit (R) with protein kinase A-anchoring proteins (AKAPs) via an amphipathic helix binding motif. Synthetic peptides containing this amphipathic helix domain competitively disrupt PKA binding to AKAPs and cause a loss of PKA modulation of cellular responses. In this report we use S-Ht31, a cell-permeant anchoring inhibitor peptide, to study the role of PKA anchoring in sperm. Our analysis of three species of mammalian sperm detected three isoforms of PKA (RIIα, RIIβ, and RIβ) and one 110-kDa AKAP. The addition of S-Ht31 to bovine caudal epididymal sperm inhibits motility in a time- and concentration-dependent manner. A control peptide, ...
A-kinase anchor protein 10, mitochondrial (AKAP-10) (Dual specificity A kinase-anchoring protein 2) (D-AKAP-2) (Protein kinase A-anchoring protein 10) (PRKA10), ...
RecName: Full=A-kinase anchor protein 13; Short=AKAP-13;AltName: Full=Protein kinase A-anchoring protein 13;AltName: Full=Breast cancer nuclear receptor-binding auxiliary protein;AltName: Full=Human thyroid-anchoring protein 31;AltName: Full=Guanine nucleotide exchange factor Lbc;AltName: Full=AKAP-Lbc;AltName: Full=P47;AltName: Full=Lymphoid blast crisis oncogene; Short=LBC oncogene;AltName: Full=Non-oncogenic Rho GTPase-specific GTP exchange ...
The beta 2 adrenergic receptor (beta 2AR) undergoes desensitization by a process involving its phosphorylation by both protein kinase A (PKA) and G protein-coupled receptor kinases (GRKs). The protein kinase A-anchoring protein AKAP79 influences beta 2AR phosphorylation by complexing PKA with the receptor at the membrane. Here we show that AKAP79 also regulates the ability of GRK2 to phosphorylate agonist-occupied receptors. In human embryonic kidney 293 cells, overexpression of AKAP79 enhances agonist-induced phosphorylation of both the beta 2AR and a mutant of the receptor that cannot be phosphorylated by PKA (beta 2AR/PKA-). Mutants of AKAP79 that do not bind PKA or target to the beta 2AR markedly inhibit phosphorylation of beta 2AR/PKA-. We show that PKA directly phosphorylates GRK2 on serine 685. This modification increases Gbeta gamma subunit binding to GRK2 and thus enhances the ability of the kinase to translocate to the membrane and phosphorylate the receptor. Abrogation of the ...
cAMP signals are locally amplified by scaffold proteins (A Kinase Anchor Proteins, AKAPs) that tether cAMP-dependent Protein Kinase A (PKA) to discrete cellular locations. Here we hypothesized that mitochondrial anchoring of PKA promotes survival in muscle cells. We identified AKAP121 as the major mitochondrial AKAP in cardiomyocytes and aortic smooth muscle cells. In response to pressure overload, cardiac AKAP121 levels were significantly reduced, inducing marked mitochondrial dysfunction, DNA damage and activation of the DNA repair machinery. To test the role of AKAP121 in the modulation of cell survival, we synthesized peptides (AK-in) containing AKAP121 mitochondrial targeting domain but lacking its PKA binding motif, in order to competitively displace the endogenous AKAP121/PKA complex from mitochondria. Sequence-scrambled peptides were synthetized and used as controls (S). 24 hours after administration, FITC-conjugated AK-in peptides co-localized with mitochondria at confocal microscopy; ...
Extracellular hyperosmolarity, or osmotic stress, generally caused by differences in salt and macromolecule concentrations across the plasma membrane, occurs in lymphoid organs and at inflammatory sites. The response of immune cells to osmotic stress is regulated by nuclear factor of activated T cells 5 (NFAT5), a transcription factor that induces the expression of hyperosmolarity-responsive genes and stimulates cytokine production. We report that the guanine nucleotide exchange factor (GEF) Brx [also known as protein kinase A-anchoring protein 13 (AKAP13)] is essential for the expression of nfat5 in response to osmotic stress, thus transmitting the extracellular hyperosmolarity signal and enabling differentiation of splenic B cells and production of immunoglobulin. This process required the activity of p38 mitogen-activated protein kinase (MAPK) and NFAT5 and involved a physical interaction between Brx and c-Jun N-terminal kinase (JNK)-interacting protein 4 (JIP4), a scaffold molecule specific ...
TY - JOUR. T1 - Organelle-specific targeting of protein kinase AII (PKAII). T2 - Molecular and in situ characterization of murine A kinase anchor proteins that recruit regulatory subunits of PKAII to the cytoplasmic surface of mitochondria. AU - Chen, Qian. AU - Lin, Reigh Yi. AU - Rubin, Charles S.. PY - 1997/6/13. Y1 - 1997/6/13. N2 - Experiments were designed to test the idea that A kinase anchor proteins (AKAPs) tether regulatory subunits (RII) of protein kinase AII (PKAII) isoforms to surfaces of organelles that are bounded by phospholipid bilayers. S-AKAP84, one of three RII-binding proteins encoded by a single-copy murine gene, was studied as a prototypic organelle-associated AKAP. When S-AKAP84 was expressed in HEK293 cells, the anchor protein was targeted to mitochondria and excluded from other cell compartments. The RII tethering site is located in the cytoplasm adjacent to the mitochondrial surface. Endogenous RII subunits are not associated with mitochondria isolated from control ...
Gene Information This gene encodes a member of the A-kinase anchor protein family. A-kinase anchor proteins are scaffold proteins that contain a binding domain for the RI/RII subunit of protein kinase A (PKA) and recruit PKA and other signaling molecules to specific subcellular locations. This gene encodes a nuclear A-kinase anchor protein that binds to the RII alpha subunit of PKA and may play a role in chromosome condensation during mitosis by targeting PKA and the condensin complex to chromatin. A pseudogene of this gene is located on the short arm of chromosome 9. [provided by RefSeq May 2011]. ...
Differentially targeted protein that binds to type I and II regulatory subunits of protein kinase A and anchors them to the mitochondria or the plasma membrane. Although the physiological relevance between PKA and AKAPS with mitochondria is not fully understood, one idea is that BAD, a proapoptotic member, is phosphorylated and inactivated by mitochondria-anchored PKA. It cannot be excluded too that it may facilitate PKA as well as G protein signal transduction, by acting as an adapter for assembling multiprotein complexes. With its RGS domain, it could lead to the interaction to G-alpha proteins, providing a link between the signaling machinery and the downstream kinase (By similarity).
AKAP12; AKAP250; A-kinase anchor protein 12; AKAP-12; A-kinase anchor protein 250 kDa; AKAP 250; Gravin; Myasthenia gravis autoantigen ...
CRC is the third leading cause of mortality in men and women worldwide [1]. Most of the cancer-related deaths in CRC patients are as a result of early spread of cancer cells or due to reoccurrence post-surgical interventions [15]. Alterations in some key regulatory molecules involved in cell cycle, apoptosis and EMT pathways have been proposed in the initiation of carcinogenesis [16]. In this context, efforts are being made to identify and characterize tumor associated molecules for development of therapeutic targets for cancer treatment. A unique class of tumor associated antigens called cancer testis (CT) antigens has been reported in various malignancies and have been shown to be associated with tumor growth and metastasis [4]. Only few CT antigens with abundant expression, namely sperm associated antigen (SPAG9) and AKAP4 have been shown to be associated with CRC [5, 10]. In this study, we examined the involvement of AKAP4 in various malignant properties at phenotype and molecular level of ...
MSSGRRRGSAPWHSFSRFFAPRSPSRDKEEEEEERPGTSPPPAPGRSAASVENEPMSTSQKKENVLSSEA 1 - 70 VKIRQSEDKRNHAEKPVTLPVQEDPKKAYDLSSSTSDTKIGESDRQPKESFFQFLGNLFNISGKSSLGEA 71 - 140 KQSSFKDDQDKTEKDLQNPSDHHEDGIKREREIFSGSLRTQTHPTEEQDSNSSELSDAFSLDTTQDSDQE 141 - 210 TTNLLKQIDGKPEKPSVTYATYRGPRHIGKYLKQQTGLATVNTLDRENESSDSSTNRHIDPGSEIEAGVL 211 - 280 PLLLSASTDSSMKGNLLEGPLEDSDCSKTSFNKENSLTNNPELQNIASSNNLLNKNAWGSIERNRSSPSS 281 - 350 VTNSSYDGESDSQHHLSCEPVSQTNRNLVCSALLTGSNHRKVPCSPDFQRVTTTENTIKENSTVMSNRTL 351 - 420 VQREELVEPQGPAISDFSCSKSDGSDTTEQESTNLPSPNKSIRHEHLQLPESECSDKQTIDSSSKQAATH 421 - 490 TNIIALQRHAVTDTEFVNEGKRLSAQDSQKNVAVREIRRETESASAGESIASSHVKAPEDKIESLPKDTD 491 - 560 QYFETKAKKLDFRSHDKIPHIRMNKKDLASLNYISESAVVASLGNENAPELKFELNRSHISETPLDSESP 561 - 630 QQAEVSPDAKTSLSLDCKKLNFSISPPTFVSGVGMLSKLDIPDLMNEGSPVPIETGNVNIVGISYQPRKC 631 - 700 KEENVKNHVEAAGRKSPPPSFCLEYTSAIFEFKEVLSNSEKCQVLPGSEASGPHLTGLELLSFDSGNLSK 701 - 770 DCSSILSQDPNRVELVSSNTKANMSIIEKSDSLSLEAKTANIVSKAEIDGQNNVLVESHSGRGKTISLSK 771 - 840 ...
AKAP9 (A kinase (PRKA) anchor protein (yotiao) 9), Authors: Raffaele Ciampi, Yuri E Nikiforov. Published in: Atlas Genet Cytogenet Oncol Haematol.
Akap10 (untagged) - Mouse A kinase (PRKA) anchor protein 10 (Akap10), nuclear gene encoding mitochondrial protein, (10ug), 10 µg.
Complete information for AKAP5 gene (Protein Coding), A-Kinase Anchoring Protein 5, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
FUNCTION: [Summary is not available for the mouse gene. This summary is for the human ortholog.] The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is highly expressed in various brain regions and cardiac and skeletal muscle. It is specifically localized to the sarcoplasmic reticulum and nuclear membrane, and is involved in anchoring PKA to the nuclear membrane or sarcoplasmic reticulum. [provided by RefSeq, Jul 2008 ...
FUNCTION: [Summary is not available for the mouse gene. This summary is for the human ortholog.] The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is highly expressed in various brain regions and cardiac and skeletal muscle. It is specifically localized to the sarcoplasmic reticulum and nuclear membrane, and is involved in anchoring PKA to the nuclear membrane or sarcoplasmic reticulum. [provided by RefSeq, Jul 2008 ...
Sarah C. Bernier, Marc-Antoine Millette, Sarah Roy, Line Cantin, Ana Coutinho, Christian Salesse, (2021). Structural information and membrane binding of truncated RGS9-1 Anchor Protein and its C-terminal hydrophobic segment. Biochimica et Biophysica Acta (BBA) - Biomembranes, 1863, ISSN 0005-2736. eISSN . http://dx.doi.org/10.1016/j.bbamem.2021.183566 ...
Protein kinase A (PKA) is targeted to distinct subcellular localizations by specific protein kinase A anchoring proteins (AKAPs). AKAPs are divided into subclasses based on their ability to bind type I or type II PKA or both. Dual-specificity AKAPs were recently reported to have an additional PKA binding determinant called the RI specifier region. A bioinformatic search with the consensus RI specifier region identified a novel AKAP, the splicing factor arginine/serine-rich 17A (SFRS17A). Here, we show by a variety of protein interaction assays that SFRS17A binds both type I and type II PKA in vitro and inside cells, demonstrating that SFRS17A is a dual-specific AKAP. Moreover, immunofluorescence experiments show that SFRS17A colocalizes with the catalytic subunit of PKA as well as the splicing factor SC35 in splicing factor compartments. Using the E1A minigene splicing assay, we found that expression of wild type SFRS17A conferred regulation of E1A alternative splicing, whereas the mutant ...
AKAP7 - AKAP7 (untagged)-Human A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant beta available for purchase from OriGene - Your Gene Company.
Akap1 - Akap1 (untagged) - Mouse A kinase (PRKA) anchor protein 1 (Akap1), nuclear gene encoding mitochondrial protein, transcript variant 1, (10ug) available for purchase from OriGene - Your Gene Company.
Homo sapiens A kinase (PRKA) anchor protein (gravin) 12 (AKAP12), transcript variant 1, mRNA. (H00009590-R01) - Products - Abnova
Complete information for AKAP12 gene (Protein Coding), A-Kinase Anchoring Protein 12, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
Looking for online definition of A kinase (PRKA) anchor protein (gravin) 12 in the Medical Dictionary? A kinase (PRKA) anchor protein (gravin) 12 explanation free. What is A kinase (PRKA) anchor protein (gravin) 12? Meaning of A kinase (PRKA) anchor protein (gravin) 12 medical term. What does A kinase (PRKA) anchor protein (gravin) 12 mean?
Heart failing occurs because of persistent stress towards the myocardium frequently. (1-AR) and G12, activate the tiny G proteins RhoA, which in turn engages both Jun N-terminal proteins kinase (JNK) and p38 mitogen-activated proteins kinase (MAPK) kinase cascades (4C6). These research stage toward tension signaling as a significant contributor towards the hypertrophic response. In this issue, del Vescovo et al. describe an intriguing new connection between adrenergic, small GTPase, and cytokine signaling that regulates stress effects on cardiac remodeling (7). del Vescovo and colleagues have identified a robust protein-protein conversation between A-kinase-anchoring protein (AKAP)CLbc and IB kinase (IKK), a crucial regulator of NF-B signaling. Interestingly, AKAP-Lbc is an AKAP that also possesses Rho guanine PP242 nucleotide exchange factor (GEF) activity and acts as a scaffold for multiple kinases involved in cardiomyocyte function (5, 8, 9). In this context, AKAP-Lbc promotes fetal gene ...
Since its inception, the synaptic tagging hypothesis has inspired many to search for synaptic tags. However, very few molecules have been proposed as candidates (Frey and Frey, 2008). The nature and identity of PRPs and synaptic tags are under intensive investigations (Frey and Frey, 2008). Two pathway experiments showed that blockade of protein kinase A (PKA) or its interaction with A kinase-anchoring proteins (AKAPs) prevents synaptic capture, suggesting that PKA or its anchoring at active synapses may serve as a synaptic tag for L-LTP (Huang et al., 2006; Young et al., 2006). Calcium/calmodulin-dependent protein kinase II (CaMKII) is also implicated as an L-LTP-specific tag (Sajikumar et al., 2007). Studies thus far have been based on the use of pharmacological inhibitors in two-pathway experiments. However, it is necessary to show that these tags are transiently and locally activated in a protein synthesis-independent manner by weak stimulation. In a recent study, NMDA-dependent, ...
We have reported previously the design of a RIAD (RI-anchoring disruptor) peptide that specifically displaces PKA (protein kinase A) type I from the AKAP (A-kinase-anchoring protein) ezrin, which is present in the immunological synapse of T-cells. This increases immune reactivity by reducing the threshold for activation and may prove a feasible approach for improving immune function in patients with cAMP-mediated T-cell dysfunction. However, the use of RIAD in biological systems is restricted by its susceptibility to enzymatic cleavage and, consequently, its short half-life in presence of the ubiquitous serum peptidases. In the present study, carefully selected non-natural amino acids were employed in the design of RIAD analogues with improved stability. The resulting peptidomimetics demonstrated up to 50-fold increased half-lives in serum compared with RIAD, while maintaining similar or improved specificity and potency with respect to disruption of PKA type I-AKAP interactions.. ...
Yotiao is an A-kinase anchoring protein (AKAP) that, in the heart, mediates the formation of a macromolecular complex consisting of the IKs channel (α subunit KCNQ1 and regulatory subunit KCNE1), protein kinase A (PKA), and protein phosphatase 1 (PP1). Mutations that disrupt this complex do not allow the channel to be regulated in response to stress and can cause death. The effects of PKA on the channel can be mimicked by mutation of Ser97 to Asp in the KCNQ1 subunit. Using cells transfected with this mutant form of the channel, Kurokawa et al. demonstrated that interaction with Yotiao increased channel current by slowing channel inactivation in the absence of adenosine 3′,5′-monophosphate (cAMP). This effect of Yotiao on the S97D channel was not blocked by inhibitors of PKA or protein kinase C (PKC), which indicates that Yotiao was not promoting phosphorylation of other sites on the channel. Disruption of the Yotiao interaction by mutation of the KCNQ1 leucine zipper domain blocked the ...
TY - JOUR. T1 - Single nucleotide polymorphisms alter kinase anchoring and the subcellular targeting of A-kinase anchoring proteins. AU - Donelson Smith, F.. AU - Omar, Mitchell H.. AU - Nygren, Patrick J.. AU - Soughayer, Joseph. AU - Hoshi, Naoto. AU - Lau, Ho Tak. AU - Snyder, Calvin G.. AU - Branon, Tess C.. AU - Ghosh, Debapriya. AU - Langeberg, Lorene K.. AU - Ting, Alice Y.. AU - Santana, Luis Fernando. AU - Ong, Shao En. AU - Navedo, Manuel F. AU - Scott, John D.. PY - 2018/12/4. Y1 - 2018/12/4. N2 - A-kinase anchoring proteins (AKAPs) shape second-messenger signaling responses by constraining protein kinase A (PKA) at precise intracellular locations. A defining feature of AKAPs is a helical region that binds to regulatory subunits (RII) of PKA. Mining patient-derived databases has identified 42 nonsynonymous SNPs in the PKA-anchoring helices of five AKAPs. Solid-phase RII binding assays confirmed that 21 of these amino acid substitutions disrupt PKA anchoring. The most deleterious ...
Biosensors can offer unparalleled insights into the temporal and spatial features of signaling in live cells. The AKAR2 biosensor enables the detection in real time of PKA-catalyzed phosphorylation events in live cells [15,42,43]. We successfully engineered AKAR2 to the N-terminus of AKAP5, providing a biosensor that reports from the local environment, in cis orientation with respect to AKAP5. The FRET-based signal generated from the AKAP5 biosensor displayed a rapid activation in response to beta-adrenergic stimulation. Within less than 10 s the FRET signal, reflecting in situ PKA-catalyzed phosphorylation of AKAP5, reached peak amplitude. PKA-catalyzed phosphorylation of AKAP5 underwent rapid reversal. PCDs confine AKAP5 to the cell membrane, in close proximity to the membrane-embedded adenylylcyclase that generates cyclic AMP. The localization of AKAP5 was highly uniform, decorating the inner leaflet of the cell membrane. AKAP12, in contrast, is sequestered in close proximity to the cell ...
All we need from you is a couple of sentences/bullet points for this gene describing 1) how the protein functions, 2) what pathway it is in (if relevant) and 3) what are its main biological roles, preferably using terms suitable for a general, non-Drosophilist audience. Here is an example: nervy (nvy) is a member of the MTG family of genes that have both nuclear and cytosolic functions. nvy encodes a transcriptional repressor and an A kinase anchoring protein (AKAP). It regulates repulsive axon guidance and functions in Plexin and Notch signaling pathways. For those genes currently lacking a gene snapshot, FlyBase welcomes contributions through our online form (also accessible from the snapshot field of the gene). Feedback on existing Gene Snapshots can be made by clicking on the Contact FlyBase link (also accessible from the bottom of every FlyBase page) and selecting the Gene Snapshots option. ...
A-Kinase (cAMP dPK). A-Kinase (cAMP dPK),. Cyclic AMP dependent protein kinase. A family of enzymes activated by cyclic AMP, which catalyse intracellular phosphorylation reactions.. Protein scaffold complexes are a key mechanism by which a common signaling pathway can serve many different functions. Sequestering a signaling enzyme to a specific subcellular environment not only ensures that the enzyme is near its relevant targets, but also segregates this activity to prevent indiscriminate phosphorylation of other substrates. One family of diverse, well-studied scaffolding proteins are the A-kinase anchoring proteins (AKAPs). These anchoring proteins form multi-protein complexes that integrate cAMP signaling with other pathways and signaling events.. ...
Expression of AKAP4 (AKAP82, CT99, Fsc1, hAKAP82, HI, p82) in lung tissue. Antibody staining with HPA005949 and HPA020046 in immunohistochemistry.
AKAP7 antibody, N-term (A-kinase anchoring protein 7) for IHC-P, WB. Anti-AKAP7 pAb (GTX47526) is tested in Human samples. 100% Ab-Assurance.
Pulsatron Pump LBC3SA-WTC1-GCC - A Plus (A+) Series Chemical Metering Pumps from Pulsafeeder are in Stock at www.PumpCatalog.com - Click to Order!
Previous physiological and pharmacological experiments have demonstrated that the Chlamydomonas flagellar axoneme contains a cAMP-dependent protein kinase (PKA) that regulates axonemal motility and dynein activity. However, the mechanism for anchoring PKA in the axoneme is unknown. Here we test the hypothesis that the axoneme contains an A-kinase anchoring protein (AKAP). By performing RII blot overlays on motility mutants defective for specific axonemal structures, two axonemal AKAPs have been identified: a 240-kD AKAP associated with the central pair apparatus, and a 97-kD AKAP located in the radial spoke stalk. Based on a detailed analysis, we have shown that AKAP97 is radial spoke protein 3 (RSP3). By expressing truncated forms of RSP3, we have localized the RII-binding domain to a region between amino acids 144-180. Amino acids 161-180 are homologous with the RII-binding domains of other AKAPs and are predicted to form an amphipathic helix. Amino acid substitution of the central residues of ...
Rabbit monoclonal antibody raised against a human AKAP8L peptide using ARM Technology. A synthetic peptide of human AKAP8L is used for rabbit immunization.Customer or Abnova will decide on the preferred peptide sequence. (H00026993-K) - Products - Abnova
Sp17 is present in the head and tail of spermatozoa, in the tail it is in the fibrous sheath, which contains AKAP3 and AKAP4. Recombinant AKAP3 and AKAP4 RII binding domains were synthesized as glutathione S-transferase (GST) fusion proteins immobilized on glutathione-agarose resin and added to CHAPS extracts of human spermatozoa. Western blots of bound and eluted proteins probed with anti-Sp17 revealed that AKAP3 bound and precipitated a significant level of Sp17 while AKAP4 did not. AKAP4 binds AKAP3 and expression of AKAP3 is reduced in AKAP4 knockout sperm, therefore we tested AKAP4 knockout spermatozoa for Sp17 and found that there was a reduction in the amount of Sp17 expressed when compared to wild type spermatozoa. Co-localization of AKAP3 and Sp17 by immunofluorescence was demonstrated along the length of the principal piece of the flagella.. ...
Scaffolding proteins often bring kinases together with their substrates to facilitate cell signaling. This arrangement is critical for the phosphorylation and regulation of the transient receptor potential vanilloid 1 (TRPV1) channel, a key target of inflammatory mediators such as prostaglandins. The protein kinase A anchoring protein AKAP79/150 organizes a multiprotein complex to position protein kinase A (PKA) and protein kinase C (PKC) in the immediate proximity of TRPV1 channels to enhance phosphorylation efficiency. This arrangement suggests that regulators upstream of the kinases must also be present in the signalosome. Here, we show that AKAP79/150 facilitates a complex containing TPRV1 and adenylyl cyclase (AC). The anchoring of AC to this complex generates local pools of cAMP, shifting the concentration of forskolin required to attenuate capsaicin-dependent TRPV1 desensitization by approximately 100-fold. Anchoring of AC to the complex also sensitizes the channel to activation by ...
Description: A polyclonal antibody for detection of AKAP 10 from Human, Mouse, Rat. This AKAP 10 antibody is for WB, IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the N-terminal region of human AKAP 10 at AA rangle: 10- ...
Second, the biological response to a second messenger can depend on the scaffolding complex that binds enzymes that synthesize or degrade the second messenger, and effectors (Figure 1B). There are numerous examples of this mode of operation in cells. A-kinase anchoring proteins (AKAPs) are known to localize cAMP-dependent protein kinase (PKA) to different subcellular compartments in the cell, thereby ensuring phosphorylation of PKA targets in the correct cellular vicinity.16 Some AKAPs have also been found to associate with cAMP-hydrolyzing PDE isoforms, thereby providing a mechanism for fine-tuning local cAMP levels and downstream effects of PKA.17 The PDE4D splice variant PDE4D3 binds to muscle-selective AKAP (mAKAP), and this association results in low cAMP levels and prevents PKA activation under basal conditions. Following stimulation of cAMP synthesis, however, PKA is activated and phosphorylates mAKAP. These phosphorylation events result in a more efficient PDE4D3 action, and provides a ...
View Notes - D103 clicker+questions_lecture+16-18 from BIOL 05400 at UC Irvine. A. expression level of AKAPs B. level of adenylyl cyclase activity C. increased cytosolic concentration of cAMP D.
Story ideas from the May 2007 issue of the Journal of Lipid Research include why fish and seafood are better than olive oil and nuts against heart disease; too much cholesterol in a cell organelle can cause heart disease; why Down Syndrome individuals develop Alzheimers disease earlier than the general population; and how lipids anchor proteins on cell membranes.
This study provides evidence that the nuclear-encoded NCX3 is the only Na+/Ca2+ exchanger isoform localized within the OMM of neurons, where it plays a relevant role in controlling Ca2+m homeostasis under both basal and hypoxic conditions. Further results also revealed that mNCX3 colocalizes with AKAP121 - a member of PKA anchoring protein expressed on the OMM - and that this interaction modulates mNCX3 activity. This finding led to the hypothesis that the interplay between mNCX3 and AKAP121 regulates [Ca2+]m and contributes to cell survival. Indeed, when the constitutively expressed AKAP121 was silenced, [Ca2+]m increases and the prosurvival effect exerted by these two proteins was reverted.. An interesting finding emerging from our studies is that, among the three nuclear-encoded Na+/Ca2+ exchanger isoforms, only NCX3 was localized on mitochondria. In particular, mNCX3 was specifically localized on the OMM, as its lysis completely eliminated mNCX3 immunoreactivity. In this regard, an even more ...
Expression of AKAP12 (AKAP250, SSeCKS) in bronchus tissue. Antibody staining with HPA006344, HPA056230 and CAB026379 in immunohistochemistry.
Order AKAP5 ELISA Kits for many Reactivities. Human and more. Compare AKAP5 ELISA Kits and find the right product on antibodies-online.com.
Pharmacological Aspects of of PKA with PKI presents cDNA of HA95 and physics of LAP2beta from HA95, although LAPbeta is 2007. reducing years costing in own advice not is the fruit of LAP2beta from HA95; never, binding PKA carrying to A-kinase finding arguments recruits no satellite. background of CDK lot in the character here is LAP2beta computation but adds simultaneously abandon LAP2beta hormone from HA95.
The genotyping protocol(s) presented here have been optimized for reagents and conditions used by The Jackson Laboratory (JAX). To genotype animals, JAX recommends researchers validate the assay independently upon receipt of animals into their facility. Reaction cycling temperature and times may require additional optimization based on the specific genotyping reagents used ...
TY - JOUR. T1 - Purification of a regulatory subunit of type II cAMP-dependent protein kinase from Drosophila heads. AU - Inoue, Hiroko. AU - Yoshioka, Tohru. PY - 1997/6/9. Y1 - 1997/6/9. N2 - The cytosolic extract from Drosophila heads was separated using anion-exchange column chromatography. Two types of cAMP-dependent protein kinase (PKA), type I and type II, were detected, and type II PKA was found to be a major isozyme. The regulatory subunit of type II PKA (RII) was purified, and only one isoform was observed. The purified protein had an apparent molecular mass of 51 kDa on SDS gel electrophoresis. Partial amino acid sequences of the protein were almost identical with the RIIα subunit of human. Since PKA has been implicated to be especially important for learning and memory in Drosophila, the RII subunit may play an essential role in the regulation of neuronal activity in the brain of Drosophila, and possibly in human.. AB - The cytosolic extract from Drosophila heads was separated using ...
TY - JOUR. T1 - Kinome and phosphoproteome of high-grade meningiomas reveal AKAP12 as a central regulator of aggressiveness and its possible role in progression. AU - Parada, Carolina Angelica. AU - Osbun, Joshua. AU - Kaur, Sumanpreet. AU - Yakkioui, Youssef. AU - Shi, Min. AU - Pan, Catherine. AU - Busald, Tina. AU - Karasozen, Yigit. AU - Gonzalez-Cuyar, Luis Francisco. AU - Rostomily, Robert. AU - Zhang, Jing. AU - Ferreira, Manuel. PY - 2018/12/1. Y1 - 2018/12/1. N2 - There is a need to better understand meningioma oncogenesis for biomarker discovery and development of targeted therapies. Histological or genetic criteria do not accurately predict aggressiveness. Post-translational studies in meningioma progression are lacking. In the present work, we introduce a combination of mass spectrometry-based phosphoproteomics and peptide array kinomics to profile atypical and anaplastic (high-grade) meningiomas. In the discovery set of fresh-frozen tissue specimens (14), the A-kinase anchor protein ...
TY - JOUR. T1 - Methylation of AKAP12α promoter in lung cancer. AU - Jo, Uk Hyun. AU - Whang, Young Mi. AU - Sung, Jae Sook. AU - Kim, Yeul Hong. PY - 2010/11/1. Y1 - 2010/11/1. N2 - AKAP12α plays an important role in tumour growth suppression by inducing apoptosis. This study investigated whether the promoter methylation of AKAP12α is associated with lung cancer. AKAP12α was down-regulated in lung cancer cells and the reduced protein expression was restored by DNA methyl-transferase inhibitor. AKAP12α promoter was more frequently methylated in tumours than in normal tissues. Furthermore, AKAP12α methylation was found more frequently in the cells of non-relapse patients after surgery than in those of early relapse patients. In conclusion, this study demonstrated that AKAP12α expression is regulated by DNA methylation and that AKAP12α promoter methylation is associated with lung cancer prognosis.. AB - AKAP12α plays an important role in tumour growth suppression by inducing apoptosis. ...
The acquisition of a migratory phenotype is central in processes as diverse as embryo differentiation and tumor metastasis. An early event in this phenomenon is the generation of a nucleus-centrosome-Golgi back to front axis. AKAP350 is a Golgi/centrosome scaffold protein involved in microtubule nucleation. AKAP350 interacts with CIP4, a cdc42 effector that regulates actin dynamics. The present study aimed to characterize the participation of centrosomal AKAP350 in the acquisition of migratory polarity, and the involvement of CIP4 in the pathway. The decrease in total or in centrosomal AKAP350 led to decreased formation of the nucleus-centrosome-Golgi axis and defective cell migration. CIP4 localized at the centrosome. That was enhanced in migratory cells, but inhibited in cells with decreased centrosomal AKAP350. The interference with CIP4 expression or with CIP4/AKAP350 interaction also led to defective cell polarization. Centrosome positioning, but not nuclear movement was affected by loss of ...
Cyclic AMP is a ubiquitous intracellular second messenger involved in the regulation of a wide variety of cellular processes, a majority of which act through the cAMP - protein kinase A (PKA) signalling pathway and involve PKA phosphorylation of specific substrates. PKA phosphorylation events are typically spatially restricted and temporally well controlled. A-kinase anchoring proteins (AKAPs) directly bind PKA and recruit it to specific subcellular loci targeting the kinase activity towards particular substrates, and thereby provide discrete spatiotemporal control of downstream phosphorylation events. AKAPs also scaffold other signalling molecules into multi-protein complexes that function as crossroads between different signalling pathways. Targeting AKAP coordinated protein complexes with high-affinity peptidomimetics or small molecules to tease apart distinct protein-protein interactions (PPIs) therefore offer important means to disrupt binding of specific components of the complex to better
This gene encodes a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This protein is an essential component of the multisubunit enzyme, GPI transamidase. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2012 ...
A stearated form of the peptide Ht-31 derived from human thyroid A-kinase anchoring protein. This peptide inhibits the interaction between the RII subunits of cAMP-Dependent Protein Kinase (PKA) and AKAP in cell extracts.
Compare Alpha-catulin ELISA Kits from leading suppliers on Biocompare. View specifications, prices, citations, reviews, and more.
Immediate fixation of LBC samples improves preservation of cellular morphology and reduces air-drying and crush artefacts compared with CP. Cellular components such as cell membranes and chromatin may appear more sharply defined in LBC preparations than in CP as a result of improved cell preservation. Cell sizes appear slightly smaller in LBC preparations than in CP, however overall cellular morphology is unchanged. Tissue architecture in larger cell groups may be better appreciated in CP compared with LBC, however small cellular clusters and tissue fragments are still preserved.. ...
Leading Britains Conversation LBC - talk radio for the UK, letting you have your say on the big issues of the day and affecting London and the UK, with breaking news and opinion.
POWER-Drop drop in anchors provide the strength of a wedge anchor, but are used as a drop in anchor. Use them with machine screws and other bolts.
Who is the Workington man and why is he important? The author of a Conservative think-tank report explains why the party needs to win their votes.
This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind ... "A novel lipid-anchored A-kinase Anchoring Protein facilitates cAMP-responsive membrane events". The EMBO Journal. 17 (8): 2261- ... "Bioinformatic design of A-kinase anchoring protein-in silico: a potent and selective peptide antagonist of type II protein ... A-kinase anchor protein 7 isoform gamma is an enzyme that in humans is encoded by the AKAP7 gene. ...
2003). "Amino acid variant in the kinase binding domain of dual-specific A kinase-anchoring protein 2: a disease susceptibility ... "Bioinformatic design of A-kinase anchoring protein-in silico: a potent and selective peptide antagonist of type II protein ... "Bioinformatic design of A-kinase anchoring protein-in silico: a potent and selective peptide antagonist of type II protein ... A-kinase anchor protein 2 is an enzyme that in humans is encoded by the AKAP2 gene. AKAP2 has been shown to interact with ...
A-kinase anchor protein 8-like is a protein that in humans is encoded by the AKAP8L gene. AKAP8L has been shown to interact ... cloning and characterization of a novel nuclear protein, HA95, homologous to A-kinase anchoring protein 95". Biology of the ... "Entrez Gene: AKAP8L A kinase (PRKA) anchor protein 8-like". Yang JP, Tang H, Reddy TR, Wong-Staal F (Aug 2001). "Mapping the ... neighbor of A-kinase anchoring protein 95 (AKAP95) on chromosome 19p13.11-p13.12 region". Journal of Human Genetics. 45 (1): ...
A-kinase anchor protein 6 is an enzyme that in humans is encoded by the AKAP6 gene. The A-kinase anchor proteins (AKAPs) are a ... "Cloning and characterization of A-kinase anchor protein 100 (AKAP100). A protein that targets A-kinase to the sarcoplasmic ... "Entrez Gene: AKAP6 A kinase (PRKA) anchor protein 6". Marx, S O; Reiken S; Hisamatsu Y; Jayaraman T; Burkhoff D; Rosemblit N; ... Kapiloff MS, Schillace RV, Westphal AM, Scott JD (1999). "mAKAP: an A-kinase anchoring protein targeted to the nuclear membrane ...
Another protein essential for the SI response is MLPK, a serine-threonine kinase, which is anchored to the plasma membrane from ... "A membrane-anchored protein kinase involved in Brassica self-incompatibility signaling". Science. 303 (5663): 1516-9. Bibcode: ... The female determinant of the SI response in Brassica, is a transmembrane protein termed SRK, which has an intracellular kinase ... The interaction between the SRK and SCR/SP11 proteins results in autophosphorylation of the intracellular kinase domain of SRK ...
A-kinase anchor protein 5 is a protein that in humans is encoded by the AKAP5 gene. The A-kinase anchor proteins (AKAPs) are a ... 1995). "Association of protein kinase A and protein phosphatase 2B with a common anchoring protein". Science. 267 (5194): 108- ... "A-kinase anchoring protein 79/150 facilitates the phosphorylation of GABA(A) receptors by cAMP-dependent protein kinase via ... "Localization of the cAMP-dependent protein kinase to the postsynaptic densities by A-kinase anchoring proteins. ...
A-kinase anchor protein 8 is an enzyme that, in humans, is encoded by the AKAP8 gene. The A-kinase anchor proteins (AKAPs) are ... Collas P, Le Guellec K, Taskén K (Dec 1999). "The A-kinase-anchoring protein AKAP95 is a multivalent protein with a key role in ... 2003). "Protein kinase A-anchoring protein AKAP95 interacts with MCM2, a regulator of DNA replication". J. Biol. Chem. 278 (29 ... Collas P, Le Guellec K, Taskén K (2000). "The A-kinase-anchoring protein AKAP95 is a multivalent protein with a key role in ...
A-kinase anchor protein 12, aka AKAP250, is an enzyme that in humans is encoded by the AKAP12 gene. The A-kinase anchor ... Fan G, Shumay E, Wang H, Malbon CC (2001). "The scaffold protein gravin (cAMP-dependent protein kinase-anchoring protein 250) ... "The scaffold protein gravin (cAMP-dependent protein kinase-anchoring protein 250) binds the beta 2-adrenergic receptor via the ... Piontek J, Brandt R (2003). "Differential and regulated binding of cAMP-dependent protein kinase and protein kinase C ...
A kinase anchor protein 10, mitochondrial is an enzyme that in humans is encoded by the AKAP10 gene. The A-kinase anchor ... Huang LJ, Durick K, Weiner JA, Chun J, Taylor SS (November 1997). "D-AKAP2, a novel protein kinase A anchoring protein with a ... a protein kinase A anchoring protein". Proc. Natl. Acad. Sci. U.S.A. 98 (6): 3220-5. doi:10.1073/pnas.051633398. PMC 30634. ... "Amino acid variant in the kinase binding domain of dual-specific A kinase-anchoring protein 2: a disease susceptibility ...
A-kinase anchor protein 11 is an enzyme that in humans is encoded by the AKAP11 gene. The A-kinase anchor proteins (AKAPs) are ... "A-kinase anchoring protein AKAP220 binds to glycogen synthase kinase-3beta (GSK-3beta ) and mediates protein kinase A-dependent ... "A-kinase anchoring protein AKAP220 binds to glycogen synthase kinase-3beta (GSK-3beta ) and mediates protein kinase A-dependent ... Schillace RV, Scott JD (March 1999). "Association of the type 1 protein phosphatase PP1 with the A-kinase anchoring protein ...
Lea IA, Widgren EE, O'Rand MG (2004). "Association of sperm protein 17 with A-kinase anchoring protein 3 in flagella". Reprod. ... Frayne J, Hall L (2003). "A re-evaluation of sperm protein 17 (Sp17) indicates a regulatory role in an A-kinase anchoring ... Sperm surface protein Sp17 is a protein that in humans is encoded by the SPA17 gene. This gene encodes a protein present at the ... Studies in rabbits suggest that in sperm the protein is involved in fertilization by binding to the zona pellucida of the ...
"The A-kinase anchor protein AKAP121 is a negative regulator of cardiomyocyte hypertrophy". Journal of Molecular and Cellular ... "Induction of cardiomyocyte hypertrophy by specific knockdown of an a-kinase anchor protein". Journal of Molecular and Cellular ...
... evolutionarily conserved human gene family encoding proteins with presumptive protein kinase A anchoring function". Genomics. ... LRBA contains key features of both beige/CHS1 and A kinase anchor proteins (AKAPs; see MIM 602449).[supplied by OMIM] ... of a novel lipopolysaccharide-inducible gene with key features of both A kinase anchor proteins and chs1/beige proteins". J ... Lipopolysaccharide-responsive and beige-like anchor protein is a protein that in humans is encoded by the LRBA gene. Patients ...
Howlett CJ, Robbins SM (March 2002). "Membrane-anchored Cbl suppresses Hck protein-tyrosine kinase mediated cellular ... "The Cbl proteins are binding partners for the Cool/Pix family of p21-activated kinase-binding proteins". FEBS Lett. 550 (1-3): ... is a mammalian gene encoding the protein CBL which is an E3 ubiquitin-protein ligase involved in cell signalling and protein ... N-terminal tyrosine kinase binding domain (TKB domain): determines the protein which it can bind to RING finger domain motif: ...
Chen L, Marquardt ML, Tester DJ, Sampson KJ, Ackerman MJ, Kass RS (2007). "Mutation of an A-kinase-anchoring protein causes ... Golgi reassembly-stacking proteins are an evolutionarily conserved family of proteins in the Golgi matrix. GRASP65 and GRASP55 ... encoding a transmembrane protein with a presumed role in vesicle-mediated sorting and intracellular protein transport". Am. J. ... The first individual protein component of the matrix was identified in 1995 as Golgin A2 (then called GM130). Since then, many ...
Mochly-Rosen D (April 1995). "Localization of protein kinases by anchoring proteins: a theme in signal transduction". Science. ... "Protein kinase C-associated kinase (PKK), a novel membrane-associated, ankyrin repeat-containing protein kinase". The Journal ... Protein kinase C beta type is an enzyme that in humans is encoded by the PRKCB gene. Protein kinase C (PKC) is a family of ... December 1996). "Protein-protein interaction of zinc finger LIM domains with protein kinase C". The Journal of Biological ...
The protein becomes activated when binding to receptors capable of protein kinase activity for cellular signaling. TGF-α is a ... As a membrane anchored-growth factor, TGF-α can be cleaved from an integral membrane glycoprotein via a protease. Soluble forms ... When TGF-α binds to EGFR it dimerizes triggering phosphorylation of a protein-tyrosine kinase. The activity of protein-tyrosine ... This protein may act as either a transmembrane-bound ligand or a soluble ligand. This gene has been associated with many types ...
Mochly-Rosen D (Apr 1995). "Localization of protein kinases by anchoring proteins: a theme in signal transduction". Science. ... Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the ... "Characterization of protein kinase C isotype expression in adult rat heart. Protein kinase C-epsilon is a major isotype present ... PRKCE protein kinase C, epsilon". Newton PM, Messing RO (Apr 2010). "The substrates and binding partners of protein kinase ...
PMID 27057472 A-kinase anchor protein 4 (AKAP4) a promising therapeutic target of colorectal cancer. Jagadish N, Parashar D, ... PMID 20564126 Gene silencing of A-kinase anchor protein 4 inhibits cervical cancer growth in vitro and in vivo. Saini S, ... PMID 19190149 A novel cancer testis antigen, A-kinase anchor protein 4 (AKAP4) is a potential biomarker for breast cancer. ... PMID 17332284 A novel cancer testis antigen, A-kinase anchor protein 4 (AKAP4) is a putative target for immunotherapy of ...
"Down-regulation of tumor suppressor A kinase anchor protein 12 in human hepatocarcinogenesis by epigenetic mechanisms". ...
Diviani D, Soderling J, Scott JD (November 2001). "AKAP-Lbc anchors protein kinase A and nucleates Galpha 12-selective Rho- ... Holinstat M, Mehta D, Kozasa T, Minshall RD, Malik AB (August 2003). "Protein kinase Calpha-induced p115RhoGEF phosphorylation ... Holinstat M, Mehta D, Kozasa T, Minshall RD, Malik AB (August 2003). "Protein kinase Calpha-induced p115RhoGEF phosphorylation ... Rho is a small GTPase protein that is inactive when bound to the guanine nucleotide GDP. But when acted on by Rho GEF proteins ...
"Protein kinase A-anchoring (AKAP) domains in brefeldin A-inhibited guanine nucleotide-exchange protein 2 (BIG2)". Proceedings ... "Protein kinase A-anchoring (AKAP) domains in brefeldin A-inhibited guanine nucleotide-exchange protein 2 (BIG2)". Proceedings ... Brefeldin A-inhibited guanine nucleotide-exchange protein 2 is a protein that in humans is encoded by the ARFGEF2 gene. ADP- ... a brefeldin A-inhibited guanine nucleotide-exchange protein, with exocyst protein Exo70". Proceedings of the National Academy ...
Interaction of glycosyl-phosphatidylinositol anchor and protein tyrosine kinases p56lck and p59fyn 1". Journal of Immunology. ... 3-kinase and PI 4-kinase binding to the CD4-p56lck complex: the p56lck SH3 domain binds to PI 3-kinase but not PI 4-kinase". ... Lck (or lymphocyte-specific protein tyrosine kinase) is a 56 kDa protein that is found inside specialized cells of the immune ... "The glycophosphatidylinositol-anchored Thy-1 molecule interacts with the p60fyn protein tyrosine kinase in T cells". The ...
Oct 2013). "Cypher/ZASP is a novel A-kinase anchoring protein". The Journal of Biological Chemistry. 288 (41): 29403-13. doi: ... Dec 1996). "Protein-protein interaction of zinc finger LIM domains with protein kinase C". The Journal of Biological Chemistry ... ZASP is a PDZ domain-containing protein. PDZ motifs are modular protein-protein interaction domains consisting of 80-120 amino ... a striated muscle-restricted PDZ and LIM domain-containing protein, binds to alpha-actinin-2 and protein kinase C". The Journal ...
Evidence of tyrosine phosphorylation of a kinase-anchoring protein 3 and valosin-containing protein/p97 during capacitation". ... Furthermore, immunization of female rats with the recombinant human protein reduced fertility. This protein localizes to the ... interacts with G-protein beta 1 subunit and activates extracellular signal-regulated kinases (ERK)". Frontiers in Bioscience. ... The protein expressed by this gene is recognized by anti-sperm agglutinating antibodies from an infertile woman. ...
... and Golgi-localized protein kinase N-associated protein (CG-NAP) or AKAP350 or AKAP450 The A-kinase anchor proteins (AKAPs) are ... These signaling proteins include type II protein kinase A, serine/threonine kinase protein kinase N, protein phosphatase 1, ... and Golgi-Localized Protein Kinase N-Associated Protein Serves As a Docking Platform for Protein Kinase A Signaling and ... A-kinase anchor protein 9 is a protein that in humans is encoded by the AKAP9 gene. AKAP9 is also known as Centrosome- ...
November 2001). "Ht31: the first protein kinase A anchoring protein to integrate protein kinase A and Rho signaling". FEBS ... A-kinase anchor protein 13 is an protein that in humans is encoded by the AKAP13 gene. This protein is also called AKAP-Lbc ... anchor protein 13". Diviani D, Soderling J, Scott JD (November 2001). "AKAP-Lbc anchors protein kinase A and nucleates Galpha ... of the cAMP-dependent protein kinase interaction with A-kinase anchor proteins requires isoleucines 3 and 5". The Journal of ...
A-kinase anchor protein 3 is an enzyme that in humans is encoded by the AKAP3 gene. The A-kinase anchor proteins (AKAPs) are a ... anchor protein 3". Brown PR, Miki K, Harper DB, Eddy EM (Jun 2003). "A-kinase anchoring protein 4 binding proteins in the ... Brown PR, Miki K, Harper DB, Eddy EM (Jun 2003). "A-kinase anchoring protein 4 binding proteins in the fibrous sheath of the ... Lea IA, Widgren EE, O'Rand MG (Jul 2004). "Association of sperm protein 17 with A-kinase anchoring protein 3 in flagella". ...
"Association of protein kinase A and protein phosphatase 2B with a common anchoring protein". Science. 267 (5194): 108-11. doi: ... Calcineurin (CaN) is a calcium and calmodulin dependent serine/threonine protein phosphatase (also known as protein phosphatase ... Giri PR, Higuchi S, Kincaid RL (1991). "Chromosomal mapping of the human genes for the calmodulin-dependent protein phosphatase ... Frey N, Richardson JA, Olson EN (2000). "Calsarcins, a novel family of sarcomeric calcineurin-binding proteins". Proc. Natl. ...
A protein kinase drifting around on the outer chloroplast membrane can use ATP to add a phosphate group to the Toc34 protein, ... which anchors the protein to the outer chloroplast membrane.[48]. Toc159 probably works a lot like Toc34, recognizing proteins ... Toc34 is an integral protein in the outer chloroplast membrane that's anchored into it by its hydrophobic[48] C-terminal tail.[ ... It can be regulated through phosphorylation, but by a different protein kinase than the one that phosphorylates Toc34.[41] Its ...
The synaptic anchoring protein Gephyrin is indirectly linked to the GABAA receptors. ... Bcr-Abl tyrosine-kinase inhibitors. *Cannabinoid receptor antagonists. *CCR5 receptor antagonists. *Neurokinin 1 receptor ... Fig 2. Schematic diagram of a GABAA receptor protein ((α1)2(β2)2(γ2)) which illustrates the five combined subunits that form ... molecules that increase the activity of the GABAA receptor protein in the vertebrate central nervous system. ...
... protein kinase A-anchoring protein AKAP95". Biochem. J. 378 (Pt 2): 673-9. doi:10.1042/BJ20031765. PMC 1223988. PMID 14641107. ... protein kinase activity. • kinase activity. • protein serine/threonine kinase activity. • cyclin-dependent protein serine/ ... The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is highly similar to the gene ... Dephospho-(reductase kinase) kinase (EC 2.7.11.3). *AMP-activated protein kinase α *PRKAA1 ...
negative regulation of protein processing. • protein destabilization. • activation of protein kinase activity. • calcium- ... anchored component of membrane. • extracellular exosome. • cell nucleus. • extrinsic component of membrane. • cytosol. • ... ATP-dependent protein binding. • metal ion binding. • tubulin binding. • protein binding. • identical protein binding. • copper ... positive regulation of protein tyrosine kinase activity. • positive regulation of protein targeting to membrane. • modulation ...
FYN - a Src family kinase that phosphorylates CD3 and ζ ITAMs. *CD45 - a transmembrane protein whose intracellular tail ... The TCR is a disulfide-linked membrane-anchored heterodimeric protein normally consisting of the highly variable alpha (α) and ... UMich Orientation of Proteins in Membranes protein/pdbid-2hac - Zeta-zeta dimer of T cell receptor ... Early signaling steps implicate the following kinases and phosphatases after TCR triggering: *Lck - a Src family kinase ...
... anchored proteins: GPI-anchored proteins in liposomes and cells show similar behavior". Proceedings of the National Academy of ... PA acts as a signaling lipid, recruiting cytosolic proteins to appropriate membranes (e.g., sphingosine kinase 1[8]). ... October 2004). "Sphingosine kinase 1 is an intracellular effector of phosphatidic acid". J. Biol. Chem. 279 (43): 44763-74. doi ... This will show whether the phosphate group is newly derived from the kinase activity or whether it originates from the PC.[18] ...
... attaches to the actin cytoskeleton through anchor proteins that are still poorly characterized. ... positive regulation of phosphatidylinositol 3-kinase signaling. • inflammatory response. • calcium-mediated signaling using ... protein binding. • calcium ion binding. • metal ion binding. Cellular component. • integral component of membrane. • membrane. ... an EGF-like domain and a complement-binding protein-like domains (same as complement regulatory proteins: CRP) having short ...
"Protein kinases 6. The eukaryotic protein kinase superfamily: kinase (catalytic) domain structure and classification". FASEB J. ... "Membrane-anchored growth factors, the epidermal growth factor family: Beyond receptor ligands". Cancer Science 99 (2): 214-20. ... "Peptide inhibitors of protein kinases-discovery, characterisation and use". Biochimica et Biophysica Acta (BBA) - Proteins and ... Hunter T (1991). "Protein kinase classification". Meth. Enzymol. 200: 3-37. PMID 1835513. doi:10.1016/0076-6879(91)00125-G. ...
Skeletal muscle or "voluntary muscle" is anchored by tendons (or by aponeuroses at a few places) to bone and is used to effect ... Muscle cells contain protein filaments of actin and myosin that slide past one another, producing a contraction that changes ... Diagnostic procedures that may reveal muscular disorders include testing creatine kinase levels in the blood and ... The epimysium anchors muscle tissue to tendons at each end, where the epimysium becomes thicker and collagenous. It also ...
From left to right are: immunoglobulin G (IgG, an antibody), hemoglobin, insulin (a hormone), adenylate kinase (an enzyme), and ... Antibodies can be secreted into the extracellular environment or anchored in the membranes of specialized B cells known as ... Main article: Protein domain. Many proteins are composed of several protein domains, i.e. segments of a protein that fold into ... globular proteins, fibrous proteins, and membrane proteins. Almost all globular proteins are soluble and many are enzymes. ...
protein binding. • ephrin receptor binding. Cellular component. • anchored component of membrane. • plasma membrane. • integral ... 1995). "Ligands for the receptor tyrosine kinases hek and elk: isolation of cDNAs encoding a family of proteins". Oncogene. 10 ... The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been ... Three transcript variants that encode distinct proteins have been identified.[6] References[edit]. *^ a b c GRCh38: Ensembl ...
protein binding. • heme binding. • electron carrier activity. Cellular component. • cytosol. • protein phosphatase type 2A ... Cytochrome c binds to cardiolipin in the inner mitochondrial membrane, thus anchoring its presence and keeping it from ... regulated by Pyruvate dehydrogenase kinase and Pyruvate dehydrogenase phosphatase). to α-ketoglutaric acid. *Glutamate ... Soltys BJ, Gupta RS (2000). "Mitochondrial proteins at unexpected cellular locations: export of proteins from mitochondria from ...
kinase binding. • mitogen-activated protein kinase kinase binding. • guanylate kinase activity. • protein binding. • protein ... "Anchoring proteins confer G protein sensitivity to an inward-rectifier K(+) channel through the GK domain". The EMBO Journal. ... SAP97 is a mammalian MAGUK-family member protein that is similar to the Drosophila protein Dlg1 (the protein is alternatively ... brain-enriched guanylate kinase-associated protein), a novel neuronal PSD-95/SAP90-binding protein". The Journal of Biological ...
... and gp130-mediated stimulation of mitogen-activated protein kinase. Evidence for participation of multiple signaling pathways ... signal-transducing receptor component gp130 in human serum possessing a potential to inhibit signals through membrane-anchored ... Mijelin protein nula • Osteonektin • Protein C • Protein S • Proteoglikan • Serum amiloid P komponenta • Sialoglikoprotein ( ... Glikoprotein 130 (takođe poznat kao gp130, IL6ST, IL6-beta ili CD130) je transmembranski protein. On je osnivački član klase ...
... which contain residues that can be directly modified by a series of protein kinases and protein phosphatases, as well as ... "The anchoring protein SAP97 influences the trafficking and localisation of multiple membrane channels". Biochimica et ... Yu XM, Askalan R, Keil GJ, Salter MW (January 1997). "NMDA channel regulation by channel-associated protein tyrosine kinase Src ... synaptic NMDA excitation caused a decrease in the intracellular concentration of p38 mitogen-activated protein kinase (p38MAPK ...
"Role of p38 mitogen-activated protein kinase and extracellular signal-regulated protein kinase kinase in adenosine A2B receptor ... 2001). "Adenosine A2B receptors behave as an alternative anchoring protein for cell surface adenosine deaminase in lymphocytes ... Adenozinski A2B receptor (ADORA2B) je G-protein spregnuti adenozinski receptor. Ovaj protein je kodiran humanim ADORA2B genom.[ ... signalni put G-protein spregnutog receptora. • aktivnost adenilat ciklaze. • JNK kaskada. • izlučivanje. ...
Peles E, Schlessinger J, Grumet M (1998). «Multi-ligand interactions with receptor-like protein tyrosine phosphatase beta: ... Walsh FS, Doherty P (1992). «Glycosylphosphatidylinositol anchored recognition molecules that function in axonal fasciculation ... molecule is localized to glycolipid-enriched membrane subdomains and interacts with L1 and fyn kinase in cerebellum.». J. ... 1999). «The interaction between F3 immunoglobulin domains and protein tyrosine phosphatases zeta/beta triggers bidirectional ...
... which leads to hyperpolarization and relaxation Stimulates a cGMP-dependent protein kinase that activates myosin light chain ... The subcellular localisation of nNOS in skeletal muscle is mediated by anchoring of nNOS to dystrophin. nNOS contains an ... An alternatively spliced form of nNOS is a major muscle protein that produces signals in response to calcium release from the ... Ponting CP, Phillips C (March 1995). "DHR domains in syntrophins, neuronal NO synthases and other intracellular proteins". ...
anchored component of membrane. • لیپید رفت. • پوسته یاخته. • extracellular exosome. • membrane. • anchored component of ... Peles E, Schlessinger J, Grumet M (Apr 1998). "Multi-ligand interactions with receptor-like protein tyrosine phosphatase beta: ... molecule is localized to glycolipid-enriched membrane subdomains and interacts with L1 and fyn kinase in cerebellum". Journal ... anchored component of presynaptic membrane. فرایند زیستی. • positive regulation of peptidyl-tyrosine phosphorylation. • nervous ...
"The AMP-activated protein kinase α2 catalytic subunit controls whole-body insulin sensitivity". The Journal of Clinical ... An anchor identifier; can be made the target of wikilinks to full references; special value 'harv' generates an anchor suitable ... The AMP-activated protein kinase α2 catalytic subunit controls whole-body insulin sensitivity ,journal=The Journal of Clinical ... "The AMP-activated protein kinase α2 catalytic subunit controls whole-body insulin sensitivity". The Journal of Clinical ...
Finally, the Akt protein kinase promotes cell survival through two pathways. Akt phosphorylates and inhibits Bad (a Bcl-2 ... AIF is anchored to the inner membrane. In order to be released, the protein is cleaved by a calcium-dependent calpain protease ... Examples of viral Bcl-2 proteins include the Epstein-Barr virus BHRF1 protein and the adenovirus E1B 19K protein.[104] Some ... The adenovirus E1B-55K protein and the hepatitis B virus HBx protein are examples of viral proteins that can perform such a ...
Regulation of Na+-K+-ATPase by cAMP-dependent protein kinase anchored on membrane via its anchoring protein Kinji Kurihara, ... mitogen-activated protein kinase, MAPK)訊息的梯瀑效應(cascade)的活化、粒線體活性氧(reactive oxygen species, ROS)的產生、C型磷脂酶(phospholipase C, PLC)及 ... 3.6.5.1: 异三聚体G蛋白(英语:Heterotrimeric
Kinase. L[cuir in eagar , athraigh foinse]. For substances with an l- or L- prefix such as L-alanine or DL-alanine, please see ... Lipid anchored protein. *Lipoamide. *Lipoprotein. *Low density lipoprotein,LDL. *Luteinizing hormone (LH) ...
Protein phosphatase *PP2A. *OCRL. *Pyruvate dehydrogenase phosphatase. *Fructose 6-P,2-kinase:fructose 2,6-bisphosphatase ... Glucose 6-phosphatase consists of 357 amino acids, and is anchored to the endoplasmic reticulum (ER) by nine transmembrane ... Glucose is then exported from the cell via glucose transporter membrane proteins.[1] This catalysis completes the final step in ... The transfer of the glucose 6-phosphate is carried out by a transporter protein (T1) and the endoplasmic reticulum (ER) ...
protein binding. Cellular component. • membrane. • plasma membrane. • anchored component of external side of plasma membrane. • ... transmembrane receptor protein tyrosine kinase activator activity. • neurotrophin TRKA receptor binding. • ephrin receptor ... Ephrin A5 is a glycosylphosphatidylinositol (GPI)-anchored protein of the ephrin-A subclass of ephrin ligands that binds to the ... activation of transmembrane receptor protein tyrosine kinase activity. • axon guidance. • synaptic membrane adhesion. ...
Liedtke, Carole M; Yun C H Chris, Kyle Nicole, Wang Dandan. Protein kinase C epsilon-dependent regulation of cystic fibrosis ... An apical PDZ protein anchors the cystic fibrosis transmembrane conductance regulator to the cytoskeleton (англ.) // Journal of ... Sun, F; Hug M J., Lewarchik C M., Yun C H., Bradbury N A., Frizzell R A. E3KARP mediates the association of ezrin and protein ... Wang, S; Yue H., Derin R B., Guggino W B., Li M. Accessory protein facilitated CFTR-CFTR interaction, a molecular mechanism to ...
... receptor channels through activation of anchored protein kinase C in prefrontal cortical neurons". The Journal of Neuroscience ... G-protein coupled receptor activity. • virus receptor activity. • signal transducer activity. • drug binding. • G-protein alpha ... G-protein coupled serotonin receptor activity. • serotonin binding. • neurotransmitter receptor activity. • protein binding. • ... G-protein coupled receptor signaling pathway. • animal behavior. • regulation of synaptic vesicle exocytosis. • G-protein ...
protein binding. • ADP binding. • protein membrane anchor. • actin-dependent ATPase activity. • calmodulin binding. • ATPase ... but most prominently by Rho-dependent kinase and/or by the calcium-calmodulin-dependent myosin light chain kinase, not only ... Other proteins that are known to interact with NM IIA include the actin binding protein tropomyosin 4.2 [26] and a novel actin ... It encodes a protein of the same length, with 97.1% amino acid identity with the human MYH9 protein.[15] ...
"Interaction of focal adhesion kinase with cytoskeletal protein talin". The Journal of Biological Chemistry. 270 (28): 16995-9. ... cytoskeletal anchoring at plasma membrane. • cell adhesion. • viral process. • integrin-mediated signaling pathway. • integrin ... protein binding. • vinculin binding. • protein complex binding. • actin binding. • cadherin binding. • phosphatidylserine ... "Protein sequence of human TLN1 (Uniprot ID: Q9Y490)". Cardiac Organellar Protein Atlas Knowledgebase (COPaKB). Retrieved 7 July ...
... is directed to specific sub cellular locations after tethering to Protein kinase A anchoring proteins (AKAPs ... "Targeting of Protein Kinase A by Muscle A Kinase-anchoring Protein (mAKAP) Regulates Phosphorylation and Function of the ... out of 540 different protein kinase genes that make up for human kinome, only one other protein kinase, Casein kinase 2, is ... The dimerization and docking (D/D) domain of the dimer binds to the A-kinase binding (AKB) domain of A-kinase anchor protein ( ...
The A-kinase anchoring proteins or A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have ... Marin, Wenwen (January 2020). "A-kinase anchoring protein 1 (AKAP1) and its role in some cardiovascular diseases". Journal of ... AKAPs act as scaffold proteins wherein they bind PKA and other signaling proteins and physically tether these multi-protein ... "A-kinase-anchoring proteins". Journal of Cell Science. 118 (15): 3217-3220. CiteSeerX 10.1.1.621.7853. doi:10.1242/jcs.02416. ...
A-kinase anchor protein 9. Names. A kinase (PRKA) anchor protein (yotiao) 9. A kinase (PRKA) anchor protein 9. A-kinase anchor ... kinase N-associated protein. protein hyperion. protein kinase A anchoring protein 9. protein phosphatase 1, regulatory subunit ... These signaling proteins include type II protein kinase A, serine/threonine kinase protein kinase N, protein phosphatase 1, ... AKAP9 A-kinase anchoring protein 9 [Homo sapiens] AKAP9 A-kinase anchoring protein 9 [Homo sapiens]. Gene ID:10142 ...
... anchor protein 4 Biomolecules from leading suppliers on Biocompare. View specifications, prices, citations, reviews, and more. ... Your search returned 5 A kinase (PRKA) anchor protein 4 Biomolecules across 3 suppliers. ... I am studying a protein that is usually responsible for male gonad differentiation in mammals but is... read more ...
The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex ... Interacts with the regulatory region of protein kinase N (PKN), protein phosphatase 2A (PP2A), protein phosphatase 1 (PP1) and ... Scaffolding protein that assembles several protein kinases and phosphatases on the centrosome and Golgi apparatus. Required to ... targets protein kinase A (PKA) catalytic and regulatory subunits and protein phosphatase 1 (PP1), to the heterodimer KCNQ1- ...
... anchor protein 1 ELISA Kits from leading suppliers on Biocompare. View specifications, prices, citations, reviews, and more. ... A kinase (PRKA) anchor protein 1 ELISA Kits. The ELISA (enzyme-linked immunosorbent assay) is a widely used application for ... Your search returned 56 A kinase (PRKA) anchor protein 1 ELISA ELISA Kit across 2 suppliers. ... detecting and quantifying proteins and antigens from various samples. Target-specific ELISA kits are available from a variety ...
Critical role of cAMP-dependent protein kinase anchoring to the L-type calcium channel Cav1.2 via A-kinase anchor protein 150 ... McConnell BK, Popovic Z, Mai N et al (2009) Disruption of protein kinase a interaction with A-kinase-anchoring proteins in the ... Chen L, Kurokawa J, Kass RS (2005) Phosphorylation of the A-kinase-anchoring protein Yotiao contributes to protein kinase A ... Cloning and characterization of A-kinase anchor protein 100 (AKAP100). A protein that targets A-kinase to the sarcoplasmic ...
Jackson, S. M. and Berg, C. A. (2002). An A-kinase anchoring protein is required for Protein kinase A regulatory subunit ... Akap200 is a potentially mobile, chimeric A kinase anchor protein-myristoylated alanine-rich C kinase substrate protein that ... A kinase anchor protein 75 targets regulatory (RII) subunits of cAMP-dependent protein kinase II to the cortical actin ... Signaling at A-kinase anchoring proteins organizes anesthesia-sensitive memory in Drosophila. The ubiquitous cAMP-protein ...
Two scaffold proteins, the centrosomal and Golgi N-kinase anchoring protein (CG-NAP; also known as AKAP450) and the DEAD-box ... Centrosomal anchoring of the protein kinase CK1delta mediated by attachment to the large, coiled-coil scaffolding protein CG- ... Because CK1 isoforms are thought to be constitutively active protein kinases, the ability of FAM83 proteins to anchor CK1 ... The FAM83 proteins anchor various isoforms of the constitutively active kinase CK1 to specific subcellular locations. ...
It cannot be excluded too that it may facilitate PKA as well as G protein signal transduction, by acting as an adapter for ... With its RGS domain, it could lead to the interaction to G-alpha proteins, providing a link between the signaling machinery and ... is phosphorylated and inactivated by mitochondria-anchored PKA. ... I and II regulatory subunits of protein kinase A and anchors ... "A systematic evaluation of protein kinase A-A-Kinase anchoring protein interaction motifs.". Burgers P.P., van der Heyden M.A. ...
Anchors them to the cytoplasmic face of the mitochondrial outer membrane or allows them to reside in the endoplasmic reticulum ... Differentially targeted protein that binds to type I and II regulatory subunits of protein kinase A. ... Differentially targeted protein that binds to type I and II regulatory subunits of protein kinase A. Anchors them to the ... "Identification of a novel protein kinase A anchoring protein that binds both type I and type II regulatory subunits.". Huang L. ...
View mouse Akap8l Chr17:32321425-32350581 with: sequences, polymorphisms, proteins, references, function, expression
Synonyms: A-kinase anchor protein 350 kDa, A-kinase anchor protein 450 kDa, A-kinase anchor protein 9, AKAP 120-like protein, ... AKAP350, a multiply spliced protein kinase A-anchoring protein associated with centrosomes. Schmidt, P.H., Dransfield, D.T., ... Association of immature hypophosphorylated protein kinase cepsilon with an anchoring protein CG-NAP. Takahashi, M., Mukai, H., ... Cloning and characterization of a cDNA encoding an A-kinase anchoring protein located in the centrosome, AKAP450. Witczak, O., ...
... anchor protein (yotiao) 9), Authors: Raffaele Ciampi, Yuri E Nikiforov. Published in: Atlas Genet Cytogenet Oncol Haematol. ... of cAMP dependent Protein Kinase A (PKA) and several other protein kinases and phosphatases and to anchor them to specific ... phosphorylation protein kinase A regulatory subunit binding protein kinase A regulatory subunit binding protein kinase A ... phosphorylation protein kinase A regulatory subunit binding protein kinase A regulatory subunit binding protein kinase A ...
Signaling at A-Kinase Anchoring Proteins Organizes Anesthesia-Sensitive Memory in Drosophila. Martin Schwaerzel, Andrea Jaeckel ... Signaling at A-Kinase Anchoring Proteins Organizes Anesthesia-Sensitive Memory in Drosophila ... Signaling at A-Kinase Anchoring Proteins Organizes Anesthesia-Sensitive Memory in Drosophila ... Signaling at A-Kinase Anchoring Proteins Organizes Anesthesia-Sensitive Memory in Drosophila ...
... pathophysiological role as well as highlights the potential benefits of targeting these proteins and their protein-protein ... A-kinase anchoring proteins (AKAPs) and cyclic nucleotide phosphodiesterases (PDEs) are essential enzymes in the cyclic ... "Roles of A-Kinase Anchoring Proteins and Phosphodiesterases in the Cardiovascular System." J. Cardiovasc. Dev. Dis. 5, no. 1: ... Roles of A-Kinase Anchoring Proteins and Phosphodiesterases in the Cardiovascular System. Maria Ercu 1. ...
A-kinase anchoring proteins (AKAPs) directly bind PKA and recruit it to specific subcellular loci targeting the kinase activity ... A-kinase anchoring proteins (AKAPs) directly bind PKA and recruit it to specific subcellular loci targeting the kinase activity ... Here, we will focus on mechanisms for targeting protein-protein interaction, disruptors that modulate down-stream cAMP ... Here, we will focus on mechanisms for targeting protein-protein interaction, disruptors that modulate down-stream cAMP ...
Roles of A-kinase anchoring proteins and phosphodiesterases in the cardiovascular system Eintrag beim MDC-Dokumentenserver ... A-kinase anchoring proteins (AKAPs) and cyclic nucleotide phosphodiesterases (PDEs) are essential enzymes in the cyclic ... pathophysiological role as well as highlights the potential benefits of targeting these proteins and their protein-protein ...
... anchored via an A kinase anchoring protein (AKAP). Here we report the isolation, primary sequence determination, and functional ... voltage-dependent potentiation of skeletal muscle L-type calcium channels requires phosphorylation by cAMP-dependent protein ... anchored via an A kinase anchoring protein (AKAP). Here we report the isolation, primary sequence determination, and functional ... Primary structure and function of an A kinase anchoring protein associated with calcium channels Neuron. 1998 May;20(5):1017-26 ...
Anchoring, scaffolding and adapter proteins function to enhance the precision and directionality of these signaling events by ... A fundamental role for protein-protein interactions in the organization of signal transduction pathways is evident. ... The cAMP signaling pathway is organized by A-kinase anchoring proteins. This family of proteins assembles enzyme complexes ... Selected A-kinase anchoring protein signaling complexes are highlighted in this minireview. ...
cAMP signals are locally amplified by scaffold proteins (A Kinase Anchor Proteins, AKAPs) that tether cAMP-dependent Protein ... Abstract 1231: Competitive Displacement of A Kinase Anchor Protein 121 From Mitochondria Triggers DNA Damage And Lowers ... Abstract 1231: Competitive Displacement of A Kinase Anchor Protein 121 From Mitochondria Triggers DNA Damage And Lowers ... Abstract 1231: Competitive Displacement of A Kinase Anchor Protein 121 From Mitochondria Triggers DNA Damage And Lowers ...
... which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to ... The DH domain is associated with guanine nucleotide exchange activation for the Rho/Rac family of small GTP binding proteins, ... Therefore, these isoforms function as scaffolding proteins to coordinate a Rho signaling pathway and, in addition, function as ... The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, ...
... anchor protein 10)*CCDS: 24821, 24821.1*OMIM: CARDIAC CONDUCTION DEFECT, LONGEVITY, A-KINASE ANCHOR PROTEIN 10; AKAP10*Gene ... A kinase (PRKA) anchor protein 10. Synonyms: 1500031L16Rik, B130049N18Rik, D-AKAP2. Gene nomenclature, locus information, and ...
A kinase (PRKA) anchor protein 6 explanation free. What is A kinase (PRKA) anchor protein 6? Meaning of A kinase (PRKA) anchor ... What does A kinase (PRKA) anchor protein 6 mean? ... Looking for online definition of A kinase (PRKA) anchor protein ... A kinase (PRKA) anchor protein 6 , definition of A kinase (PRKA) anchor protein 6 by Medical dictionary https://medical- ... anchor protein 6) AKAP6. A gene on chromosome 14q12 that encodes a member of the structurally diverse A-kinase anchor protein ( ...
Cav1.2 forms a complex with the beta2-adrenergic receptor, the trimeric GS protein, adenyl … ... The cAMP-dependent protein kinase (PKA) regulates a wide array of cellular functions. In brain and heart PKA increases the ... Critical role of cAMP-dependent protein kinase anchoring to the L-type calcium channel Cav1.2 via A-kinase anchor protein 150 ... Here we demonstrate that the A-kinase anchor protein 150 (AKAP150) is critical for PKA-mediated regulation of Cav1.2 in the ...
... Wang, Mojin Sichuan ... Background and AimPreviously study showed that the loss of the control of cAMP-dependent protein kinase A RI (PKA RI)/ A-kinase ... A notably higher level of AKAP10 expression was found in CRC tissues at both mRNA and protein levels. Increased expression of ... anchoring proteins 10 (AKAP10) signaling pathway initiate dysregulation of cellular healthy physiology leading to tumorigenesis ...
FERONIA receptor kinase interacts with phosphatidylinositol-anchored proteins LORELEI and LLG1 to ensure its proper functional ... Protein-protein interaction assays. Request a detailed protocol For protein pull-downs, bait proteins (MBP-LLG1, MBP-LRE1, MBP- ... Glycosylphosphatidylinositol-anchored proteins as chaperones and co-receptors for FERONIA receptor kinase signaling in ... 2013) Recent progress in synthetic and biological studies of GPI anchors and GPI-anchored proteins Current Opinion in Chemical ...
... we found that internalization of CD59 was prevented by the protein kinase C inhibitor staurosporine and by the protein kinase A ... Endocytosis of GPI-anchored proteins in human lymphocytes: role of glycolipid-based domains, actin cytoskeleton, and protein ... Endocytosis of GPI-anchored proteins in human lymphocytes: role of glycolipid-based domains, actin cytoskeleton, and protein ... This process, which is regulated by both protein kinase C and A activity, is tightly controlled by the dynamic organization of ...
... protein kinase A anchoring protein 1 explanation free. What is protein kinase A anchoring protein 1? Meaning of protein kinase ... A anchoring protein 1 medical term. What does protein kinase A anchoring protein 1 mean? ... Looking for online definition of protein kinase A anchoring protein 1 in the Medical Dictionary? ... Protein kinase A anchoring protein 1 , definition of protein kinase A anchoring protein 1 by Medical dictionary https://medical ...
The encoded protein binds to type I and type II regulatory subunits of PKA and anchors them to the mitochondrion. This protein ... which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to ... The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, ... Protein kinase A1; D-AKAP-1; A-kinase anchor protein 149 kDa; protein kinase A anchoring protein 1; spermatid A-kinase anchor ...
... illustrating that AKAP13 is an essential protein in this process. We show that the PKA-anchoring protein AKAP13 is essential ... A signalling cascade that leads to tamoxifen resistance is dictated by activation of the Protein Kinase A (PKA) pathway, which ... Thus far, it remains elusive what protein complexes enable the PKA-ERα interaction resulting in ERα Serine 305 phosphorylation ... From: Protein Kinase A-induced tamoxifen resistance is mediated by anchoring protein AKAP13 ...
  • The A-kinase anchoring proteins or A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. (wikipedia.org)
  • AKAPs act as scaffold proteins wherein they bind PKA and other signaling proteins and physically tether these multi-protein complexes to specific locations, such as the nucleus, in cells. (wikipedia.org)
  • The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. (nih.gov)
  • Though first identified by their role in localizing the pleiotropic cAMP-dependent protein kinase A ( PKA ) to specific intracellular organelles and compartments, A-kinase-anchoring proteins ( AKAPs ) are a structurally and functionally diverse family of multivalent scaffolds that organize "signalosomes" constituting critical nodes in the cell-type-specific network of intracellular signaling pathways. (springer.com)
  • This sequestration is achieved through A-kinase anchoring proteins (AKAPs), a heterogeneous family of proteins that bind to PKA regulatory subunits and anchor PKA holoenzyme (Scott, 1994). (sdbonline.org)
  • Although the physiological relevance between PKA and AKAPS with mitochondria is not fully understood, one idea is that BAD, a proapoptotic member, is phosphorylated and inactivated by mitochondria-anchored PKA. (uniprot.org)
  • AKAP9 belongs to the family of A-Kinase Anchor Proteins (AKAPs), which are scaffold proteins able to bind the type II regulatory subunit (RII) of cAMP dependent Protein Kinase A (PKA) and several other protein kinases and phosphatases and to anchor them to specific intracellular compartments. (atlasgeneticsoncology.org)
  • A-kinase anchoring proteins (AKAPs) and cyclic nucleotide phosphodiesterases (PDEs) are essential enzymes in the cyclic adenosine 3'-5' monophosphate (cAMP) signaling cascade. (mdpi.com)
  • This review provides an overview over the AKAPs and PDEs relevant for cAMP compartmentalization in the heart and vasculature and discusses their pathophysiological role as well as highlights the potential benefits of targeting these proteins and their protein-protein interactions for the treatment of cardiovascular diseases. (mdpi.com)
  • A-kinase anchoring proteins (AKAPs) directly bind PKA and recruit it to specific subcellular loci targeting the kinase activity toward particular substrates, and thereby provide discrete spatiotemporal control of downstream phosphorylation events. (frontiersin.org)
  • AKAPs also scaffold other signaling molecules into multi-protein complexes that function as crossroads between different signaling pathways. (frontiersin.org)
  • Additionally, cAMP signalosomes targeted to specific subcellular locales by A-kinase anchoring proteins (AKAPs) bring together signal initiators, effector and terminators in supramolecular signaling complexes. (frontiersin.org)
  • cAMP signals are locally amplified by scaffold proteins (A Kinase Anchor Proteins, AKAPs) that tether cAMP-dependent Protein Kinase A (PKA) to discrete cellular locations. (ahajournals.org)
  • These results demonstrate the physiological relevance of PKA anchoring by AKAPs in general and AKAP150 specifically in the regulation of Cav1.2 in vivo. (nih.gov)
  • Although cAMP elevation may occur over a large area of a target-organ cell, its effects are often more restricted due to local concentration of its main effector, protein kinase A (PKA), through A-kinase anchoring proteins (AKAPs). (deepdyve.com)
  • A-kinase anchoring proteins (AKAPs) include a family of scaffolding proteins that target protein kinase A (PKA) and other signaling proteins to cellular compartments and thereby confine the activities of the associated proteins to distinct regions within cells. (uni-regensburg.de)
  • A-kinase anchoring proteins (AKAPs) shape second-messenger signaling responses by constraining protein kinase A (PKA) at precise intracellular locations. (elsevier.com)
  • Mining patient-derived databases has identified 42 nonsynonymous SNPs in the PKA-anchoring helices of five AKAPs. (elsevier.com)
  • One family of diverse, well-studied scaffolding proteins are the A- kinase anchoring proteins (AKAPs). (nialoasacomhigh.ml)
  • One set of scaffolding molecules that organize such complexes is a family of proteins known as A- kinase - anchoring proteins (AKAPs). (nialoasacomhigh.ml)
  • Compartmentalization of the cAMP-dependent protein kinase (PKA) is coordinated through association with A- kinase anchoring proteins (AKAPs). (nialoasacomhigh.ml)
  • A- kinase - anchoring proteins (AKAPs) compartmentalize cAMP signaling by establishing protein complexes. (nialoasacomhigh.ml)
  • Compartmentalization of intracellular signaling is maintained by scaffolding proteins, such as A- kinase anchoring proteins (AKAPs). (nialoasacomhigh.ml)
  • The tethering of PKA to subcellular compartments by protein kinase A anchoring proteins (AKAPs) is a prerequisite for the AQP2 shuttle. (nialoasacomhigh.ml)
  • Protein kinase A (PKA) in vertebrates is localized to specific locations in the cell via A- kinase anchoring proteins (AKAPs). (nialoasacomhigh.ml)
  • The PKG binding proteins were distinct from AKAPs, proteins known to bind the cAMP-dependent protein kinase (PKA). (elsevier.com)
  • Preferential phosphorylation of specific proteins by cAMP-dependent protein kinase (PKA) may be mediated in part by the anchoring of PKA to a family of A-kinase anchor proteins (AKAPs) positioned in close proximity to target proteins. (pnas.org)
  • In support of this, RII subunits have been shown to bind to a family of A-kinase anchor proteins (AKAPs) ( 4 , 5 ). (pnas.org)
  • It is therefore possible that AKAPs act as a scaffold for multiple kinases and phosphatases, adding another level of complexity to cAMP-mediated signal transduction. (pnas.org)
  • Cyclic AMP-dependent protein kinase (PKA) is anchored at specific subcellular sites through the interaction of the regulatory subunit (R) with protein kinase A-anchoring proteins (AKAPs) via an amphipathic helix binding motif. (elsevier.com)
  • These data suggest that the interaction of the regulatory subunit of PKA with sperm AKAPs, independent of PKA catalytic activity, is a key regulator of sperm motility and that disruption of this interaction using cell-permeable anchoring inhibitor peptides may form the basis of a sperm-targeted contraceptive. (elsevier.com)
  • A-kinase anchor proteins (AKAPs) assemble multi-enzyme signaling complexes in proximity to substrate/effector proteins, thus directing and amplifying membrane-generated signals. (elsevier.com)
  • These AKAPs bind and target protein kinase A (PKA) to the outer mitochondrial membrane. (elsevier.com)
  • AKAPs tether the main effector of cAMP, cAMP-dependent protein kinase (protein kinase A, PKA), to cellular compartments, and thereby limit its access to a subset of its substrates. (pharmacologicalsciences.us)
  • AKAPs also bind protein phosphatases dephosphorylating PKA substrates and thereby terminate PKA signalling. (pharmacologicalsciences.us)
  • In addition to PKA, PDEs and protein phosphatases involved in cAMP signalling, AKAPs bind further signalling proteins, including other kinases, such as protein kinases C (PKC) and D (PKD), and other protein phosphatases, such as calcium/calmodulin-dependent phosphatase (calcineurin, protein phosphatase 2B, PP2B) (Carnegie et al. (pharmacologicalsciences.us)
  • This review focuses on A-kinase anchoring proteins (AKAPs) which are expressed in the heart. (kent.edu)
  • A-kinase anchoring proteins or AKAPs are known to influence the spatial distribution of kinases within the cell, crucial enzymes that control important molecular events related to the regulation of glucose levels in the blood. (innovations-report.com)
  • In a new study published in The EMBO Journal, the team of researchers led by Simon Hinke and John Scott reveal for the first time that AKAPs influence the levels of glucose in the body by coordinating the spatial positioning of phosphatases, naturally occurring enzymes that counteract the effects of kinase enzymes. (innovations-report.com)
  • Experiments were designed to test the idea that A kinase anchor proteins (AKAPs) tether regulatory subunits (RII) of protein kinase AII (PKAII) isoforms to surfaces of organelles that are bounded by phospholipid bilayers. (elsevier.com)
  • Mining of patient datasets has uncovered genetic variation in A-kinase anchoring proteins (AKAPs) that promotes mislocalization of protein kinase A (PKA). (pnas.org)
  • An unexpected outcome is the discovery of an alternative targeting mechanism for AKAPs that utilizes the intact PKA holoenzymes as cytoplasmic "anchors. (pnas.org)
  • For example, the cAMP-dependent protein kinase is tethered at specific intracellular locations through association with A-kinase anchoring proteins (AKAPs). (elsevier.com)
  • To date, one of the best-studied examples of kinase anchoring is the targeting of protein kinase A to cellular locations through its association with A-kinase anchoring proteins (AKAPs). (elsevier.com)
  • AKAPs mediate a high-affinity interaction with the type II regulatory subunit of protein kinase A for the purpose of localizing the kinase to pools of cyclic adenosine monophosphate and within proximity of preferred substrates. (elsevier.com)
  • Furthermore, AKAPs can organize entire signaling complexes made up of kinases, phosphatases, signaling enzymes, and additional regulatory proteins. (elsevier.com)
  • In fact all cells that have been investigated contain a variety of AKAPs [ 18 , 19 ], which serve to localize cAMP-dependent protein kinase (PKA) to different compartments within the cell and thereby restrict phosphorylation of target proteins and the resultant signal cascades to distinct regions within the cell. (biomedcentral.com)
  • One general mechanism believed to make PKA signaling more effective is the use of A-kinase anchoring proteins (AKAPs) to recruit PKA to discrete subcellular compartments, which coordinates and focuses PKA action with respect to its substrates. (northwestern.edu)
  • Efficient phosphorylation requires that PKA be anchored close to its targets by A-kinase anchoring proteins (AKAPs). (biomedcentral.com)
  • Protein kinase A (PKA) is targeted to distinct subcellular localizations by specific protein kinase A anchoring proteins (AKAPs). (uky.edu)
  • Compartmentalization of kinases in general is achieved by either direct docking of the kinase on the target protein, or by anchoring of the kinase to, or close to, the target via an adaptor protein, named A-kinase anchoring proteins or AKAPs in the case of PKA [ 11 ]. (biomedcentral.com)
  • The activity of cAMP-dependent protein kinase (PKA) depends on A-kinase anchoring proteins (AKAPs) through protein interactions. (beds.ac.uk)
  • This specificity is largely achieved by binding of PKA to protein scaffolds, whereby a distinct group of proteins called A kinase anchoring proteins (AKAPs) play a dominant role. (mcponline.org)
  • AKAPs are a diverse family of proteins that all bind via a small PKA binding domain to the regulatory subunits of PKA. (mcponline.org)
  • Some of the best described scaffolding proteins are the so-called A-kinase anchoring proteins (AKAPs), which all bind specifically to the N-terminal dimerization domain of the PKA regulatory domain. (mcponline.org)
  • PKA enzyme is targeted to specific cellular organelles or membranes through interaction with A-kinase anchor proteins (AKAPs). (portlandpress.com)
  • Rapid, voltage-dependent potentiation of skeletal muscle L-type calcium channels requires phosphorylation by cAMP-dependent protein kinase (PKA) anchored via an A kinase anchoring protein (AKAP). (nih.gov)
  • This family of proteins assembles enzyme complexes containing the cAMP-dependent protein kinase, phosphoprotein phosphatases, phosphodiesterases and other signaling effectors to optimize cellular responses to cAMP and other second messengers. (ovid.com)
  • The cAMP-dependent protein kinase (PKA) regulates a wide array of cellular functions. (nih.gov)
  • Background and AimPreviously study showed that the loss of the control of cAMP-dependent protein kinase A RI (PKA RI)/ A-kinase anchoring proteins 10 (AKAP10) signaling pathway initiate dysregulation of cellular healthy physiology leading to tumorigenesis. (diva-portal.org)
  • Previous physiological and pharmacological experiments have demonstrated that the Chlamydomonas flagellar axoneme contains a cAMP-dependent protein kinase (PKA) that regulates axonemal motility and dynein activity. (rupress.org)
  • The goal of this study is to determine the mechanism for localization of the cAMP-dependent protein kinase (PKA) in ciliary and flagellar axonemes. (rupress.org)
  • Protein kinases such as cAMP‐dependent protein kinase (PKA), protein kinase C (PKC), and Ca 2+ /calmodulin‐dependent protein kinase II (CaM kinase II) phosphorylate many substrate proteins in order to coordinate diverse cellular responses to extracellular signals. (embopress.org)
  • Following the hormonal elevation of cAMP, phosphorylation of protein substrates by cAMP-dependent protein kinase (PKA) influences many physiological processes, including cellular differentiation, metabolism, and ion channel activity. (pnas.org)
  • Sphingosine kinase interacting protein is an A-kinase anchoring protein specific for type I cAMP-dependent protein kinase. (uniprot.org)
  • Multivalent scaffold protein that anchors the cAMP-dependent protein kinase/PKA to cytoskeletal and/or organelle-associated proteins, targeting the signal carried by cAMP to specific intracellular effectors (PubMed:1512224). (genecards.org)
  • This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. (genecards.org)
  • Targets the cAMP-dependent protein kinase (PKA) to the plasma membrane, and permits functional coupling to the L-type calcium channel. (genecards.org)
  • Probably targets cAMP-dependent protein kinase (PKA) to the cellular membrane or cytoskeletal structures. (genecards.org)
  • Collectively, these data suggest that a domain containing spectrin-like repeats mediates targeting of the anchoring protein mAKAP and the cAMP-dependent protein kinase holoenzyme to the nuclear membrane in response to differentiation signals. (elsevier.com)
  • The cAMP-signalling pathway plays a central role in many developmental processes in eukaryotes, by activating molecules such as the cAMP-dependent protein kinase (PKA). (beds.ac.uk)
  • PKA is also known as cAMP-dependent protein kinase (EC 2.7.11.11). (wikipedia.org)
  • The following human genes encode PKA subunits: catalytic subunit - PRKACA, PRKACB, PRKACG regulatory subunit type I - PRKAR1A, PRKAR1B regulatory subunit type II - PRKAR2A, PRKAR2B PKA is also commonly known as cAMP-dependent protein kinase, because it has traditionally been thought to be activated through release of the catalytic subunits when levels of the second messenger called cyclic adenosine monophosphate, or cAMP, rise in response to a variety of signals. (wikipedia.org)
  • Widely used inhibitors of cAMP-dependent protein kinase (PKA) have nonspecific side effects. (sciencemag.org)
  • The principal target of cAMP is cAMP-dependent protein kinase (PKA) 1 . (mcponline.org)
  • Mechanistically, it is known that GLP-1 increases cyclic AMP in pancreatic β-cells by its action on the Gs-coupled GLP-1 receptor, which in turn, activates cAMP-dependent protein kinase A (PKA) ( 21 ). (diabetesjournals.org)
  • Your search returned 5 A kinase (PRKA) anchor protein 4 Biomolecules across 3 suppliers. (biocompare.com)
  • Your search returned 56 A kinase (PRKA) anchor protein 1 ELISA ELISA Kit across 2 suppliers. (biocompare.com)
  • These mAKAP6 fl mutant mice possess loxP sites flanking exon 9 of the A kinase (PRKA) anchor protein 6 ( Akap6 ) gene, a scaffold protein located in the nuclear envelope of striated myocytes. (jax.org)
  • Chen L, Kurokawa J, Kass RS (2005) Phosphorylation of the A-kinase-anchoring protein Yotiao contributes to protein kinase A regulation of a heart potassium channel. (springer.com)
  • Cyclic AMP is a ubiquitous intracellular second messenger involved in the regulation of a wide variety of cellular processes, a majority of which act through the cAMP - protein kinase A (PKA) signaling pathway and involve PKA phosphorylation of specific substrates. (frontiersin.org)
  • Here, we report that the PKA-RII-specific AKAP inhibitory peptide AKAP-IS perturbs the distribution of PKA-RII and diminishes the PKA-dependent phosphorylation of HERG protein. (deepdyve.com)
  • The beta 2 adrenergic receptor (beta 2AR) undergoes desensitization by a process involving its phosphorylation by both protein kinase A (PKA) and G protein-coupled receptor kinases (GRKs). (caltech.edu)
  • The protein kinase A-anchoring protein AKAP79 influences beta 2AR phosphorylation by complexing PKA with the receptor at the membrane. (caltech.edu)
  • Regulates insulin-dependent IRS1 tyrosine phosphorylation in adipocytes by modulating the availability of IRS1 to IR tyrosine kinase . (nialoasacomhigh.ml)
  • It has been proposed that the selective phosphorylation of specific proteins by PKA is achieved in part by the subcellular compartmentalization of PKA ( 2 ). (pnas.org)
  • However, little is known about the molecular organization of the TRPV1 phosphorylation complex and specifically about scaffolding proteins that position the protein kinase A (PKA) holoenzyme proximal to TRPV1 for effective and selective regulation of the receptor. (elsevier.com)
  • As a scaffolding protein for Protein Kinases A and C (PKA and PKC, respectively), AKAP facilitates phosphorylation and sensitization of TRPA1 in ex vivo sensory neuronal preparations. (utsystem.edu)
  • Cardiac contractility is regulated by dynamic phosphorylation of sarcomeric proteins by kinases such as cAMP-activated protein kinase A (PKA). (biomedcentral.com)
  • Cardiac Myosin Binding Protein-C (cMyBPC) and cardiac troponin I (cTNI) are hypertrophic cardiomyopathy (HCM)-causing sarcomeric proteins which regulate contractility in response to PKA phosphorylation. (biomedcentral.com)
  • AKAP79 or 150 serves as an adapter that brings the anchored C-kinase to the substrate KCNQ channel to permit the rapid and 'definitive' phosphorylation of serine residues, resulting in avoidance of signal dispersion. (elsevier.com)
  • As phosphorylation could be involved in the regulation of protein complexes, both PfAKAL and Pf14-3-3I phosphorylation was studied using a radiolabel kinase activity assay. (beds.ac.uk)
  • Protein phosphorylation is one of the most common post-translational modifications involved in cellular communication. (beds.ac.uk)
  • The phosphorylation status of a protein is determined by the balance between the activities of kinases and phosphatases. (beds.ac.uk)
  • the interaction with 14-3-3 proteins requires phosphorylation on Thr-735 and, sequesters ABL1 into the cytoplasm. (rcsb.org)
  • PIN-mediated auxin transport is critically dependent on phosphorylation by protein kinases ( Barbosa and Schwechheimer, 2014 ). (biologists.org)
  • phosphodiesterases (PDEs) which break down cAMP, phosphatases which dephosphorylate downstream PKA targets and also other kinases (PKC and MAPK). (wikipedia.org)
  • Scaffolding protein that assembles several protein kinases and phosphatases on the centrosome and Golgi apparatus. (rcsb.org)
  • To promote both efficiency and selectivity, many protein kinases and phosphatases are maintained in specific subcellular microenvironments through their association with anchoring proteins. (elsevier.com)
  • Included in these are the beta adrenergic receptor (AR), adenylyl cyclase (AC), L-type voltage-gated Ca2+ stations (Cav1.2, Cav1.3) proteins kinases A and C (PKA, PKC), and proteins phosphatases amongst others [3-5]. (healthyfutureforkids.com)
  • Protein tyrosine phosphatases (PTP) attenuate growth signals generated by the PTKs through catalyzing the tyrosine dephosphorylation step on their substrate proteins. (sigmaaldrich.com)
  • It appears that for such events a supramolecular complex is required that comprises of the appropriate effector system together with signal termination enzymes such as PDEs and phosphatases that are sequestered by scaffolding proteins ( 4 ). (mcponline.org)
  • The dimerization and docking (D/D) domain of the regulatory subunit dimer of PKA binds with the A-kinase binding (AKB) domain (an amphipathic helix) of AKAP. (wikipedia.org)
  • RII-binding site, predicted to form an amphipathic helix, could participate in protein-protein interactions with a complementary surface on the R-subunit dimer. (rcsb.org)
  • A gene on chromosome 14q12 that encodes a member of the structurally diverse A-kinase anchor protein (AKAP) family, which binds to the regulatory subunit of protein kinase A (PKA), confining the enzyme to discrete locations within the cell. (thefreedictionary.com)
  • This modification increases Gbeta gamma subunit binding to GRK2 and thus enhances the ability of the kinase to translocate to the membrane and phosphorylate the receptor. (caltech.edu)
  • An A- kinase anchoring protein is required for Protein kinase A regulatory subunit localization and morphology of actin structures during oogenesis in Drosophila. (nialoasacomhigh.ml)
  • We hypothesized that the targeted disruption of the gene for the ubiquitously expressed RIIα subunit would reveal those tissues and signaling events that require anchored PKA. (pnas.org)
  • Nonetheless, a reduction in both catalytic (C) subunit protein levels and total kinase activity was observed. (pnas.org)
  • In addition to binding to the RII subunit of PKA, AKAP 79 interacts with the calcium and calmodulin-dependent protein phosphatase 2B (calcineurin) and protein kinase C through sites distinct from the RII binding site ( 7 , 8 ). (pnas.org)
  • Anchoring protein that binds preferentially to the type I regulatory subunit of c-AMP-dependent protein kinase (PKA type I) and targets it to distinct subcellular compartments. (uniprot.org)
  • The localization and association of PKA RII, the regulatory subunit II of protein kinase A, tyrosine kinase Abl, and small GTPase RAC1 were also explored. (northwestern.edu)
  • The encoded protein binds to the RII-beta regulatory subunit of PKA, and also to protein. (genecards.org)
  • Rdhs identified in Dehalococcoides and other dehalorespiring bacteria consist of a catalytic subunit (RdhA) encoded by the rdhA gene and membrane-anchoring protein (RdhB) encoded by rdhB neighboring to rdhA [ 13 , 14 ]. (hindawi.com)
  • MGAM and SI are anchored to the small intestinal brush-border epithelial cells, and each contains a catalytic N- and C-terminal subunit. (medicalxpress.com)
  • In 1991, Susan Taylor and colleagues crystallized the PKA Cα subunit, which revealed the bi-lobe structure of the protein kinase core for the very first time, providing a blueprint for all the other protein kinases in a genome (the kinome). (wikipedia.org)
  • The catalytic subunit contains the active site, a series of canonical residues found in protein kinases that bind and hydrolyse ATP, and a domain to bind the regulatory subunit. (wikipedia.org)
  • The Gs alpha subunit of the stimulated G protein complex exchanges GDP for GTP in a reaction catalyzed by the GPCR and is released from the complex. (wikipedia.org)
  • Once released from inhibitory regulatory subunit, the catalytic subunits can go on to phosphorylate a number of other proteins in the minimal substrate context Arg-Arg-X-Ser/Thr. (wikipedia.org)
  • Below is a list of the steps involved in PKA activation: Cytosolic cAMP increases Two cAMP molecules bind to each PKA regulatory subunit The regulatory subunits move out of the active sites of the catalytic subunits and the R2C2 complex dissociates The free catalytic subunits interact with proteins to phosphorylate Ser or Thr residues. (wikipedia.org)
  • targets protein kinase A (PKA) catalytic and regulatory subunits and protein phosphatase 1 (PP1), to the heterodimer KCNQ1 - KCNE1 (PubMed:11799244). (rcsb.org)
  • In the absence of cAMP, inactive Protein kinase A is a holoenzyme (PKA), a heterotetramer of two identical catalytic subunits (Pka-C) and two identical regulatory subunits (Pka-R). When cAMP is present, it binds to the regulatory subunits and releases catalytic subunits from the holoenzyme, allowing phosphorylation of target substrates. (sdbonline.org)
  • Once activated, the catalytic subunits are capable of phosphorylating a large number of protein substrates, both in vitro and in vivo (Jackson, 2002 and references therein). (sdbonline.org)
  • Differentially targeted protein that binds to type I and II regulatory subunits of protein kinase A and anchors them to the mitochondria or the plasma membrane. (uniprot.org)
  • Differentially targeted protein that binds to type I and II regulatory subunits of protein kinase A. Anchors them to the cytoplasmic face of the mitochondrial outer membrane or allows them to reside in the endoplasmic reticulum. (uniprot.org)
  • A gene on chromosome 17q21-q23 that encodes a member of the structurally diverse A-kinase anchor protein (AKAP) family, which binds type-I and -II regulatory subunits of protein kinase A, anchoring them to the cytoplasmic face of the mitochondrial outer membrane. (thefreedictionary.com)
  • The encoded protein binds to type I and type II regulatory subunits of PKA and anchors them to the mitochondrion. (creativebiomart.net)
  • Regulation, localization, and anchoring of protein kinase A subunits during mouse sperm capacitation. (umassmed.edu)
  • The RII subunits (RIIα and RIIβ) are postulated to anchor PKA holoenzyme to subcellular compartments thereby positioning PKA in close proximity to its substrates ( 3 ). (pnas.org)
  • A-kinase anchor proteins bind to the regulatory subunits of protein kinase A (PKA) and confine the holoenzyme to discrete locations within the cell. (nih.gov)
  • The encoded protein is localized to mitochondria and interacts with both the type I and type II regulatory subunits of PKA. (nih.gov)
  • Chen, Q, Lin, RY & Rubin, CS 1997, ' Organelle-specific targeting of protein kinase AII (PKAII): Molecular and in situ characterization of murine A kinase anchor proteins that recruit regulatory subunits of PKAII to the cytoplasmic surface of mitochondria ', Journal of Biological Chemistry , vol. 272, no. 24, pp. 15247-15257. (elsevier.com)
  • To investigate this possibility, we assessed the ability of MMGL isoform 4 to interact with PKA regulatory subunits R1A and R2A using Y2H-based direct protein-protein interaction assays. (biomedcentral.com)
  • A high concentration of cAMP interacting with regulatory subunits liberates catalytic subunits of PKA (PKA-C) to phosphorylate its target proteins. (beds.ac.uk)
  • out of 540 different protein kinase genes that make up for human kinome, only one other protein kinase, casein kinase 2, is known to exist in a physiological tetrameric complex, meaning it is made up of four subunits. (wikipedia.org)
  • Mammalian cells have at least two types of PKAs: type I is mainly in the cytosol, whereas type II is bound via its regulatory subunits and special anchoring proteins, described in the anchorage section, to the plasma membrane, nuclear membrane, mitochondrial outer membrane, and microtubules. (wikipedia.org)
  • In both types, once the catalytic subunits are freed and active, they can migrate into the nucleus (where they can phosphorylate transcription regulatory proteins), while the regulatory subunits remain in the cytoplasm. (wikipedia.org)
  • without ATP binding, the catalytic subunits are unable to phosphorylate target proteins. (sciencemag.org)
  • We identified members of the FAM83 family of proteins as partners of CK1 in cells. (sciencemag.org)
  • A family of proteins called glycosylphosphatidylinositol-anchored proteins (GPI-APs for short) play important roles in plants, animals, and other eukaryotic organisms. (elifesciences.org)
  • These findings show that FERONIA is able to perform different roles in cells by teaming up with different members of the GPI-AP family of proteins. (elifesciences.org)
  • Also, evidence is emerging that besides G protein inhibition, they can enhance G protein activation, serve as effectors, and act as scaffold proteins to gather receptors, G proteins, effectors, and other regulatory molecules together. (aspetjournals.org)
  • Interacts with chloride intracellular channel proteins CLIC1 , CLIC4 and CLIC5 (PubMed:12163479). (rcsb.org)
  • Protein kinase A, a ubiquitous, highly conserved serine-threonine kinase, is a key intracellular transducer of many hormonal and other extracellular signals. (sdbonline.org)
  • Thus, naturally occurring PKA-anchoring-defective AKAP variants not only perturb dissemination of local second-messenger responses, but also may influence the intracellular distribution of certain AKAP18 isoforms. (elsevier.com)
  • In rat hippocampal neurons NFAT signaling is set up via AKAP79/150-anchored Cav1.2-mediated increases in intracellular Ca2+, PP2B activation and NFAT dephosphorylation, allowing NFAT translocation towards the nucleus where it regulates gene transcription. (healthyfutureforkids.com)
  • The receptor exerts excitatory effects through its positive coupling to heterotrimeric Gs proteins to activate adenylyl cyclases and to induce robust increases of intracellular adenosine 3′,5′-monophosphate (cAMP) levels ( 6 , 7 ). (sciencemag.org)
  • Pathogens can highjack ABL1 kinase signaling to reorganize the host actin cytoskeleton for multiple purposes, like facilitating intracellular movement and host cell exit. (rcsb.org)
  • Extracellular hormones, such as glucagon and epinephrine, begin an intracellular signalling cascade that triggers protein kinase A activation by first binding to a G protein-coupled receptor (GPCR) on the target cell. (wikipedia.org)
  • When a GPCR is activated by its extracellular ligand, a conformational change is induced in the receptor that is transmitted to an attached intracellular heterotrimeric G protein complex by protein domain dynamics. (wikipedia.org)
  • The presence of serine-threonine kinase and GTPase activities supports a role for LRRK2 in intracellular signaling cascades. (portlandpress.com)
  • Interacts with the regulatory region of protein kinase N (PKN), protein phosphatase 2A (PP2A), protein phosphatase 1 (PP1) and the immature non-phosphorylated form of PKC epsilon. (rcsb.org)
  • We propose that short MAPK‐binding stretches are created in disordered protein segments through a variety of ways and they represent a major resource for ancient signaling enzymes to acquire new regulatory roles. (embopress.org)
  • These simple protein‐protein recruitment sites represent a major resource for ancient signaling enzymes to acquire new regulatory roles. (embopress.org)
  • The expression of the steroidogenic acute regulatory protein (STAR) is regulated by PKA in response to trophic hormone stimulation through the second messenger cAMP. (northwestern.edu)
  • Splicing factor arginine/serine-rich 17A (SFRS17A) is an A-kinase anchoring protein that targets protein kinase A to splicing factor compartments. (nih.gov)
  • Proteins in every cellular compartments had been precipitated with TCA cleaned in acetone and examined by immunoblot using monoclonal antibodies. (mirc-undernet.org)
  • Thus, GPI anchors can function in protein trafficking in both early and late compartments of the secretory pathway in a variety of eukaryotic cells. (asm.org)
  • When S-AKAP84 was expressed in HEK293 cells, the anchor protein was targeted to mitochondria and excluded from other cell compartments. (elsevier.com)
  • Here we report the isolation, primary sequence determination, and functional characterization of AKAP15, a lipid-anchored protein of 81 amino acid residues with a single amphipathic helix that binds PKA. (nih.gov)
  • found that FERONIA binds to LLG1 in a compartment within the cell called the endoplasmic reticulum-where proteins are assembled-before both proteins are moved together to the cell membrane. (elifesciences.org)
  • Subsequently, a protein of the 14-3-3 family binds to the phosphorylated site and inhibits the RhoGEF activity (Diviani et al. (pharmacologicalsciences.us)
  • This study demonstrates that Sp17 from spermatozoa binds A-kinase anchoring protein 3 (AKAP3), confirming the functionality of the N-terminal domain. (21centurytoxicology.com)
  • Thus, the tethering region of the organelle-inserted anchor protein is properly oriented and avidly binds RII (PKAII) isoforms in intact cells. (elsevier.com)
  • Here, we show by a variety of protein interaction assays that SFRS17A binds both type I and type II PKA in vitro and inside cells, demonstrating that SFRS17A is a dual-specific AKAP. (uky.edu)
  • Interestingly, PfAKAL binds nucleotides such as AMP and cAMP, suggesting that this protein may be involved in the AMP-activated protein kinase (AMPK) pathway, or associated with phosphodiesterase activities. (beds.ac.uk)
  • We further show that D6PK directly binds polyacidic phospholipids through a polybasic lysine-rich motif in the middle domain of the kinase. (biologists.org)
  • Alternate splicing of this gene results in at least two isoforms that localize to the centrosome and the Golgi apparatus, and interact with numerous signaling proteins from multiple signal transduction pathways. (nih.gov)
  • We demonstrate that αKAP, a non‐kinase protein encoded by a gene within the gene of α‐CaM kinase II, can target the CaM kinase II holoenzyme to the SR membrane. (embopress.org)
  • CaM kinase II orchestrates many cellular functions in response to Ca 2+ ‐based signals, including neurotransmitter synthesis and release, membrane excitability, synaptic plasticity, cell cycle and gene expression (reviewed in Braun and Schulman, 1995 ). (embopress.org)
  • AKAP5 (A-Kinase Anchoring Protein 5) is a Protein Coding gene. (genecards.org)
  • This gene encodes a member of the A-kinase anchor protein family. (nih.gov)
  • Gene Ontology (GO) annotations related to this gene include nucleotide binding and protein kinase A binding . (genecards.org)
  • Mutations in each of these genes reduces the abundance of surface protein mRNA and the expression of the corresponding gene products. (mirc-undernet.org)
  • Mice that lacked the gene for the AKAP150 anchoring protein produced less insulin from beta cells in the islets of Langerhans. (innovations-report.com)
  • A-kinase anchor protein 4 (AKAP4) gene and protein expression was monitored by quantitative polymerase chain reaction (qPCR), reverse transcription (RT)-PCR and Western blotting in normal colon tissue lysate, normal colon epithelial cells and in colon cancer cell lines viz. (biomedcentral.com)
  • Our studies showed that AKAP4 gene and protein expression was expressed in all colon cancer cells while no expression was detectable in normal colon cells. (biomedcentral.com)
  • S-AKAP84, one of three RII-binding proteins encoded by a single-copy murine gene, was studied as a prototypic organelle-associated AKAP. (elsevier.com)
  • This is the case of A36R of Vaccinia virus, Tir (translocated intimin receptor) of pathogenic E.coli and possibly Citrobacter, CagA (cytotoxin-associated gene A) of H.pylori, or AnkA (ankyrin repeat-containing protein A) of A.phagocytophilum. (rcsb.org)
  • We have previously identified NFAT (nuclear factor of activated T-cells) as a key regulator of insulin gene transcription in pancreatic β-cells that is activated by the calcium/calmodulin-dependent protein phosphatase 2B (calcineurin) in response to increased [Ca 2+ ] i ( 10 ). (diabetesjournals.org)
  • Leucine-rich repeat kinase 2 ( LRRK2 ), a gene mutated in autosomal dominant Parkinson's disease (PD) and a risk locus for sporadic PD [ 1 , 2 ], encodes a large and complex protein ( Figure 1A ) with dual enzymatic function. (portlandpress.com)
  • Because these kinases exhibit constitutive activity in biochemical assays, it is likely that their activity in cells is controlled by subcellular localization, interactions with inhibitory proteins, targeted degradation, or combinations of these mechanisms. (sciencemag.org)
  • Targeting AKAP coordinated protein complexes with high-affinity peptidomimetics or small molecules to tease apart distinct protein-protein interactions (PPIs) therefore offers important means to disrupt binding of specific components of the complex to better understand the molecular mechanisms involved in the function of individual signalosomes and their pathophysiological role. (frontiersin.org)
  • The existence of these specific complexes (illustrated in Figure 1 ) governed by protein-protein interactions (PPIs) creates an opportunity for new therapeutic strategies to control cAMP dependent signaling that is out of tune or involved in pathologies. (frontiersin.org)
  • A fundamental role for protein-protein interactions in the organization of signal transduction pathways is evident. (ovid.com)
  • akap1 has direct interactions with proteins and molecules. (creativebiomart.net)
  • Large-scale mapping of human protein-protein interactions by mass spectrometry. (nih.gov)
  • and interactions between CaM kinase II and unknown PSD proteins have been detected on SDS gels ( McNeill and Colbran, 1995 ). (embopress.org)
  • Surprisingly, the anchored PKA-dependent potentiation of the L-type Ca 2+ channel in RIIα knockout skeletal muscle was unchanged compared with wild type although it was more sensitive to inhibitors of PKA-AKAP interactions. (pnas.org)
  • The potentiation of the L-type Ca 2+ channel in RIIα knockout mouse skeletal muscle suggests that, despite a lower affinity for AKAP binding, RIα is capable of physiologically relevant anchoring interactions. (pnas.org)
  • We used a structurally consistent model on kinase‐docking motif interactions to facilitate the discovery of short functional sites in the structurally flexible and functionally under‐explored part of the human proteome and applied experimental tools specifically tailored to detect low‐affinity protein-protein interactions for their validation in vitro and in cell‐based assays. (embopress.org)
  • In order to study physical interactions between PfAKAL and other proteins, pull down experiments were performed using a recombinant PfAKAL protein and parasite protein extracts, or with recombinant proteins. (beds.ac.uk)
  • SUN proteins in turn are localized in the inner nuclear membrane, anchoring the LINC complex in the nucleus by interactions with A-type lamins, chromatin-binding proteins, and other proteins. (rupress.org)
  • The book also contains detailed protocols on the manipulation and detection of signals and protein interactions. (sigmaaldrich.com)
  • These mechanisms are based on protein -protein interactions, and the best-understood mechanisms are controlled by a single locus termed S , which has many different alleles in the species population. (wikipedia.org)
  • MethodsThe AKAP10 expression at the mRNA and protein level have been analyzed in colon cancer cell lines, primary CRCs and matched normal mucosa samples, and compared in accordance with specific clinicopathological features of CRC. (diva-portal.org)
  • A notably higher level of AKAP10 expression was found in CRC tissues at both mRNA and protein levels. (diva-portal.org)
  • A competitive ELISA for quantitative measurement of Porcine A kinase anchor protein 10, mitochondrial(AKAP10) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. (antibody-antibodies.com)
  • We aimed at assessing the predisposition of A-kinase anchoring protein 10 (AKAP10) polymorphism toward acquired repolarization disorders in high-risk vascular surgery patients. (cdc.gov)
  • Experiments in which DUF1669 domains were swapped among FAM83 family members suggested that DUF1669 determines the specificity of the FAM83 protein for particular CK1 isoforms. (sciencemag.org)
  • But how is response specificity achieved with kinases designed to recognize many substrates? (embopress.org)
  • Kinases can be spatially positioned near their substrates at all times, or translocate to their substrates subsequent to activation in order to improve speed and specificity in response to cell stimulation. (embopress.org)
  • Signaling specificity through anchoring Probably the most thoroughly characterized anchoring proteins, AKAP79/150, organizes a veritable mecca of signaling protein. (healthyfutureforkids.com)
  • The beautiful control AKAP79/150 exerts on its many partner substances in buy GNE-7915 a number of mobile contexts makes this anchoring proteins a prototypic exemplory case of regional signaling specificity [6]. (healthyfutureforkids.com)
  • These all target, with characteristic binding specificity, an ancient protein interaction surface on evolutionarily related but physiologically clearly distinct three MAPKs (JNK, ERK, and p38). (embopress.org)
  • Drugs targeting RGS proteins can be divided into five groups: 1) potentiators of endogenous agonist function, 2) potentiators/desensitization blockers of exogenous GPCR agonists, 3) specificity enhancers of exogenous agonists, 4) antagonists of effector signaling by an RGS protein, and 5) RGS agonists. (aspetjournals.org)
  • In the fusion, AKAP9 lacks the centrosome binding domain and, as a result, the AKAP9-BRAF protein looses its cytoplasmic compartmentalization and appears to be diffusely distributed in the cytoplasm, as detected by immunofluorescence. (atlasgeneticsoncology.org)
  • Furthermore, compartmentalization of a kinase via an anchoring protein could affect accessibility of the kinase to its second messengers, thereby specifying a preferred receptor signaling route for its activation and/or modulating the amplitude of its basal and stimulated activities. (embopress.org)
  • There is compelling evidence for subcellular compartmentalization and targeting of the kinase. (embopress.org)
  • The compartmentalization of second messenger-activated protein kinases contributes to the fidelity of hormone-mediated signal transduction events. (elsevier.com)
  • Here we report that the female gametophyte-expressed glycosylphosphatidylinositol-anchored protein (GPI-AP) LORELEI and the seedling-expressed LRE-like GPI-AP1 (LLG1) bind to the extracellular juxtamembrane region of FER and show that this interaction is pivotal for FER function. (elifesciences.org)
  • In this study, we describe a new class of proteins, called GKAPS, that specifically bind the Type II cGMP-dependent protein kinase (PKG). (elsevier.com)
  • Systematic discovery of MAPK networks both experimentally and in silico has been hindered because MAPKs bind to other proteins with low affinity and mostly in less‐characterized disordered regions. (embopress.org)
  • The disordered part of the human proteome contains a large number of short linear motif occurrences that can bind to MAP kinases. (embopress.org)
  • KASH proteins extend into the cytoplasm and allow the LINC complex to bind to different cytoskeletal elements and signaling molecules. (rupress.org)
  • Several other proteins such as cyclic nucleotide gated ion channels ( 1 ), phosphodiesterases (PDE) ( 2 ), and guanine nucleotide exchange factors (Epac) ( 3 ) bind cAMP. (mcponline.org)
  • These signaling proteins include type II protein kinase A, serine/threonine kinase protein kinase N, protein phosphatase 1, protein phosphatase 2a, protein kinase C-epsilon and phosphodiesterase 4D3. (nih.gov)
  • Appert-Collin A, Cotecchia S, Nenniger-Tosato M et al (2007) The A-kinase anchoring protein (AKAP)-Lbc-signaling complex mediates α1 adrenergic receptor-induced cardiomyocyte hypertrophy. (springer.com)
  • Cariolato L, Cavin S, Diviani D (2011) A-kinase anchoring protein (AKAP)-Lbc anchors a PKN-based signaling complex involved in α1-adrenergic receptor-induced p38 activation. (springer.com)
  • AKAP200 is a Drosophila melanogaster member of the "A Kinase Associated Protein" family of scaffolding proteins, known for their role in the spatial and temporal regulation of Protein Kinase A (PKA) in multiple signaling contexts. (sdbonline.org)
  • Taken together, these data indicate that AKAP200 is a novel tissue specific posttranslational regulator of Notch, maintaining high Notch protein levels and thus promoting Notch signaling. (sdbonline.org)
  • Members of the casein kinase 1 (CK1) family of serine-threonine protein kinases are implicated in the regulation of many cellular processes, including the cell cycle, circadian rhythms, and Wnt and Hedgehog signaling. (sciencemag.org)
  • With its RGS domain, it could lead to the interaction to G-alpha proteins, providing a link between the signaling machinery and the downstream kinase (By similarity). (uniprot.org)
  • Anchoring, scaffolding and adapter proteins function to enhance the precision and directionality of these signaling events by bringing enzymes together. (ovid.com)
  • The cAMP signaling pathway is organized by A-kinase anchoring proteins. (ovid.com)
  • Selected A-kinase anchoring protein signaling complexes are highlighted in this minireview. (ovid.com)
  • Therefore, these isoforms function as scaffolding proteins to coordinate a Rho signaling pathway and, in addition, function as protein kinase A-anchoring proteins. (creativebiomart.net)
  • Thus, in lymphocytes, as in other cell types, glycolipid-based domains provide sites of integration of signaling pathways involved in GPI-anchored protein endocytosis. (rupress.org)
  • We selected most pathways akap1 participated on our site, such as Factors involved in megakaryocyte development and platelet production, G Protein Signaling Pathways, Hemostasis, which may be useful for your reference. (creativebiomart.net)
  • There is increasing evidence that subcellular targeting of signaling molecules is an important means of regulating the protein kinase A (PKA) pathway. (kent.edu)
  • In the ER, these events are sensed by specific sensors, which in turn trigger select Rabbit Polyclonal to CPB2 signaling pathways, collectively named the unfolded-protein response (UPR) (1). (exposed-skin-care.net)
  • We conclude that anchoring of AC by AKAP5 is certainly very important to positive legislation of postsynaptic features including AMPA receptor activity by cAMP-PKA signaling. (healthweeks.com)
  • We recently reported protein kinase A (PKA) to be part of a macromolecular signaling complex with ezrin and gap junction protein connexin 43 (Cx43) that provides cAMP-mediated control of gap junction communication. (biochemj.org)
  • Hence, our growing understanding of these anchored enzyme systems earmark AKAP complexes as potential goals for therapeutic involvement, especially because the manipulation of regional signaling retains a guarantee of producing therapies with fewer off-target results. (healthyfutureforkids.com)
  • Mitogen‐activated protein kinases (MAPK) are broadly used regulators of cellular signaling. (embopress.org)
  • Together, these data suggest that PKA anchoring by AKAP150 is essential for the enhancement of TRPV1 function by activation of the PGE 2 /PKA signaling pathway. (elsevier.com)
  • In eukaryotic cells, protein kinases are known to play key roles in cell cycle regulation and signaling pathways. (beds.ac.uk)
  • The scaffold protein muscle A-kinase anchoring protein beta orchestrates cardiac myocyte hypertrophic signaling required for the development of heart failure. (jax.org)
  • Expression of the fibroblast growth factor-like protein EGL-17 and its receptor EGL-15 is reduced in vrk-1 mutants, suggesting that VRK-1 might act at least partially through activation of FGF signaling. (csic.es)
  • Protein kinase A (PKA)-mediated signaling is a key regulator of brain function. (portlandpress.com)
  • The observation that all segregating mutations increase LRRK2 cellular activity towards its physiological substrates (LRRK2 itself and Rab proteins) [ 4 , 5 ] and equally impair LRRK2-dependent cellular processes, such as clearance of Golgi-derived vesicles [ 6 ], suggests that LRRK2 signaling cascades are probably in the same way affected by mutations. (portlandpress.com)
  • The regulator of G protein signaling (RGS) proteins form a recently identified protein family, and they strongly modulate the activity of G proteins. (aspetjournals.org)
  • Their best known function is to inhibit G protein signaling by accelerating GTP hydrolysis [GTPase activating protein (GAP)] thus turning off G protein signals. (aspetjournals.org)
  • The regulator of G protein signaling (RGS) proteins modulate the activity of G proteins in vitro, and evidence is beginning to emerge on their role in vivo as well. (aspetjournals.org)
  • The RGS proteins were discovered in genetic studies of GPCR signaling pathways in model organisms ( Dohlman and Thorner, 1997 ). (aspetjournals.org)
  • The GAP activity explains RGS-mediated inhibition of G protein signaling. (aspetjournals.org)
  • Dodge-Kafka KL, Soughayer J, Pare GC et al (2005) The protein kinase a anchoring protein mAKAP coordinates two integrated cAMP effector pathways. (springer.com)
  • ATF6, a membrane-anchored transcription factor from the endoplasmic reticulum (ER) that modulates the cellular response to stress as an effector of the unfolded-protein response (UPR), is a key player in the development of tumors of different origin. (exposed-skin-care.net)
  • Use NFAT has discovered a PP2B identification site intrinsic to numerous PP2B effector protein, commonly known as PIxIxIT series buy GNE-7915 [9, 10]. (healthyfutureforkids.com)
  • Just as our understanding of receptor, G protein, and effector function seemed nearly complete, a new kid appeared on the scene injecting fresh life into the field. (aspetjournals.org)
  • It cannot be excluded too that it may facilitate PKA as well as G protein signal transduction, by acting as an adapter for assembling multiprotein complexes. (uniprot.org)
  • Signal transduction through the cAMP pathway starts by stimulation of G-protein-coupled-receptors (GPCRs), via specific extracellular ligands leading to activation of adenylyl cyclase (AC), which converts ATP into cAMP. (frontiersin.org)
  • This protein is speculated to be involved in the cAMP-dependent signal transduction pathway and in directing RNA to a specific cellular compartment. (creativebiomart.net)
  • The role of A-Kinase anchoring proteins in cAMP-mediated signal transduction pathways. (elsevier.com)
  • G protein-coupled receptors (GPCRs) play a major role in signal transduction and are targets of many therapeutic drugs. (aspetjournals.org)
  • They are a highly diverse protein family, have unique tissue distributions, are strongly regulated by signal transduction events, and will likely play diverse functional roles in living cells. (aspetjournals.org)
  • Each FAM83 protein exhibited a distinct pattern of subcellular distribution and colocalized with the CK1 isoform(s) to which it bound. (sciencemag.org)
  • This led to the discovery of AKAP18e: an exclusively nuclear isoform that lacks a PKA-anchoring helix. (elsevier.com)
  • PKA, protein kinase A. ( B ) Western blot analysis of the brainstem lysate witha polyclonal antibody raised against the C-terminal part of the 5-HT 4( a ) receptor isoform. (sciencemag.org)
  • Also, we found that internalization of CD59 was prevented by the protein kinase C inhibitor staurosporine and by the protein kinase A activator forskolin. (rupress.org)
  • In this report we use S-Ht31, a cell-permeant anchoring inhibitor peptide, to study the role of PKA anchoring in sperm. (elsevier.com)
  • FAM83 proteins participate in various cellular processes and are characterized by an N-terminal "domain of unknown function" called DUF1669. (sciencemag.org)
  • The inhibition of motility by S- Ht31 is reversible but only if calcium is present in the suspension buffer, suggesting a role for PKA anchoring in regulating cellular calcium homeostasis. (elsevier.com)
  • reticulum (ER) can be particularly affected by the presence of mutations in secretory proteins or by dynamic changes in the cellular microenvironment, events which are often encountered in cancers. (exposed-skin-care.net)
  • Our discovery that anchored enzymes contribute to the regulation of cellular events that underlie diabetes may help us to move more rapidly toward new therapies to control this increasingly prevalent metabolic disease," commented John Scott, Edwin G. Krebs-Hilma Speights Professor of Pharmacology at the University of Washington School of Medicine, Seattle and an investigator of the Howard Hughes Medical Institute. (innovations-report.com)
  • Here, PfAKAL, an open reading frame of a potential AKAP-like protein in the P. falciparum genome was identified, and its protein partners and putative cellular functions characterized. (beds.ac.uk)
  • In cell biology, protein kinase A (PKA) is a family of enzymes whose activity is dependent on cellular levels of cyclic AMP (cAMP). (wikipedia.org)
  • In this review, we will discuss the accumulating evidence linking PKA and LRRK2 in neuron and microglia functions, and offer an overview of the enigmatic cross-talk between these two kinases with molecular and cellular implications. (portlandpress.com)
  • Targeting proceeds via a mechanism whereby association with the PKA holoenzyme masks a polybasic nuclear localization signal on the anchoring protein. (elsevier.com)
  • Here we hypothesized that mitochondrial anchoring of PKA promotes survival in muscle cells. (ahajournals.org)
  • Disruption of the wheel by site-directed mutagenesis abolished tubulin binding and reduced mitochondrial attachment of an MT-GFP fusion protein. (elsevier.com)
  • Following epididymal passage, WAVE1 was found exclusively on the mitochondrial sheath, suggesting that the protein may function in this region. (northwestern.edu)
  • Mitochondrial-Shaping Proteins in Cardiac Health and Disease - the Long and the Short of It! (springer.com)
  • Mitochondrial health is critically dependent on the ability of mitochondria to undergo changes in mitochondrial morphology, a process which is regulated by mitochondrial shaping proteins. (springer.com)
  • Mitochondria undergo fission to generate fragmented discrete organelles, a process which is mediated by the mitochondrial fission proteins (Drp1, hFIS1, Mff and MiD49/51), and is required for cell division, and to remove damaged mitochondria by mitophagy. (springer.com)
  • Mitochondria undergo fusion to form elongated interconnected networks, a process which is orchestrated by the mitochondrial fusion proteins (Mfn1, Mfn2 and OPA1), and which enables the replenishment of damaged mitochondrial DNA. (springer.com)
  • Although the mitochondria are arranged differently, emerging data supports a role for the mitochondrial shaping proteins in cardiac health and disease. (springer.com)
  • Interestingly, in the adult heart, it appears that the pleiotropic effects of the mitochondrial fusion proteins, Mfn2 (endoplasmic reticulum-tethering, mitophagy) and OPA1 (cristae remodeling, regulation of apoptosis, and energy production) may play more important roles than their pro-fusion effects. (springer.com)
  • In this review article, we provide an overview of the mitochondrial fusion and fission proteins in the adult heart, and highlight their roles as novel therapeutic targets for treating cardiac disease. (springer.com)
  • By undergoing fission they generate fragmented discrete mitochondria, a process which is regulated by the mitochondrial fission proteins, dynamic-related peptide-1 (Drp1), human fission protein-1 (hFis1), mitochondrial fission factor (Mff) and mitochondrial dynamics proteins 49 and 51 (MiD49 and 51). (springer.com)
  • this interaction stabilizes both proteins (PubMed:25217626, PubMed:27666745, PubMed:28814570). (rcsb.org)
  • A systematic evaluation of protein kinase A-A-Kinase anchoring protein interaction motifs. (uniprot.org)
  • Our bioinformatics and peptide array screening approaches based on this signature motif identified GSKIP (glycogen synthase kinase 3beta interaction protein) as an AKAP. (uni-regensburg.de)
  • This occurs through the interaction of enzymes with scaffolding or anchoring proteins. (elsevier.com)
  • The combined computational and experimental approach enabled the identification of many novel MAPK‐docking motifs that were elusive for other large‐scale protein-protein interaction screens. (embopress.org)
  • The identification and characterization of novel Plasmodium -specific proteins and their joint interaction may lead to the development of new therapeutic strategies. (beds.ac.uk)
  • This interaction prevents the KASH protein from diffusing out of the outer nuclear membrane into the contiguous ER. (rupress.org)
  • The nucleoplasmic domains of SUN proteins anchor the LINC complex to the nucleoskeleton, through its interaction with nuclear lamina, as well as chromosome-binding proteins and probably other anchoring proteins (see Fig. 3 ). (rupress.org)
  • AKAP150-anchored PKA and PKC phosphorylate the TRPV1 route, increasing route sensitivity. (healthyfutureforkids.com)
  • The vaccinia-related kinases (VRKs) are highly conserved throughout the animal kingdom and phosphorylate several chromatin proteins and transcription factors. (csic.es)
  • Here we demonstrate that the A-kinase anchor protein 150 (AKAP150) is critical for PKA-mediated regulation of Cav1.2 in the brain. (nih.gov)
  • The encoded protein is part of the spliceosome complex and is involved in the regulation of alternate splicing in some mRNA precursors. (nih.gov)
  • It is predominantly expressed in cerebral cortex and may anchor the PKA protein at postsynaptic densities (PSD) and be involved in the regulation of postsynaptic events. (genecards.org)
  • Originally thought to have only a structural role, cMyBPC has been shown to play an important role in the regulation of cardiac contractility [ 1 ], for which the N-terminal region of the protein appears to be crucial. (biomedcentral.com)
  • Mutations in genes for ABI domain proteins designated and (surface protein display) diminish the expression of surface proteins with YSIRK signal peptides but not of precursor proteins with conventional signal peptides. (mirc-undernet.org)
  • mini-transposon in four genes encoding for ABI domain proteins (Newman (Bae (((or were verified by DNA sequencing. (mirc-undernet.org)
  • The predicted proteins for two of these four genes, YN3RdhA8 and YN3RdhA16 , showed 94% and 97% of amino acid similarity with PceA and VcrA, which are well known to dechlorinate PCE to trichloroethene (TCE) and TCE to ETH, respectively. (hindawi.com)
  • Differential expression of anchoring proteins, some of which may directly modulate kinases, can generate distinct tissue‐specific properties of a given kinase. (embopress.org)
  • Furthermore, the GPI anchor plays a role in protein sorting as GPI-anchored proteins are segregated from other secretory proteins and exit the ER in a distinct population of coated vesicles ( 45 ). (asm.org)
  • The trypanosome life cycle alternates between the midgut of the insect vector (procyclic stage) and the bloodstream of the mammalian host, and trypanosomes have distinct surface proteins at each stage. (asm.org)
  • This functional diversity is achieved by assembling the LINC complex from distinct KASH proteins that interact with different cytoskeletal filaments and by associating with accessory factors. (rupress.org)
  • Diviani D, Maric D, Perez Lopez I et al (2013) A-kinase anchoring proteins: molecular regulators of the cardiac stress response. (springer.com)
  • A lately defined example is normally anchoring from the calcium-calmodulin-dependent serine-threonine proteins phosphatase 2B/calcineurin (PP2B) to neuronal AKAP79/150 (Amount 1). (healthyfutureforkids.com)
  • Here, we demonstrate the critical role of the A-kinase anchoring protein AKAP150 in PKA-dependent modulation of TRPV1 function in adult mouse dorsal root ganglion (DRG) neurons. (elsevier.com)
  • Here, we show that the primary cilium of renal epithelial cells contains a protein complex comprising adenylyl cyclase 5/6 (AC5/6), A-kinase anchoring protein 150 (AKAP150), and protein kinase A. Loss of primary cilia caused by deletion of Kif3a results in activation of AC5 and increased cAMP levels. (umn.edu)
  • AKAP79 in human, or its rat homolog, AKAP150) which forms a trimeric complex with protein kinase C (PKC) and KCNQ channels. (elsevier.com)
  • it localises to the sarcoplasmic reticulum and nuclear membrane, where it anchors PKA. (thefreedictionary.com)
  • They cluster into glycolipid-based membrane domains and caveolae, plasmalemmal vesicles involved in the transcytosis and endocytosis of these surface proteins. (rupress.org)
  • Velocity gradient centrifugation of solubilized porcine cardiac membrane proteins showed that several PKA-RI and PKA-RII binding proteins cosediment with ERG channels. (deepdyve.com)
  • Ca 2+ /calmodulin‐dependent protein kinase II (CaM kinase II) is present in a membrane‐bound form that phosphorylates synapsin I on neuronal synaptic vesicles and the ryanodine receptor at skeletal muscle sarcoplasmic reticulum (SR), but it is unclear how this soluble enzyme is targeted to membranes. (embopress.org)
  • Our results indicate that αKAP (i) is anchored to the membrane via its N‐terminal hydrophobic domain, (ii) can co‐assemble with catalytically competent CaM kinase II isoforms and target them to the membrane regardless of their state of activation, and (iii) is co‐localized and associated with rat skeletal muscle CaM kinase II in vivo . (embopress.org)
  • Plays a role in long term synaptic potentiation by regulating protein trafficking from the dendritic recycling endosomes to the plasma membrane and controlling both structural and functional plasticity at excitatory synapses (PubMed:25589740). (genecards.org)
  • De novo sphingolipid synthesis is required for the exit of glycosylphosphatidylinositol (GPI)-anchored membrane proteins from the endoplasmic reticulum in yeast. (asm.org)
  • A subset of eukaryotic cell surface proteins is attached to the outer leaflet of the plasma membrane lipid bilayer via glycosylphosphatidylinositol (GPI) anchors. (asm.org)
  • In mammalian cells, GPI anchors influence protein sorting to the apical and basolateral plasma membrane domains of polarized epithelia ( 12 , 39 , 55 ). (asm.org)
  • Analysis of mAKAP-green fluorescent protein (GFP) fusion constructs revealed that nuclear membrane targeting is conferred by two regions of the protein, between residues 772-915 and 915-1065, which contain spectrin-like repeat sequences. (elsevier.com)
  • Heterologous expression of the mAKAP targeting sequences displaced the endogenous anchoring protein from the nuclear membrane, demonstrating that mAKAP targeting is saturable. (elsevier.com)
  • The linker of nucleoskeleton and cytoskeleton (LINC) complex, composed of outer and inner nuclear membrane Klarsicht, ANC-1, and Syne homology (KASH) and Sad1 and UNC-84 (SUN) proteins, respectively, connects the nucleus to cytoskeletal filaments and performs diverse functions including nuclear positioning, mechanotransduction, and meiotic chromosome movements. (rupress.org)
  • It is composed of Klarsicht, ANC-1, and Syne homology (KASH) domain proteins in the outer nuclear membrane and Sad1 and UNC-84 (SUN) domain proteins in the inner nuclear membrane ( Fig. 1 ). (rupress.org)
  • The LINC complex is composed of KASH proteins in the outer nuclear membrane and SUN proteins in the inner nuclear membrane. (rupress.org)
  • The Arabidopsis thaliana serine/threonine kinase D6 PROTEIN KINASE (D6PK) is polarly localized at the plasma membrane of many cells where it colocalizes with PINs and activates PIN-mediated auxin efflux. (biologists.org)
  • Here, we show that the association of D6PK with the basal plasma membrane and PINs is dependent on the phospholipid composition of the plasma membrane as well as on the phosphatidylinositol phosphate 5-kinases PIP5K1 and PIP5K2 in epidermis cells of the primary root. (biologists.org)
  • Polybasic motifs are also present at a conserved position in other D6PK-related kinases and required for membrane and phospholipid binding. (biologists.org)
  • Properties established for S-AKAP84 in vitro and in situ strongly suggest that a physiological function of this protein is to concentrate and immobilize RII (PKAII) isoforms at the cytoplasmic face of a phospholipid bilayer. (elsevier.com)
  • The cytoplasmic extensions of KASH proteins vary in size and interact with different cytoskeletal elements. (rupress.org)
  • Phosphorylates multiple receptor tyrosine kinases and more particularly promotes endocytosis of EGFR , facilitates the formation of neuromuscular synapses through MUSK , inhibits PDGFRB -mediated chemotaxis and modulates the endocytosis of activated B-cell receptor complexes. (rcsb.org)
  • Stable isotope labeling was used to confidently identify and differentially quantify target proteins and their preferential binding affinity for the three different cAMP analogs. (mcponline.org)
  • Also, other proteins which involved in the same pathway with akap1 were listed below. (creativebiomart.net)
  • The ability of an AKAP to anchor PKA may be altered in the failing heart, thus compromising the ability of the myocyte to respond to stimuli which elicit the PKA pathway. (kent.edu)
  • These findings suggest a requirement for the GPI anchor in export from the ER and also later in the secretory pathway, for targeting to the cell surface. (asm.org)
  • Whereas 5-HT 4 receptors stimulate adenylyl cyclases (ACs) throughbothGs and G13 proteins, μ-opioid receptors inhibit AC activities through a Gi/o-mediated inhibitory pathway. (sciencemag.org)
  • The response to GLP-1 was mimicked by forskolin and largely inhibited by the protein kinase A (PKA) inhibitors, H89 and myristoylated PKI(14-22) amide, indicating partial mediation via a cAMP/PKA pathway. (diabetesjournals.org)
  • If it is possible to develop drugs that target the region where anchoring proteins specifically interact with phosphatase enzymes it is feasible that insulin sensitivity could be improved in selected tissues such as skeletal muscle. (innovations-report.com)
  • GPI attachment occurs in the endoplasmic reticulum (ER), and GPI anchors can function subsequently in protein sorting within the secretory and endocytic pathways ( 40 ). (asm.org)
  • Localization of a novel human A-kinase-anchoring protein, hAKAP220, during spermatogenesis. (creativebiomart.net)
  • In the present study we focus on the A-kinase-anchoring protein (AKAP) WAVE1, a member of the Wiskott-Aldrich syndrome (WASP) family of adaptor proteins, to study its localization throughout mammalian spermatogenesis. (northwestern.edu)
  • Many different subcellular regions are targets for PKA anchoring (Colledge, 1999). (sdbonline.org)
  • Dr. Kapiloff is the manager of Anchored RSK3 Inhibitors, LLC, and president of Cardiac RSK3 Inhibitors, LLC, companies interested in developing RSK3-targeted therapies and in which Dr. Kapiloff holds equity. (springer.com)
  • Because CK1 isoforms are thought to be constitutively active protein kinases, the ability of FAM83 proteins to anchor CK1 isoforms may be an important mechanism for targeting CK1 activity to specific subcellular locations and substrates. (sciencemag.org)
  • Several known tyrosine-phosphorylated microbial proteins have been identified as ABL1 substrates. (rcsb.org)
  • We now report the cloning of mAKAP, an anchoring protein found predominantly in heart, skeletal muscle and brain, and whose expression is induced in neonatal ventriculocytes by treatment with hypertrophic stimuli. (elsevier.com)
  • The AKAP9 protein contains the PKA binding domain, a large coiled-coil domain and C-terminal centrosome binding domain. (atlasgeneticsoncology.org)
  • Latest evidence indicates the fact that A kinase anchor protein AKAP5 (AKAP79/150) interacts not merely with PKA but also with several adenylyl cyclase (AC) isoforms. (healthweeks.com)
  • found that FAM83 family members interacted with a specific subset of casein kinase 1 (CK1) isoforms in vitro through the DUF1669 domain. (sciencemag.org)
  • A new variant of β‐CaM kinase II, termed β M ‐CaM kinase II, is one of the predominant CaM kinase II isoforms associated with αKAP in skeletal muscle SR. (embopress.org)
  • Diviani D, Soderling J, Scott JD (2001) AKAP-Lbc anchors protein kinase A and nucleates Galpha 12-selective Rho-mediated stress fiber formation. (springer.com)
  • 2004). Conversely, lysophatidic acid, an agonist stimulating receptors coupled to the G protein G12, increases the RhoGEF activity of AKAP-Lbc (Diviani et al. (pharmacologicalsciences.us)
  • Non-receptor tyrosine-protein kinase that plays a role in many key processes linked to cell growth and survival such as cytoskeleton remodeling in response to extracellular stimuli, cell motility and adhesion, receptor endocytosis, autophagy, DNA damage response and apoptosis. (rcsb.org)
  • ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate. (rcsb.org)
  • Tyrosine kinases (PTK) represent only 10% of all protein kinases, although they are the most important protein kinases. (sigmaaldrich.com)
  • A-kinase anchor protein 4 precursor (pro-AKAP4) in human spermatozoa. (nih.gov)
  • GFP fusion protein in the ventral nerve cord and vulva precursor cells restores vulva and uterus formation, suggesting both cell autonomous and non-autonomous roles of VRK-1. (csic.es)
  • Stimulation of G-protein-coupled receptors leads to activation of adenylyl cyclase (AC), which converts ATP into cAMP. (frontiersin.org)
  • and protein kinase A (PKA) are two important transmitters that transfer signals from a wide variety of cell surface receptors to generate physiological responses. (nialoasacomhigh.ml)
  • for transmembrane protein displayed greatly reduced envelope abundance of SpA and surface proteins with YSIRK signal peptides. (mirc-undernet.org)
  • This phenotype is restricted to surface proteins with YSIRK-G/S signal peptides and does not apply to surface proteins secreted via canonical signal peptides. (mirc-undernet.org)
  • A protein called FERONIA is found in most types of cells and regulates many of the processes that drive these responses, such as cell growth and communication between male and female cells. (elifesciences.org)
  • VRK-1 regulates anchor cell polarity and the timing of anchor cell invasion through the basement membranes separating vulval and somatic gonadal cells during the L3 larval stage. (csic.es)