A membrane bound member of the TNF superfamily that is expressed on activated B-LYMPHOCYTES; MACROPHAGES; and DENDRITIC CELLS. The ligand is specific for the 4-1BB RECEPTOR and may play a role in inducing the proliferation of activated peripheral blood T-LYMPHOCYTES.
A member of the tumor necrosis factor receptor superfamily that is specific for 4-1BB LIGAND. It is found in a variety of immune cell types including activated T-LYMPHOCYTES; NATURAL KILLER CELLS; and DENDRITIC CELLS. Activation of the receptor on T-LYMPHOCYTES plays a role in their expansion, production of cytokines and survival. Signaling by the activated receptor occurs through its association with TNF RECEPTOR-ASSOCIATED FACTORS.
A molecule that binds to another molecule, used especially to refer to a small molecule that binds specifically to a larger molecule, e.g., an antigen binding to an antibody, a hormone or neurotransmitter binding to a receptor, or a substrate or allosteric effector binding to an enzyme. Ligands are also molecules that donate or accept a pair of electrons to form a coordinate covalent bond with the central metal atom of a coordination complex. (From Dorland, 27th ed)
Cell surface receptors that bind NERVE GROWTH FACTOR; (NGF) and a NGF-related family of neurotrophic factors that includes neurotrophins, BRAIN-DERIVED NEUROTROPHIC FACTOR and CILIARY NEUROTROPHIC FACTOR.
A family of proteins that were originally identified by their ability to cause NECROSIS of NEOPLASMS. Their necrotic effect on cells is mediated through TUMOR NECROSIS FACTOR RECEPTORS which induce APOPTOSIS.
Cell surface receptors that bind TUMOR NECROSIS FACTORS and trigger changes which influence the behavior of cells.
A strain of Rattus norvegicus which is a model for spontaneous insulin-dependent diabetes mellitus (DIABETES MELLITUS, INSULIN-DEPENDENT).
Differentiation antigens residing on mammalian leukocytes. CD stands for cluster of differentiation, which refers to groups of monoclonal antibodies that show similar reactivity with certain subpopulations of antigens of a particular lineage or differentiation stage. The subpopulations of antigens are also known by the same CD designation.
Costimulatory T-LYMPHOCYTE receptors that have specificity for CD80 ANTIGEN and CD86 ANTIGEN. Activation of this receptor results in increased T-cell proliferation, cytokine production and promotion of T-cell survival.
A costimulatory ligand expressed by ANTIGEN-PRESENTING CELLS that binds to CTLA-4 ANTIGEN with high specificity and to CD28 ANTIGEN with low specificity. The interaction of CD80 with CD28 ANTIGEN provides a costimulatory signal to T-LYMPHOCYTES, while its interaction with CTLA-4 ANTIGEN may play a role in inducing PERIPHERAL TOLERANCE.
Morphologic alteration of small B LYMPHOCYTES or T LYMPHOCYTES in culture into large blast-like cells able to synthesize DNA and RNA and to divide mitotically. It is induced by INTERLEUKINS; MITOGENS such as PHYTOHEMAGGLUTININS, and by specific ANTIGENS. It may also occur in vivo as in GRAFT REJECTION.
Lymphocytes responsible for cell-mediated immunity. Two types have been identified - cytotoxic (T-LYMPHOCYTES, CYTOTOXIC) and helper T-lymphocytes (T-LYMPHOCYTES, HELPER-INDUCER). They are formed when lymphocytes circulate through the THYMUS GLAND and differentiate to thymocytes. When exposed to an antigen, they divide rapidly and produce large numbers of new T cells sensitized to that antigen.
Serum glycoprotein produced by activated MACROPHAGES and other mammalian MONONUCLEAR LEUKOCYTES. It has necrotizing activity against tumor cell lines and increases ability to reject tumor transplants. Also known as TNF-alpha, it is only 30% homologous to TNF-beta (LYMPHOTOXIN), but they share TNF RECEPTORS.
A membrane glycoprotein and differentiation antigen expressed on the surface of T-cells that binds to CD40 ANTIGENS on B-LYMPHOCYTES and induces their proliferation. Mutation of the gene for CD40 ligand is a cause of HYPER-IGM IMMUNODEFICIENCY SYNDROME, TYPE 1.
Body of knowledge related to the use of organisms, cells or cell-derived constituents for the purpose of developing products which are technically, scientifically and clinically useful. Alteration of biologic function at the molecular level (i.e., GENETIC ENGINEERING) is a central focus; laboratory methods used include TRANSFECTION and CLONING technologies, sequence and structure analysis algorithms, computer databases, and gene and protein structure function analysis and prediction.
Exclusive legal rights or privileges applied to inventions, plants, etc.
Spread and adoption of inventions and techniques from one geographic area to another, from one discipline to another, or from one sector of the economy to another. For example, improvements in medical equipment may be transferred from industrial countries to developing countries, advances arising from aerospace engineering may be applied to equipment for persons with disabilities, and innovations in science arising from government research are made available to private enterprise.
The interchange of goods or commodities, especially on a large scale, between different countries or between populations within the same country. It includes trade (the buying, selling, or exchanging of commodities, whether wholesale or retail) and business (the purchase and sale of goods to make a profit). (From Random House Unabridged Dictionary, 2d ed, p411, p2005 & p283)
The fraudulent misrepresentation of the diagnosis and treatment of disease.
Specialized cells of the hematopoietic system that have branch-like extensions. They are found throughout the lymphatic system, and in non-lymphoid tissues such as SKIN and the epithelia of the intestinal, respiratory, and reproductive tracts. They trap and process ANTIGENS, and present them to T-CELLS, thereby stimulating CELL-MEDIATED IMMUNITY. They are different from the non-hematopoietic FOLLICULAR DENDRITIC CELLS, which have a similar morphology and immune system function, but with respect to humoral immunity (ANTIBODY PRODUCTION).
A bibliographic database that includes MEDLINE as its primary subset. It is produced by the National Center for Biotechnology Information (NCBI), part of the NATIONAL LIBRARY OF MEDICINE. PubMed, which is searchable through NLM's Web site, also includes access to additional citations to selected life sciences journals not in MEDLINE, and links to other resources such as the full-text of articles at participating publishers' Web sites, NCBI's molecular biology databases, and PubMed Central.
Analog or digital communications device in which the user has a wireless connection from a telephone to a nearby transmitter. It is termed cellular because the service area is divided into multiple "cells." As the user moves from one cell area to another, the call is transferred to the local transmitter.
CD4-positive T cells that inhibit immunopathology or autoimmune disease in vivo. They inhibit the immune response by influencing the activity of other cell types. Regulatory T-cells include naturally occurring CD4+CD25+ cells, IL-10 secreting Tr1 cells, and Th3 cells.
A subclass of winged helix DNA-binding proteins that share homology with their founding member fork head protein, Drosophila.
Endogenous substances, usually proteins, which are effective in the initiation, stimulation, or termination of the genetic transcription process.
Molecules on the surface of T-lymphocytes that recognize and combine with antigens. The receptors are non-covalently associated with a complex of several polypeptides collectively called CD3 antigens (ANTIGENS, CD3). Recognition of foreign antigen and the major histocompatibility complex is accomplished by a single heterodimeric antigen-receptor structure, composed of either alpha-beta (RECEPTORS, ANTIGEN, T-CELL, ALPHA-BETA) or gamma-delta (RECEPTORS, ANTIGEN, T-CELL, GAMMA-DELTA) chains.
A critical subpopulation of T-lymphocytes involved in the induction of most immunological functions. The HIV virus has selective tropism for the T4 cell which expresses the CD4 phenotypic marker, a receptor for HIV. In fact, the key element in the profound immunosuppression seen in HIV infection is the depletion of this subset of T-lymphocytes.
A low affinity interleukin-2 receptor subunit that combines with the INTERLEUKIN-2 RECEPTOR BETA SUBUNIT and the INTERLEUKIN RECEPTOR COMMON GAMMA-CHAIN to form a high affinity receptor for INTERLEUKIN-2.
Lymphoid cells concerned with humoral immunity. They are short-lived cells resembling bursa-derived lymphocytes of birds in their production of immunoglobulin upon appropriate stimulation.
The type species of ARENAVIRUS, part of the Old World Arenaviruses (ARENAVIRUSES, OLD WORLD), producing a silent infection in house and laboratory mice. In humans, infection with LCMV can be inapparent, or can present with an influenza-like illness, a benign aseptic meningitis, or a severe meningoencephalomyelitis. The virus can also infect monkeys, dogs, field mice, guinea pigs, and hamsters, the latter an epidemiologically important host.
A form of meningitis caused by LYMPHOCYTIC CHORIOMENINGITIS VIRUS. MICE and other rodents serve as the natural hosts, and infection in humans usually occurs through inhalation or ingestion of infectious particles. Clinical manifestations include an influenza-like syndrome followed by stiff neck, alterations of mentation, ATAXIA, and incontinence. Maternal infections may result in fetal malformations and injury, including neonatal HYDROCEPHALUS, aqueductal stenosis, CHORIORETINITIS, and MICROCEPHALY. (From Joynt, Clinical Neurology, 1996, Ch26, pp1-3)
A critical subpopulation of regulatory T-lymphocytes involved in MHC Class I-restricted interactions. They include both cytotoxic T-lymphocytes (T-LYMPHOCYTES, CYTOTOXIC) and CD8+ suppressor T-lymphocytes.
Discussions, descriptions or catalogs of public displays or items representative of a given subject.
Virus diseases caused by the ARENAVIRIDAE.

4-1BBL cooperates with B7-1 and B7-2 in converting a B cell lymphoma cell line into a long-lasting antitumor vaccine. (1/160)

A20 is a B cell lymphoma that constitutively expresses the costimulatory molecule B7-2 yet grows readily as a tumor in syngeneic BALB/c mice. We have compared the tumorigenicity of A20 variants expressing either B7-1 (A20/B7-1) or B7-2 (A20/B7-2) with an A20 variant expressing B7-1 and B7-2 with 4-1BBL (A20/4-1BBL), a costimulatory member of the TNF family. Mice injected with tumors expressing the vector backbone (A20/CMV) or B7-1 developed tumors within 25 days of s.c. injection. In contrast, mice injected with A20/4-1BBL were tumor free for the 150-day follow-up period, while 25% of mice injected with A20/B7-2 developed tumors. Tumorigenicity experiments using nude mice indicated the requirement for T cells for variant rejection. Almost all mice that resisted the initial tumor challenge were resistant to further challenge with the parental tumor. Splenocytes from these mice showed high CTL lytic activity against the parental tumor, A20, as well as the syngeneic BALB/c lymphoma K46J, but showed background levels of lytic activity against the congenic SCID thymoma line ST-D2 or the allogeneic EL4 thymoma. In vitro blocking experiments with anti-B7-1 plus anti-B7-2 and/or soluble 4-1BB receptor showed B7-1, B7-2, and 4-1BBL all contributed to the CTL activity. Thus, the data show that neither B7-1 or B7-2 alone can confer full immunogenicity to the A20 lymphoma but that the addition of 4-1BBL results in a tumor that is highly immunogenic and can confer long-lasting protection against challenge with parental tumor in vivo.  (+info)

Cutting edge: 4-1BB is a bona fide CD8 T cell survival signal. (2/160)

After recognition of Ag/MHC and ligation of a costimulatory molecule, resting T cells will clonally expand and then delete to very low levels. Previously, it was shown that deletion can be prevented by coinjection of cytokines or proinflammatory agents such as adjuvants. Here, we demonstrate that ligation of 4-1BB blocks deletion of superantigen-activated T cells in the absence of adjuvant or additional cytokine treatment. Nearly 10 times as many staphylococcal enterotoxin A-specific T cells were detected in the spleens of mice injected 21 days previously with staphylococcal enterotoxin A and an agonist anti-4-1BB Ab compared with mice given staphylococcal enterotoxin A and a control IgG. Even though both CD4- and CD8-activated T cells expressed 4-1BB, a higher proportion of CD8 T cells were rescued compared CD4 T cells. These data suggest that although 4-1BB provides costimulation, it may also promote long-term T cell survival.  (+info)

Analysis of 4-1BB ligand (4-1BBL)-deficient mice and of mice lacking both 4-1BBL and CD28 reveals a role for 4-1BBL in skin allograft rejection and in the cytotoxic T cell response to influenza virus. (3/160)

4-1BB ligand (4-1BBL) is a member of the TNF family expressed on activated APC. 4-1BBL binds to 4-1BB (CD137) on activated CD4 and CD8 T cells and in conjunction with strong signals through the TCR provides a CD28-independent costimulatory signal leading to high level IL-2 production by primary resting T cells. Here we report the immunological characterization of mice lacking 4-1BBL and of mice lacking both 4-1BBL and CD28. 4-1BBL-/- mice mount neutralizing IgM and IgG responses to vesicular stomatitis virus that are indistinguishable from those of wild-type mice. 4-1BBL-/- mice show unimpaired CTL responses to lymphocytic choriomeningitis virus (LCMV) and exhibit normal skin allograft rejection but have a weaker CTL response to influenza virus than wild-type mice. 4-1BBL-/-CD28-/- mice retain the CTL response to LCMV, respond poorly to influenza virus, and exhibit a delay in skin allograft rejection. In agreement with these in vivo results, allogeneic CTL responses of CD28-/- but not CD28+/+ T cells to 4-1BBL-expressing APC are substantially inhibited by soluble 4-1BB receptor as is the in vitro secondary response of CD28+ T cells to influenza virus peptides. TCR-transgenic CD28-/- LCMV glycoprotein-specific T cells are insensitive to the presence of 4-1BBL when a wild-type peptide is used, but the response to a weak agonist peptide is greatly augmented by the presence of 4-1BBL. These results further substantiate the idea that different immune responses vary in their dependence on costimulation and suggest a role for 4-1BBL in augmenting suboptimal CTL responses in vivo.  (+info)

4-1BB ligand, a member of the TNF family, is important for the generation of antiviral CD8 T cell responses. (4/160)

4-1BB (CD137) is a costimulatory molecule expressed on activated T cells and interacts with 4-1BB ligand (4-1BBL) on APCs. To investigate the role of 4-1BB costimulation for the development of primary immune responses, 4-1BBL-deficient (4-1BBL-/-) mice were infected with lymphocytic choriomeningitis virus (LCMV). 4-1BBL-/- mice were able to generate CTL and eliminate acute LCMV infection with normal kinetics, but CD8 T cell expansion was 2- to 3-fold lower than in wild-type (+/+) mice. In the same mice, virus-specific CD4 Th and B cell responses were minimally affected, indicating that 4-1BB costimulation preferentially affects CD8 T cell responses. This result contrasts with our earlier work with CD40L-deficient (CD40L-/-) mice, in which the CD8 T cell response was unaffected and the CD4 T cell response was markedly impaired. When both 4-1BBL- and B7-dependent signals were absent, CD8 T cell expansion was further reduced, resulting in lower CTL activity and impairing their ability to clear LCMV. Altogether, these results indicate that T cells have distinct costimulatory requirements: optimal CD8 responses require 4-1BBL-dependent interactions, whereas CD4 responses are minimally affected by 4-1BB costimulation, but require CD40-CD40L and B7-dependent interactions.  (+info)

Critical contribution of OX40 ligand to T helper cell type 2 differentiation in experimental leishmaniasis. (5/160)

Infection of inbred mouse strains with Leishmania major is a well characterized model for analysis of T helper (Th)1 and Th2 cell development in vivo. In this study, to address the role of costimulatory molecules CD27, CD30, 4-1BB, and OX40, which belong to the tumor necrosis factor receptor superfamily, in the development of Th1 and Th2 cells in vivo, we administered monoclonal antibody (mAb) against their ligands, CD70, CD30 ligand (L), 4-1BBL, and OX40L, to mice infected with L. major. Whereas anti-CD70, anti-CD30L, and anti-4-1BBL mAb exhibited no effect in either susceptible BALB/c or resistant C57BL/6 mice, the administration of anti-OX40L mAb abrogated progressive disease in BALB/c mice. Flow cytometric analysis indicated that OX40 was expressed on CD4(+) T cells and OX40L was expressed on CD11c(+) dendritic cells in the popliteal lymph nodes of L. major-infected BALB/c mice. In vitro stimulation of these CD4(+) T cells showed that anti-OX40L mAb treatment resulted in substantially reduced production of Th2 cytokines. Moreover, this change in cytokine levels was associated with reduced levels of anti-L. major immunoglobulin (Ig)G1 and serum IgE. These results indicate that anti-OX40L mAb abrogated progressive leishmaniasis in BALB/c mice by suppressing the development of Th2 responses, substantiating a critical role of OX40-OX40L interaction in Th2 development in vivo.  (+info)

Immunomodulatory gene therapy with interleukin 12 and 4-1BB ligand: long- term remission of liver metastases in a mouse model. (6/160)

BACKGROUND: The success of immunomodulatory cancer therapy is frequently hampered by the transient nature of the antitumor immune response. We have shown previously in a mouse model that interleukin 12 (IL-12) generates a strong natural killer (NK) cell-mediated antitumor response and reduces liver metastases induced by a colon carcinoma cell line. However, only a small percentage of the treated animals developed the cytotoxic T-lymphocytic response required for a long-term systemic antitumor immunity. 4-1BB is a co-stimulatory molecule expressed on the surface of activated T cells. Interaction of 4-1BB with its natural ligand (4-1BBL) has been shown to amplify T-cell (especially CD8+)-mediated immunity. In this study, we investigated the effects of adenovirus-mediated gene therapy delivering both IL-12 and 4-1BBL genes on mice with hepatic metastases induced by colon cancer cells. METHODS: Syngeneic BALB/c mice received intrahepatic injection of poorly immunogenic MCA26 colon cancer cells. Various combinations of replication-defective adenoviruses expressing IL-12 and 4-1BBL genes were injected into the established liver tumors. Changes in tumor size and animal survival were then monitored. All statistical tests were two-sided. RESULTS: The long-term survival rate of mice treated with the combination of IL-12 and 4-1BBL was significantly improved over that of animals in the control group (P =.0001). In vivo depletion of NK cells or CD8+ T cells completely abolished the long-term survival advantage of the IL-12 plus 4-1BBL-treated animals (P<.002). Moreover, the systemic immunity induced by this combination treatment protected these animals against a subcutaneous challenge with parental MCA26 cells. CONCLUSION: Adenovirus-mediated transfer of IL-12 and 4-1BBL genes directly into liver tumors resulted in tumor regression that required both NK and CD8+ T cells and generated a potent, long-lasting antitumor immunity.  (+info)

4-1BB: still in the midst of darkness. (7/160)

4-1BB is a member of the tumor necrosis factor receptor superfamily. The receptor functions mainly as a costimulatory molecule in T lymphocytes. In addition, several lines of evidence have shown that interactions between 4-1BB and its ligand are involved in the antigen presentation process and the generation of cytotoxic T cells. Recent studies, however, have demonstrated that 4-1BB plays more diverse roles: Signals through 4-1BB are important for long-term survival of CD8+ T cells and the induction of helper T cell anergy. Clinically, there is great interest in 4-1BB, because T-cell activation induced by anti-4-1BB monoclonal antibodies is highly efficient in the eradication of established tumor cells in mice. Now, since mice deficient in 4-1BB or the 4-1BB ligand are available, subtle roles played by 4-1BB may be revealed in the near future.  (+info)

Rejection of disseminated metastases of colon carcinoma by synergism of IL-12 gene therapy and 4-1BB costimulation. (8/160)

In an orthotopic model of metastatic colon carcinoma established in the liver of mice, we have previously shown that the natural killer (NK) cells were the major effectors after intratumoral delivery of a recombinant adenovirus expressing the murine IL-12 gene. However, tumor cure and long-term survival were achieved only in a minority of animals. In the present study, we generated an effective antitumoral CD8(+ ) T-cell response by the combination of IL-12 gene therapy and systemic delivery of an agonistic monoclonal antibody against 4-1BB, a costimulatory molecule expressed on activated T cells. In the IL-12 plus anti-4-1BB combination treatment, the effective dose of IL-12 could even be reduced even up to 18-fold and still achieved a better efficacy than the maximal dose of either treatment alone. We further demonstrate that the innate and the adaptive antitumoral immune responses were synergistic, as animals bearing hepatic as well as multiple pulmonary metastases were quantitatively cured of their diseases after IL-12 gene therapy + anti-4-1BB combination treatment. Both NK and CD8(+) T cells were necessary in maintaining the long-term antitumor immunity, as depletion of either cell type in the cured animals abolished their abilities to reject tumor cells implanted at distal sites. These results indicate that synergism between innate and adaptive immune responses may be effectively exploited to treat patients with metastatic diseases.  (+info)

PubMed journal article: Expression and function of 4-1BB and 4-1BB ligand on murine dendritic cells. Download Prime PubMed App to iPhone, iPad, or Android
A membrane bound member of the TNF superfamily that is expressed on activated B-LYMPHOCYTES; MACROPHAGES; and DENDRITIC CELLS. The ligand is specific for the 4-1BB RECEPTOR and may play a role in inducing the proliferation of activated peripheral blood T-LYMPHOCYTES ...
4-1BBL, a member of the TNF superfamily, is expressed in B cells, dendritic cells, activated T cells and macrophages. 4-1BBL binds to its receptor
PeproTech the producer of high quality recombinant cytokines and growth factors supports life science research, cellular therapy and regenerative medicine.
International biotechnology industry analysis, data and networking focused on translation, research, development, regulation, commercialization, partnering and funding.
Description: 4-1BB Receptor, a member of the TNF superfamily of receptors, is mainly expressed on the surface of a variety of T cells, but also found in B cells, monocytes, and various transformed cell lines. 4-1BB Receptor binds to 4-1BBL to provide a co-stimulatory signal for T lymphocytes. Signaling by 4-1BB Receptor has been implicated in the antigen-presentation process and generation of cytotoxic T cells. The human 4-1BB Receptor gene codes for a 255 amino acid type I transmembrane protein containing a 17 amino acid N-terminal signal sequence, a 169 amino acid extracellular domain, a 27 amino acid transmembrane domain and a 42 amino acid cytoplasmic domain. Recombinant human soluble 4-1BB Receptor is a 167 amino acid polypeptide (17.7 kDa), which contains the cysteine rich TNFR-like extracellular domain of 4-1BB Receptor ...
Description: 4-1BB Receptor, a member of the TNF superfamily of receptors, is mainly expressed on the surface of a variety of T cells, but also found in B cells, monocytes, and various transformed cell lines. 4-1BB Receptor binds to 4-1BBL to provide a co-stimulatory signal for T lymphocytes. Signaling by 4-1BB Receptor has been implicated in the antigen-presentation process and generation of cytotoxic T cells. The human 4-1BB Receptor gene codes for a 255 amino acid type I transmembrane protein containing a 17 amino acid N-terminal signal sequence, a 169 amino acid extracellular domain, a 27 amino acid transmembrane domain and a 42 amino acid cytoplasmic domain. Recombinant human soluble 4-1BB Receptor is a 167 amino acid polypeptide (17.7 kDa), which contains the cysteine rich TNFR-like extracellular domain of 4-1BB Receptor ...
Cambridge Newnham BBL, Cambridge Newnham BBL Advantages, Cambridge Newnham BBL Cost, Cambridge Newnham BBL Disadvantages, Cambridge Newnham BBL Prices, Cambridge Newnham BBL Procedure, Cambridge Newnham BBL Stages
Get glycol chiller quotes from multiple suppliers based on total brite tanks (no jacketed brite tanks, 1, 2, 3, 4, 5, 6, 7, 8, 9+), winery usage (fermentation vessels, storage / cellar, fermentation and storage, not applicable), total fermenters (no jacketed fermenters, 1, 2, 3, 4, 5, 6, 7, 8, 9+), brewhouse capacity (3 bbl, 3.5 bbl, 5 bbl, 7 bbl, 10 bbl, 15 bbl, 20 bbl, 25 bbl, 30 bbl, 40 bbl, 50 bbl, 60 bbl, 70 bbl, 80 bbl, 90 bbl, 100 bbl), indoor or outdoor (indoors, outdoors, not sure), power supply (triple phase, single phase), fermenter capacity (3 bbl, 3.5 bbl, 5 bbl, 7 bbl, 10 bbl, 15 bbl, 20 bbl, 25 bbl, 30 bbl, 40 bbl, 50 bbl, 60 bbl, 70 bbl, 100 bbl, 200 bbl, 300 bbl, 400 bbl, 500 bbl, 600 bbl, 700 bbl, 800 bbl, 800+ bbl, no jacketed fermenters), application (winery, brewery, pasteurizer, machine cooling, food processing, air conditioning, cidery, distillery, restaurant), wine types (red, white, red and white, not applicable), conditioning tank capacity (3 bbl, 3.5 bbl, 5 bbl, 7 bbl, 10 bbl,
Novel 4-1BB ligand (4-1BB-L) polypeptides and a human cell surface receptor designated 4-1BB that binds 4-1BB-L are provided. Isolated 4-1BB-L-encoding and human 4-1BB-encoding DNA sequences, recombinant expression vectors comprising the isolated DNA sequences, and host cells transformed with the recombinant expression vectors are disclosed, along with methods for producing the novel polypeptides by cultivating such transformed host cells. Soluble forms of the 4-1BB-L or 4-1BB polypeptides are derived from the extracellular domains thereof.
The LOB12.3 monoclonal antibody reacts with mouse 4-1BB, a TNF receptor superfamily member also known as CD137. 4-1BB is a 39 kDa transmembrane protein expressed by T lymphocytes, NK cells, dendritic cells, granulocytes, and mast cells. Upon binding its ligand 4-1BBL, 4-1BB provides costimulatory signals to both CD4 and CD8 T cells through the activation of NF- κB, c-Jun and p38 downstream pathways. The importance of the 4-1BB pathway has been underscored in a number of diseases, including cancer. Agonistic anti-4-1BB antibodies have been reported to induce T cell mediated antitumor immunity. The LOB12.3 antibody is an agonistic antibody that has been shown to stimulate 4-1BB signaling and delay tumor growth |em|in vivo|/em| when administered in combination with immune checkpoint inhibitors.
Yes, for BB30 a circlip goes in a groove in the BB shell, then the bearing gets pushed into the BB until it hits the circlip. Some BB30 frames have a step milled into the BB shell and dont use the circlips. For PF30 the bearings are pressed into platic cups and the cups are pressed in the BB shell until flanges on the cups hit the shell ...
Yes, for BB30 a circlip goes in a groove in the BB shell, then the bearing gets pushed into the BB until it hits the circlip. Some BB30 frames have a step milled into the BB shell and dont use the circlips. For PF30 the bearings are pressed into platic cups and the cups are pressed in the BB shell until flanges on the cups hit the shell ...
This item requires 3-5 Business Days to process and prepare for shipping.Description Double Swab Product has red cap Specimen Collection and Transport Systems Stock # : 413522Manufacturer # : 220109Brand : BBL CultureswabManufacturer : BDApplication : SwabstickColor : TransparentLength : 13 cmSterility : SterileUNSPSC
Looking for Forever Young BBL™ Photorejuvenation in Modesto, CA? Call 209-890-4470 to schedule your private consultation at Skinfinite Solutions.
The BD BBL CultureSwab EZ Collection and Transport System features awesome swabs that protect and safely release organisms from their own environment.
US High Yield BB Effective Yield historical data, charts, stats and more. US High Yield BB Effective Yield is at 4.32%, compared to 4.31% the previous market day and 4.65% last year. This is lower than the long term average of 7.19%..
Anti-UQCRC2 antibody [13G12AF12BB11] (ab14745) has been cited in 63 publications. References for Human, Mouse, Rat, Ce in ICC/IF, IF, IHC-Fr, WB
The latest weekly supply report from the U.S. Energy Information Administration shows domestic ethanol supply declined for the second straight week.
description.provenance : Approved for entry into archive by Sue Kunda([email protected]) on 2013-07-31T23:54:34Z (GMT) No. of bitstreams: 3 license_rdf: 1232 bytes, checksum: bb87e2fb4674c76d0d2e9ed07fbb9c86 (MD5) BB 450_550 Lecture 15 Highlights.pdf: 6598 bytes, checksum: b2e4bb47727ec1571eddb340d1f3d6a1 (MD5) #15 Biochemistry Enzyme Regulation II Lecture for Kevin Aherns BB 450_550.mp4: 137334642 bytes, checksum: 4328d439bb165b885074c48ea054dda6 (MD5 ...
Theyre chasing their second BBL title. Heres the Sydney Sixers team guide for the BBL|09 season, including their fixtures and squad.
Holley 550-816 Avenger EFI 4bbl Multi-Port Fuel Injection System made by Holley, for as low as $3,637.99. Free shipping when your order includes this part.
Active acneEvery patient is different. Your clinician will advise you on a treatment plan to achieve your desired results. We recommend a consult before your first treatment to better inform you of how BBL works, what to expect during and after your treatment, and the best aftercare to maximize your results ...
description.provenance : Approved for entry into archive by Sue Kunda([email protected]) on 2013-07-16T23:57:43Z (GMT) No. of bitstreams: 3 license_rdf: 1232 bytes, checksum: bb87e2fb4674c76d0d2e9ed07fbb9c86 (MD5) #8 Biochemistry Lecture (Gels_Enzymes) from Kevin Aherns BB 350.M4A: 46798132 bytes, checksum: 8d0475a48bfe969186d59ad4f1d95f5b (MD5) BB350 Lecture 8 Highlights.pdf: 7830 bytes, checksum: a9be16216feab15f68370e32e9f686db (MD5 ...
Naravna BB krema za obraz brez silikonov za popolno polt in intenzivno vlaženje. BB krema ustvari svež in poenoten videz polti, ki traja ves dan. Nakup.
Contingency planning with a sound financial strategy will help you make well-informed decisions. BB&T Wealth offers expertise to help you begin financial planning for your future.
Ethanol stocks were drawn down 700,000 barrels (bbl) to 21.802 million bbl during the week ended June 5, the Energy Information Administration reported on Wednesday, June 10.
Habari za leo wakuu, Jamani mimi BB yangu ghafla imeacha kudisplay majina ya watu kwenye contact yangu ambayo nimeya-save. Mtu akinipigia inaonekana namba...
根據歐洲醫學期刊指出,淨透明亮膚質是肌膚看起來年輕、健康的關鍵,同時也顯著影響個人吸引力;而擁有光滑勻亮的膚色,也會使人看起來更年輕,魅力也因此提升。每個文化對美的標準有所不同,亞洲女性在乎肌膚暗沉、斑點、膚色不均等肌膚困擾,努力追求更加明亮
Ha több ösztrogén termelődik, több zsír is rakódik a csípő, fenék és comb részekre. Indokolatlan súlygyarapodás esetén ellenőriztesse hormonháztartását!
Kami Ardhina Herbal melayani penjualan Obat Herbal secara online ke seluruh Indonesia, baik secara ecer maupun per dus.Untuk pemesanan Obat Herbal silahkan hubungi (telpon atau SMS) ke no 081372437200 Ardhina Herbal Pedurungan Jalan Majapahit no 440 Pojok Polsek Pedurungan Semarang Hp. 081372437200 / 085729468836 PIN BB 57D32EDE Ardhina Herbal Banyumanik Jalan Sukun Raya no 34 Sukun Banyumanik Semarang Hp. 081372437200 / 085729468836 PIN BB ...
Kami Ardhina Herbal melayani penjualan Obat Herbal secara online ke seluruh Indonesia, baik secara ecer maupun per dus.Untuk pemesanan Obat Herbal silahkan hubungi (telpon atau SMS) ke no 081372437200 Ardhina Herbal Pedurungan Jalan Majapahit no 440 Pojok Polsek Pedurungan Semarang Hp. 081372437200 / 085729468836 PIN BB 57D32EDE Ardhina Herbal Banyumanik Jalan Sukun Raya no 34 Sukun Banyumanik Semarang Hp. 081372437200 / 085729468836 PIN BB ...
敏兒安safeT21expressTM是一項高敏性胎兒染色體疾病檢測技術,利用孕婦懷孕期間,其胎兒釋放於母體血循環中的DNA作出分析。採用新一代DNA測序技術對媽媽和BB的游離DNA進行深度測序,並將測序結果進行生物信息分析,可以從中得知BB的遺傳信息,常見的包括 ...
I was reading today about the Promises, Page 83-84 from the BB. Those are the famous promises. I was looking though the BB, and found many others. This one stood...
骙b罗克贻揓侙圧纼觍颏观眍骙b罗,亚洳熠AV维吇罗,婨荡婨艷圧纼觍颏,BB罗,B罗氿聗亄叼秔固冂夐粽哃赆溌,片溌丫富,帤绝您且䷾栵皈观影佌骎!
Clone TKS-1 recognizes the mouse CD137L antigen, a Single-pass type II membrane protein also known as 4-1BB ligand (4-1BBL) or Tumor necrosis factor ligand superfamily member 9 (Tnfsf9). CD137L is expressed on activated APC and plays an essential role in regulating adaptive immune responses. Its receptor, 4-1BB is an inducible costimulatory member of the tumor necrosis factor receptor family expressed on activated CD4 and CD8 T cells. 4-1BB can enhance both the proliferation and the survival of murine CD4 and CD8 T cells. Recent evidence in mouse models suggests that 4-1BB/CD137L interaction plays an important role in the memory CD8 T cell response to viruses. - USA
Purpose: Cultured tumor fragments from melanoma metastases have been used as a source of tumor-infiltrating lymphocytes (TIL) for adoptive cell therapy. The expansion of tumor-reactive CD8+ T cells with IL-2 in these early cultures is critical in generating clinically active TIL infusion products, with a population of activated 4-1BB CD8+ T cells recently found to constitute the majority of tumor-specific T cells. Experimental Design:We used an agonistic anti-4-1BB antibody added during the initial tumor fragment cultures to provide in situ 4-1BB co-stimulation. Results: Addition of an agonistic anti-4-1BB antibody could activate 4-1BB signaling within early cultured tumor fragments and accelerated the rate of memory CD8+ TIL outgrowth that were highly enriched for melanoma antigen specificity. This was associated with NFkappaB activation and the induction of T-cell survival and memory genes, as well as enhanced IL-2 responsiveness, in the CD8+ T cells in the fragments and emerging from the ...
Immune checkpoints are one of the protective mechanisms in normal organisms. Under the initiation of the usual immune system, T cells can perform antigen-specific cytotoxicity and guide other immune responses against foreign organisms with antigens different from the host itself; however, such functions need to have a set of regulatory functions to avoid causing autoimmune reactions or injuring their own cells or tissues when fighting foreign cells. This set of regulatory functions, which we call immune checkpoint mechanisms, simply means that different groups of ligand and receptor reactions increase or inhibit the immune effects of T cells.. With years experience, Creative BioMart provides a wide range of immune checkpoint proteins and the bio-activity of all those products has been assayed and confirmed, making them essential materials for mechanistic studies and development of new therapeutics.. Creative BioMart immune checkpoint proteins mainly include: 2B4, 4-1BB, 4-1 BB Ligand, B7-1, ...
Immune checkpoints are one of the protective mechanisms in normal organisms. Under the initiation of the usual immune system, T cells can perform antigen-specific cytotoxicity and guide other immune responses against foreign organisms with antigens different from the host itself; however, such functions need to have a set of regulatory functions to avoid causing autoimmune reactions or injuring their own cells or tissues when fighting foreign cells. This set of regulatory functions, which we call immune checkpoint mechanisms, simply means that different groups of ligand and receptor reactions increase or inhibit the immune effects of T cells.. With years experience, Creative BioMart provides a wide range of immune checkpoint proteins and the bio-activity of all those products has been assayed and confirmed, making them essential materials for mechanistic studies and development of new therapeutics.. Creative BioMart immune checkpoint proteins mainly include: 2B4, 4-1BB, 4-1 BB Ligand, B7-1, ...
Immune checkpoints are one of the protective mechanisms in normal organisms. Under the initiation of the usual immune system, T cells can perform antigen-specific cytotoxicity and guide other immune responses against foreign organisms with antigens different from the host itself; however, such functions need to have a set of regulatory functions to avoid causing autoimmune reactions or injuring their own cells or tissues when fighting foreign cells. This set of regulatory functions, which we call immune checkpoint mechanisms, simply means that different groups of ligand and receptor reactions increase or inhibit the immune effects of T cells.. With years experience, Creative BioMart provides a wide range of immune checkpoint proteins and the bio-activity of all those products has been assayed and confirmed, making them essential materials for mechanistic studies and development of new therapeutics.. Creative BioMart immune checkpoint proteins mainly include: 2B4, 4-1BB, 4-1 BB Ligand, B7-1, ...
Immune checkpoints are one of the protective mechanisms in normal organisms. Under the initiation of the usual immune system, T cells can perform antigen-specific cytotoxicity and guide other immune responses against foreign organisms with antigens different from the host itself; however, such functions need to have a set of regulatory functions to avoid causing autoimmune reactions or injuring their own cells or tissues when fighting foreign cells. This set of regulatory functions, which we call immune checkpoint mechanisms, simply means that different groups of ligand and receptor reactions increase or inhibit the immune effects of T cells.. With years experience, Creative BioMart provides a wide range of immune checkpoint proteins and the bio-activity of all those products has been assayed and confirmed, making them essential materials for mechanistic studies and development of new therapeutics.. Creative BioMart immune checkpoint proteins mainly include: 2B4, 4-1BB, 4-1 BB Ligand, B7-1, ...
Lot 4 at 2014 Austin, TX Microbrewery - Lot List Posted: 20BBL Brewhouse Package, (6) 20BBL Fermenters, (8) 20BBL Serving Tanks, Keg Wash/Fill + Support from New Mill Capital.
Lot 6 at 2014 Austin, TX Microbrewery - Lot List Posted: 20BBL Brewhouse Package, (6) 20BBL Fermenters, (8) 20BBL Serving Tanks, Keg Wash/Fill + Support from New Mill Capital.
TENTANG BB PLUS COLLAGEN BB Plus ni dihasilkan untuk membantu dan merangsang pengeluaran kolagen pada kulit. Kolagen penting untuk mengembalikan keremajaan dan kehalusan kulit secara menyeluruh. BB Plus diperbuat daripada 5000mg kolagen terhidrolisis bagi memudahkan penyerapan dalam badan. Tambahan ekstrak biji anggur dan juga Vitamin C menjadi kofaktor untuk melindungi rangkaian kolagen. BB PLUS BERTINDAK…
Shop a large selection of products and learn more about CD49b Hamster anti-Mouse, BB700, Clone: HMα2, BD Optibuild 50μg; BB700 50μg; BB700.
Missha Signature CC BB krém (Complexion Coordinating), azaz arcszín kiegyenlítő, szabályozó krém. Még természetesebb, még tisztább megjelenés!
Pentek 255495, ECP20-20BB Pleated Cellulose-Polyester, 4.5 x 20, 20 Micron-Pentek 255495, ECP20-20BB Pleated Cellulose-Polyester, 4.5 x 20, 20 M
Objevte příjemně lehoučkou texturu BB krému Sundays od PUPA a dopřejte svému obličeji opálený vzhled a ochranu před UVA a UVB paprsky. Ideální na pláž i do města.
I am trying to find an equation to get a rough estimate of CO2 produced during fermentation. I figure that it should be able to be calculated by Degree Plato per Bbl. So to figure CO2 produced over fermentation one could go CO2(by the ton)=(Bbls)*(x)*(O.G.-F.G). So for one Bbl changing one degree it would be CO2=(1)(x)(1). I just need to know if this is reasonable and what one Bbl produces, which would be my x. I believe this should be somewhat constant as it just reflects CO2 output by
KATRVRKQIVDGKKVRVAVASGKTID. Chain W. MKIKLVRSVIGRPGNQVKTVQALGLRKIGDSREVSDTPAVRGMVKTVKHLLEVQE. Chain 1. MAKDGPRIIVKMESSAGTGFYYTTTKNRRNTQAKLELKKYDPVAKKHVVFREKKV. Chain 3. MPKMKTHKMAKRRIKITGTGKVMAFKSGKRHQNTGKSGDEIRGKGKGFVLAKAEWARMKLMLPRGK. Chain 2. MKRTYQPNNRKRAKTHGFRARMKTKSGRNILARRRAKGRHQLTVSDE. Chain 5. S(BB9)T(DBU)(BB9)(3GL)(BB9)C(BB9)(MH6)(BB9)(DHA)(NH2). Chain 4. MKVRSSVKKMCDNCKVVRRHGRVLVICSNVKHKQRQG. Chain B. MKGILGTKIGMTQIWKNDRAIPVTVVLAGPCPIVQRKTAQTDGYEAVQIGYAPKAERKVNKPMQGHFAKAGVAPTRILRE ...
Kert szked s, Az reged s ellen - t bb t ma is , Kinek milyen tiszt t k ra, m regtelen t k ra javasolt? , F lnek a fenyeget st l, Tudom ny, DR KENDE P TER: Isten hozz d, hal l!, Olvas s a WC-n – rtalmas szok s, K r mvir g, ❤K R MVIR G s GY GY T HAT SAi❤, Term szetesen a sz vinfarktus ellen, Ah ny nyelv, annyi ember, Gy gyn v nyek s felhaszn l suk I,
Buy 3LAB Aqua BB SPF40 Moisturiser - Shade 03 30ml online at SkinStore! We have a great range of 3LAB Skin Care products available. Free delivery over $49!
Frontrow Dynamic Duo BB+CC Hubrid Stick with SPF 50 | Shade 02 Is A Korean Formula make skin solution give you a indulge and blemish-free look and also very Light weight. BUY NOW From Eishops.com.
C2%AB%D0%A2%D1%80%D0%B8%D0%B3%D0%B3%D0%B5%D1%80_%D0%A1%D0%B5%D1%80%D0%B8%D0%B0%D0%BB_16_%D0%A1%D0%B5%D1%80%D0%B8%D1%8F%C2%BB_L0_%E3%80%90_%D0%A2%D1%80%D0%B8%D0%B3%D0%B3%D0%B5%D1%80_%D0%A1%D0%B5%D1%80%D0%B8%D0%B0%D0%BB_16_%D0%A1%D0%B5%D1%80%D0%B8%D1%8F%E3%80%91._%22%D0%A2%D1%80%D0%B8%D0%B3%D0%B3%D0%B5%D1%80_%D0%A1%D0%B5%D1%80%D0%B8%D0%B0%D0%BB_16_%D0%A1%D0%B5%D1%80%D0%B8%D1%8F_Watch%22_R1 ...
This Histri was built automatically but not manually verified. As a consequence, the Histri can be incomplete or can contain errors ...
Plasmid pSpCas9n(BB)-2A-Puro (PX462) from Dr. Feng Zhangs lab contains the insert hSpCas9n-2A-Puro and is published in Nat Protoc. 2013 Nov;8(11):2281-308. doi: 10.1038/nprot.2013.143. Epub 2013 Oct 24. This plasmid is available through Addgene.
x3A3;το βιβλίο του Κροπότκιν, "Η Μεγάλη Γαλλική Επανάσταση" μπορεί κάποιος ...
Esquemas de colores, pinturas, paletas de colores y combinaciones, gradientes y conversiones de espacio de color para el código de color hexadecimal #bb26b1.
A krónikus prosztatagyulladás merevedési zavarokkal járhat, sőt akár. Továbbá, a kezelőorvosának tudnia kell, meddig tünetei jelentek meg, és hogyan változott az idők során. A legtöbb esetben nem rákos.
Barn Find 1966 442 400 4bbl 2sp,car can be driven but there is a knock in the engine. odometer says 32000,this car has all the chromwe trim and even an extra .... Get Price ...
Made a big batch of helios using 1%ba 3%bb and peg300. Problem is, its too thick, way too thick to go through even a 25g. I upped the bb to 20%, but
Ekstrak Habbatussauda HabSa dapat dibeli di SupplierHerbalMurah.com. Cepat, Aman, Terpercaya. Call: 0821.390.63541. SMS: 0821.390.63541, PIN BB: 53B52B9C
A tclkitsh-8.6.3-win32-x86_64.exe win32-x86_64 3827d0c8fab8a88fad26b62bb1becae808ce6d5a D 2014-11-24T03:44:52.776 U rkeene Z 08392679201561126127f2b233bdcc94 ...
چند‏شکلی ناحیۀ اگزون سوم جایگاه ژن FABP4 و ارتباط الگو‏های ژنوتیپی شناسایی‌شده با صفات مرتبط با رشد با استفاده از 45 رأس گاو شامل نژاد سیستانی (30 رأس) و دشتیاری (15 رأس) بررسی شد. DNA از خون کامل استخراج و کیفیت آنها به‌کمک الکتروفورز ژل آگارز یک درصد بررسی شد. پس از تکثیر زنجیره‏ای پلی‏مرازی (PCR) و هضم آنزیمی آنها با NlaIII و الکتروفورز روی ژل آگارز 8/2 درصد، الگو‏های ژنوتیپی دام‏ها براساس اندازه و تعداد باند‏ها تعیین شد. فراوانی نسبی الگو‏های باندی شناسایی‌شده شامل ژنوتیپ‏هایAA ، AB، و BB در دو نژاد سیستانی و دشتیاری به‌ترتیب 67، 30، و 3 و نیز 73، 27، و صفر درصد بودند.
"Dichotomous Expression of TNF Superfamily Ligands on Antigen-Presenting Cells Controls Post-priming Anti-viral CD4+ T Cell ... DeBenedette, M. A.; Shahinian, A.; Mak, T. W.; Watts, T. H. (1997). "Costimulation of CD28- T lymphocytes by 4-1BB ligand". ...
Schwarz H (March 2005). "Biological activities of reverse signal transduction through CD137 ligand". Journal of Leukocyte ... receptor and ligand and potential applications in cancer therapy". Archivum Immunologiae et Therapiae Experimentalis. 47 (5): ... 8 (4): 281-4. doi:10.1038/cmi.2010.82. PMC 4002439. PMID 21217771. Jang IK, Lee ZH, Kim YJ, Kim SH, Kwon BS (January 1998). " ... Zhou Z, Kim S, Hurtado J, Lee ZH, Kim KK, Pollok KE, Kwon BS (February 1995). "Characterization of human homologue of 4-1BB and ...
Its ligand is ICOSL, expressed mainly on B cells and dendritic cells. The molecule seems to be important in T cell effector ... The ligand for GITR is mainly expressed on antigen presenting cells. Antibodies to GITR have been shown to promote an anti- ... PD-1: short for Programmed Death 1 (PD-1) receptor, has two ligands, PD-L1 and PD-L2. This checkpoint is the target of Merck & ... Binding with its two ligands are CD80 and CD86, expressed on dendritic cells, prompts T cell expansion. CD28 was the target of ...
"Costimulation as a platform for the development of vaccines: a peptide-based vaccine containing a novel form of 4-1BB ligand ...
Binding of the B7 of APC to CTLA-4 of T-cells causes inhibition of the activity of T-cells. There are two major types of B7 ... The B7-CTLA-4 binding suppresses T cell activation. The balance between the opposing signals generated by B7-CD28 and B7-CLTA-4 ... In the TNF family of molecules, the protein 4-1BB (CD137) on the T cell may bind to 4-1BB ligand (4-1BBL) on the APC. The B7 ( ... CTLA-4-knockout mice are unable to stop immune responses, and develop a fatal massive lymphocyte proliferation. Apart from B7-1 ...
Ligand at the US National Library of Medicine Medical Subject Headings (MeSH) ... 4-1BB is a type 2 transmembrane glycoprotein receptor belonging to the TNF superfamily, expressed on activated T Lymphocytes.[1 ... 4-1BBL (4-1BB ligand) is found on APCs (antigen presenting cells) and binds to 4-1BB. ... Retrieved from "https://en.wikipedia.org/w/index.php?title=4-1BB_ligand&oldid=842807712" ...
In step 4, the N-acetyl-glucosamine-1-phosphate, which is now a monophosphate, attacks UTP. Uridine triphosphate, which is a ... Each MurNAc is attached to a short (4- to 5-residue) amino acid chain, containing L-alanine, D-glutamic acid, meso- ... The sugar component consists of alternating residues of β-(1,4) linked N-acetylglucosamine (NAG) and N-acetylmuramic acid (NAM ... 4). (When UDP is used as an energy source, it gives off an inorganic phosphate.) This initial stage, is used to create the ...
66 (4): 421-9. doi:10.1002/pros.20372. PMID 16302265.. *^ Singh AP, Chaturvedi P, Batra SK (January 2007). "Emerging roles of ... 4] They bind to pathogens as part of the immune system. Overexpression of the mucin proteins, especially MUC1, is associated ...
Certain members are considered members of the "small leucine-rich proteoglycan family" (SLRP).[4] These include decorin, ...
"pH-dependency of basic ligand binding to alpha 1-acid glycoprotein (orosomucoid)". The Biochemical Journal. 280 ( Pt 1) (1): ... The effect of these changes on drug protein binding and drug delivery, however, appear to be minimal.[4] AGP shows a complex ...
In S-glycosylation, a beta-GlcNAc is attached to the sulfur atom of a cysteine residue.[4] ... 585 (4): 645-650. doi:10.1016/j.febslet.2011.01.023. ISSN 0014-5793. PMID 21251913.. ...
Text is available under the Creative Commons Attribution-ShareAlike License; additional terms may apply. By using this site, you agree to the Terms of Use and Privacy Policy. Wikipedia® is a registered trademark of the Wikimedia Foundation, Inc., a non-profit organization ...
... is a receptor for hyaluronic acid and can also interact with other ligands, such as osteopontin, collagens, and matrix ... Oxley SM, Sackstein R (Nov 1994). "Detection of an L-selectin ligand on a hematopoietic progenitor cell line". Blood. 84 (10): ... Burdick MM, Chu JT, Godar S, Sackstein R (May 2006). "HCELL is the major E- and L-selectin ligand expressed on LS174T colon ... Sackstein R, Dimitroff CJ (Oct 2000). "A hematopoietic cell L-selectin ligand that is distinct from PSGL-1 and displays N- ...
CXCL10, hemokin (C-X-C motiv) ligand 10, ili IP-10[1] je mali citokin iz CXC hemokin familije koji je takođe poznat kao 10 kDa ... CXCL10 - chemokine (C-X-C motif) ligand 10". Архивирано из оригинала на датум 20. 04. 2010. Приступљено 17. 07. 2010.. ... O'Donovan (1999). „Physical mapping of the CXC chemokine locus on human chromosome 4.". Cytogenet. Cell Genet. 84: 39-42. PMID ... 4] CXCL10 gen je lociran na ljudskom hromozomu 4 u klasteru sa nekoliko drugih CXC hemokina.[5] Ovaj hemokin dejstvuje putem ...
TNF (ligand) superfamilija. *4-1BB ligand. *Faktor aktivacije B-ćelija. *FAS ligand ... 1996 Dec 15;4(12):1453-63. PMID 8994971. *↑ Knox C, Law V, Jewison T, Liu P, Ly S, Frolkis A, Pon A, Banco K, Mak C, Neveu V, ...
TNF (ligand) superfamilija. *4-1BB ligand. *Faktor aktivacije B-ćelija. *FAS ligand ... 86 (4): 1243-1254. PMID 7632928.. *^ Yoshida K, Taga T, Saito M, Suematsu S, Kumanogoh A, Tanaka T, Fujiwara H, Hirata M, ... 53 (4): 974-81. PMID 8547494. doi:10.1095/biolreprod53.4.974.. *. Mosley B; De Imus C; Friend D; et al. (1997). „Dual ... 82 (4): 1120-6. PMID 8353278.. *. Davis S; Aldrich TH; Stahl N; et al. (1993). „LIFR beta and gp130 as heterodimerizing signal ...
TNF (ligand) superfamilija. *4-1BB ligand. *Faktor aktivacije B-ćelija. *FAS ligand ... BLyS (Belimumab) • CTLA-4 (Ipilimumab, Tremelimumab) • CAT (Bertilimumab, Lerdelimumab, Metelimumab) • Integrin (Natalizumab ...
CXCL6, hemokin (C-X-C motiv) ligand 6, je mali citokin iz CXC hemokin familije koji je takođe poznat kao granulocit hemotaksni ... O'Donovan N, Galvin M, Morgan J (1999). „Physical mapping of the CXC chemokine locus on human chromosome 4". Cytogenet Cell ... Modi W, Chen Z (1998). „Localization of the human CXC chemokine subfamily on the long arm of chromosome 4 using radiation ... CXCL6 gen je lociran na ljudskom hromozomu 4 u klasteru sa drugim CXC hemokin genima.[3][4][5] ...
CXCL2, hemokin (C-X-C motiv) ligand 2, je mali citokin koji pripada CXC hemokin familiji. Os se takođe zove makrofagni ... O'Donovan, N., Galvin, M., Morgan, J. G. (1999). „Physical mapping of the CXC chemokine locus on human chromosome 4". Cytogenet ... 4] CXCL2 mobiliše ćelije putem interakcije sa hemokin receptorom na ćelijskoj površini koji se zove CXCR2.[3][5] ... Gen za CXCL2 je lociran na ljudskom hromozomu 4 u klasteru sa drugim CXC hemokinima.[ ...
TNF (ligand) superfamilija. *4-1BB ligand. *Faktor aktivacije B-ćelija. *FAS ligand ... Ljudski TNF gen (TNFA) je bio kloniran 1985.[9] On se nalazi na hromozomu 6p21.3, sadrži oko 3 kb i ima 4 eksona. Zadnji ekson ... 316 (6028): 552-4. PMID 2993897. doi:10.1038/316552a0.. *^ Beutler B, Milsark IW, Cerami AC (1985). „Passive immunization ... Nansi H. Ruddle sa Jelskog univerziteta, koja je istovremeno nezavisno objavila tu istu aktivnost.[4] Naknadno 1975 godine dr. ...
CCL, hemokin (C-C motiv) ligand 1, je mali glikoprotein koji izlučuju aktivirane T ćelije iz familije inflamatornih citokina ... 89 (7): 2950-4. PMC 48781 . PMID 1557400.. *^ Roos RS, Loetscher M, Legler DF, Clark-Lewis I, Baggiolini M, Moser B (1997). „ ... 272 (28): 17251-4. PMID 9211859.. *^ Mire-Sluis, Anthony R.; Thorpe, Robin, ур. (1998). Cytokines (Handbook of ...
1996). „The lymphocyte chemoattractant SDF-1 is a ligand for LESTR/fusin and blocks HIV-1 entry". Nature. 382: 829-833.. CS1 ... Ovaj molekul je zvanično zove hemokin (C-X-C motiv) ligand 12.[1] ... Entrez Gene: CXCL12 chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1)".. ... 2007). „Clinical importance and therapeutic implications of the pivotal CXCL12-CXCR4 (chemokine ligand-receptor) interaction in ...
CCL13, hemokin (C-C motiv) ligand 13, je mali citokin iz CC hemokin familije. Njegov gen se nalazi na ljudskom hromozomu 17 ... 1996). „Human monocyte chemoattractant protein (MCP)-4 is a novel CC chemokine with activities on monocytes, eosinophils, and ... 2000). „Monocyte chemoattractant protein (MCP)-4 expression in the airways of patients with asthma. Induction in epithelial ... 4] CCL13 može biti indukovan inflamatornim citokinima interleukin 1 i TNF-α.[5] ...
CCL8, hemokine (C-C motiv) ligand 8, je mali citokin iz CC hemokin familije koji se nekad zvao monocit hemotaksni protein-2 ( ... U toj grupi receptora su CCR1, CCR2B i CCR5.[4][5] Reference[уреди]. *^ Van Coillie; et al. (1997). „The human MCP-2 gene ( ... 4,0 4,1 Gong; et al. (1998). „Monocyte Chemotactic Protein-2 Activates CCR5 and Blocks CD4/CCR5-mediated HIV-1 Entry/ ... 4] CCL8 dejstvuje putem vezivanja za nekoliko različitih hemokin receptora na ćelijskoj površini. ...
CCL28, hemokin (C-C motiv) ligand 28, takođe poznat kao mukozni epitelijalni hemokin (MEC), CCK1 i SCYA28, je citokin. CCL28 ... 2000). „A novel chemokine ligand for CCR10 and CCR3 expressed by epithelial cells in mucosal tissues". J. Immunol. 165: 2943- ... 4] CCL28 je bio impliciran u migraciju IgA-izražavajućih ćelija ka mlečnim žlezdama[5], pljuvačnim žlezdama, crevima[6] i ...
CCL24, hemokine (C-C motiv) ligand 24, takođe poznat kao mijeloidni progenitor inhibitorni faktor 2 (MPIF-2), ili eozinofilni ... CCL24 interaguje sa hemokinskim receptorom CCR3 i indukuje hemotaksu eozinofila.[4] Ovaj hemokin je takođe snažno hemotaksan za ...
TNF (ligand) superfamilija. *4-1BB ligand. *Faktor aktivacije B-ćelija. *FAS ligand ... 2 (4): 283-29.. *↑ Tian Li; Larisa M. Wiggins & Christopher S. von Bartheld (2010). „Insulin-like Growth Factor-1 and ...
TNF (ligand) superfamilija. *4-1BB ligand. *Faktor aktivacije B-ćelija. *FAS ligand ...
BAFF je citokin iz TNF ligand familije. Ovaj citokin je ligand za receptore TNFRSF13B/TACI, TNFRSF17/BCMA, i TNFRSF13C/BAFFR. ... Faktor aktivacije B-ćelija, (BAFF) koji je takođe poznat kao faktor nekroze tumora ligand superfamilija član 13B, je protein ... BAFF je prirodni ligand tri neuobičajena receptora faktora nekroze tumor koji se zovu BAFF-R, TACI, i BCMA. Ova tri receptora ... Liu Y, Hong X, Kappler J, Jiang L, Zhang R, Xu L, Pan CH, Martin WE, Murphy RC, Shu HB, Dai S, Zhang G (May 2003). "Ligand- ...
... , hemokin (C-X-C motiv) ligand 16, je mali citokin iz CXC hemokin familije. On je veći od drugih hemokina (sadrži 254 ... proinflamatorni citokin (IL-1, TNF-alfa) • Th1 (INF-gama i TNF-beta) • Th2 (IL-4, IL-5, IL-6, IL-10, IL-13) • Th17 (IL-17,IL-22 ... "A transmembrane CXC chemokine is a ligand for HIV-coreceptor Bonzo". Nat Immunol 1 (4): 298-304. PMID 11017100. doi:10.1038/ ... "The transmembrane CXC-chemokine ligand 16 is induced by IFN-gamma and TNF-alpha and shed by the activity of the disintegrin- ...
FAS ligand • Limfotoksin • OX40L • RANKL • TRAIL ... TNF (ligand) superfamilija. 4-1BB ligand • Faktor aktivacije B- ... IL-1 • IL-2 • IL-3 • IL-4 • IL-5 • IL-6 • IL-7 • IL-8 • IL-9 • IL-10 • IL-11 • IL-12 (B) • IL-13 • IL-14 • IL-15 • IL-16 • IL- ... proinflamatorni citokin (IL-1, TNF-alfa) • Th1 (INF-gama i TNF-beta) • Th2 (IL-4, IL-5, IL-6, IL-10, IL-13) • Th17 (IL-17,IL-22 ... Ovaj gen i drugih deset članova CXC hemokin genske familije formiraju hemokinski genski klaster na hromozomu 4.[3][6] ...
FAS ligand • Limfotoksin • OX40L • RANKL • TRAIL ... TNF (ligand) superfamilija. 4-1BB ligand • Faktor aktivacije B- ... IL-1 • IL-2 • IL-3 • IL-4 • IL-5 • IL-6 • IL-7 • IL-8 • IL-9 • IL-10 • IL-11 • IL-12 (B) • IL-13 • IL-14 • IL-15 • IL-16 • IL- ... proinflamatorni citokin (IL-1, TNF-alfa) • Th1 (INF-gama i TNF-beta) • Th2 (IL-4, IL-5, IL-6, IL-10, IL-13) • Th17 (IL-17,IL-22 ... 4,0 4,1 4,2 4,3 4,4 4,5 4,6 Kolls JK, Lindén A (2004). "Interleukin-17 family members and inflammation". Immunity 21 (4): 467- ...
FAS ligand • Limfotoksin • OX40L • RANKL • TRAIL ... TNF (ligand) superfamilija. 4-1BB ligand • Faktor aktivacije B- ... proinflamatorni citokin (IL-1, TNF-alfa) • Th1 (INF-gama i TNF-beta) • Th2 (IL-4, IL-5, IL-6, IL-10, IL-13) • Th17 (IL-17,IL-22 ... Nature Immunology, 2003, Volume 4, pages 8-9 *↑ Bartlett et al., Murine interferon lambdas (type III interferons) exhibit ... koji je još poznat kao CRF2-4) i IFNLR1 (CRF2-12). [2][3] ...
FAS ligand • Limfotoksin • OX40L • RANKL • TRAIL ... TNF (ligand) superfamilija. 4-1BB ligand • Faktor aktivacije B- ... proinflamatorni citokin (IL-1, TNF-alfa) • Th1 (INF-gama i TNF-beta) • Th2 (IL-4, IL-5, IL-6, IL-10, IL-13) • Th17 (IL-17,IL-22 ... 1][2][3][4]. *BG00012 (oralni estar fumarata koji razvija Biogen; anticipiran brend: Panaclar®). Istraživanja faze II su ... Scler. 13 (4): 517-26. PMID 17463074. doi:10.1177/1352458506070319. CS1 održavanje: Eksplicitna upotreba et al. (link)"It has ...
FAS ligand • Limfotoksin • OX40L • RANKL • TRAIL ... TNF (ligand) superfamilija. 4-1BB ligand • Faktor aktivacije B- ... IL-1 • IL-2 • IL-3 • IL-4 • IL-5 • IL-6 • IL-7 • IL-8 • IL-9 • IL-10 • IL-11 • IL-12 (B) • IL-13 • IL-14 • IL-15 • IL-16 • IL- ... proinflamatorni citokin (IL-1, TNF-alfa) • Th1 (INF-gama i TNF-beta) • Th2 (IL-4, IL-5, IL-6, IL-10, IL-13) • Th17 (IL-17,IL-22 ... Te receptorske pod-jedinice su izražene u aktiviranim monocitima i u nestimulisanim epitelijalnim ćelijama.[1][4] ...
... , hemokin (C-C motiv) ligand 14, je mali citokin iz CC hemokin familije. On je takođe poznat kao HCC-1. On se proizvodi ... proinflamatorni citokin (IL-1, TNF-alfa) • Th1 (INF-gama i TNF-beta) • Th2 (IL-4, IL-5, IL-6, IL-10, IL-13) • Th17 (IL-17,IL-22 ... 4-1BB ligand • Faktor aktivacije B-ćelija • FAS ligand • Limfotoksin • OX40L • RANKL • TRAIL ...
FAS ligand • Limfotoksin • OX40L • RANKL • TRAIL ... TNF (ligand) superfamilija. 4-1BB ligand • Faktor aktivacije B- ... proinflamatorni citokin (IL-1, TNF-alfa) • Th1 (INF-gama i TNF-beta) • Th2 (IL-4, IL-5, IL-6, IL-10, IL-13) • Th17 (IL-17,IL-22 ... BLyS (Belimumab) • CTLA-4 (Ipilimumab, Tremelimumab) • CAT (Bertilimumab, Lerdelimumab, Metelimumab) • Integrin (Natalizumab) ...
FAS ligand • Limfotoksin • OX40L • RANKL • TRAIL ... TNF (ligand) superfamilija. 4-1BB ligand • Faktor aktivacije B- ... IL-1 • IL-2 • IL-3 • IL-4 • IL-5 • IL-6 • IL-7 • IL-8 • IL-9 • IL-10 • IL-11 • IL-12 (B) • IL-13 • IL-14 • IL-15 • IL-16 • IL- ... proinflamatorni citokin (IL-1, TNF-alfa) • Th1 (INF-gama i TNF-beta) • Th2 (IL-4, IL-5, IL-6, IL-10, IL-13) • Th17 (IL-17,IL-22 ... Hepatol. 4 (6): 754-9. PMID 16716759. doi:10.1016/j.cgh.2006.03.028. Cite uses deprecated parameter ,month=. (help) ...
FGF receptor ligand: FGF1/FGF2/FGF5 • FGF3/FGF4/FGF6 • KGF (FGF7/FGF10/FGF22) • FGF8/FGF17/FGF18 • FGF9/FGF16/FGF20 FGF ... Neki citokini, kao što je Fas ligand se koriste kao signali "smrti"; oni uzrokuju da ciljne ćelije podlegnu programiranoj ... proinflamatorni citokin (IL-1, TNF-alfa) • Th1 (INF-gama i TNF-beta) • Th2 (IL-4, IL-5, IL-6, IL-10, IL-13) • Th17 (IL-17,IL-22 ... 4-1BB ligand • Faktor aktivacije B-ćelija • FAS ligand • Limfotoksin • OX40L • RANKL • TRAIL ...
... , hemokin (C-C motif) ligand 16, je mali citokin iz CC hemokin familije koji je poznat pod nekoliko pseudonima, ... proinflamatorni citokin (IL-1, TNF-alfa) • Th1 (INF-gama i TNF-beta) • Th2 (IL-4, IL-5, IL-6, IL-10, IL-13) • Th17 (IL-17,IL-22 ... 2001). "Human CC chemokine liver-expressed chemokine/CCL16 is a functional ligand for CCR1, CCR2 and CCR5, and constitutively ... 4-1BB ligand • Faktor aktivacije B-ćelija • FAS ligand • Limfotoksin • OX40L • RANKL • TRAIL ...
... , hemokin (C-C motiv) ligand 9, je mali citokin iz CC hemokin familije. On se naziva makrofagni inflamatorni protein-1 gama ... Lean J, Murphy C, Fuller K, Chambers T (2002). "CCL9/MIP-1gamma and its receptor CCR1 are the major chemokine ligand/receptor ... proinflamatorni citokin (IL-1, TNF-alfa) • Th1 (INF-gama i TNF-beta) • Th2 (IL-4, IL-5, IL-6, IL-10, IL-13) • Th17 (IL-17,IL-22 ... 4-1BB ligand • Faktor aktivacije B-ćelija • FAS ligand • Limfotoksin • OX40L • RANKL • TRAIL ...
... , hemokin (C-C motiv) ligand 4, je protein koji je kod ljudi kodiran CCL4 genom.[1][2] ... proinflamatorni citokin (IL-1, TNF-alfa) • Th1 (INF-gama i TNF-beta) • Th2 (IL-4, IL-5, IL-6, IL-10, IL-13) • Th17 (IL-17,IL-22 ... 4-1BB ligand • Faktor aktivacije B-ćelija • FAS ligand • Limfotoksin • OX40L • RANKL • TRAIL ... Res. 121 (4): 270-86. PMID 15817944. *Li L, Li HS, Pauza CD et al. (2006). "Roles of HIV-1 auxiliary proteins in viral ...
... , hemokin (C-C motiv) ligand 24, takođe poznat kao mijeloidni progenitor inhibitorni faktor 2 (MPIF-2), ili eozinofilni ... proinflamatorni citokin (IL-1, TNF-alfa) • Th1 (INF-gama i TNF-beta) • Th2 (IL-4, IL-5, IL-6, IL-10, IL-13) • Th17 (IL-17,IL-22 ... 4-1BB ligand • Faktor aktivacije B-ćelija • FAS ligand • Limfotoksin • OX40L • RANKL • TRAIL ... CCL24 interaguje sa hemokinskim receptorom CCR3 i indukuje hemotaksu eozinofila.[4] Ovaj hemokin je takođe snažno hemotaksan za ...
... , hemokin (C-C motiv) ligand 12, je mali citokin iz CC hemokin familije koji je bio opisan kod miševa. On je takođe poznat ... proinflamatorni citokin (IL-1, TNF-alfa) • Th1 (INF-gama i TNF-beta) • Th2 (IL-4, IL-5, IL-6, IL-10, IL-13) • Th17 (IL-17,IL-22 ... 4-1BB ligand • Faktor aktivacije B-ćelija • FAS ligand • Limfotoksin • OX40L • RANKL • TRAIL ...
Ligand at the US National Library of Medicine Medical Subject Headings (MeSH) ... 4-1BB is a type 2 transmembrane glycoprotein receptor belonging to the TNF superfamily, expressed on activated T Lymphocytes.[1 ... 4-1BBL (4-1BB ligand) is found on APCs (antigen presenting cells) and binds to 4-1BB. ... Retrieved from "https://en.wikipedia.org/w/index.php?title=4-1BB_ligand&oldid=842807712" ...
Tumor necrosis factor ligand superfamily member 9,4-1BBL -CH/CL fusion. B. 311. Homo sapiens. Mutation(s): 0 Gene Names: TNFSF9 ... Tumor necrosis factor ligand superfamily member 9. A. 188. Homo sapiens. Mutation(s): 0 Gene Names: TNFSF9. ... Tumor necrosis factor ligand superfamily member 9,Uncharacterized protein. C. 292. Homo sapiens. Mutation(s): 0 Gene Names: ... Tumor-targeted 4-1BB agonists for combination with T cell bispecific antibodies as off-the-shelf therapy.. Claus, C., Ferrara, ...
International biotechnology industry analysis, data and networking focused on translation, research, development, regulation, commercialization, partnering and funding.
4-1BBL, a member of the TNF superfamily, is expressed in B cells, dendritic cells, activated T cells and macrophages. 4-1BBL ... 4-1BBL binds to its receptor 4-1BB, and provides a co-stimulatory signal for T cell activation and expansion. The human 4-1BBL ... 4-1BBL, a member of the TNF superfamily, is expressed in B cells, dendritic cells, activated T cells and macrophages. ... The soluble form of 4-1BBL contains the TNF-like portion of the extracellular domain of 4-1BBL. Recombinant Human 4-1BBL is a ...
Immunogen: E.coli derived Recombinant Human 4-1BB Ligand (PeproTech catalog# 310-11) ... Anti-Human 4-1BBL specific antibody was purified by affinity chromatography employing immobilized Human 4-1BBL matrix. ... This antigen affinity purified antibody, in conjunction with PeproTechs Biotinylated Anti-Human 4-1BBL (500-P169Bt) as a ... Preparation: Produced from sera of rabbits pre-immunized with highly pure recombinant Human 4-1BBL. ...
4-1BB Ligand/TNFSF9 Antibody Pairs available through Novus Biologicals. Browse our 4-1BB Ligand/TNFSF9 Antibody Pair catalog ... ligand) superfamily, member 9 antibody pair, tumor necrosis factor ligand superfamily member 9 antibody pair ... Our 4-1BB Ligand/TNFSF9 Antibody Pairs can be used in a variety of model species: Human. Use the list below to choose the 4-1BB ... Each 4-1BB Ligand/TNFSF9 Antibody Pair is fully covered by our Guarantee+, to give you complete peace of mind and the support ...
Expression and function of 4-1BB and 4-1BB ligand on murine dendritic cells. Download Prime PubMed App to iPhone, iPad, or ... 1BB_ligand_on_murine_dendritic_cells_ L2 - https://academic.oup.com/intimm/article-lookup/doi/10.1093/intimm/14.3.275 DB - ... and its ligand (4-1BBL) have been implicated in cellular immune responses. To further characterize the expression and function ... and its ligand (4-1BBL) have been implicated in cellular immune responses. To further characterize the expression and function ...
CD137 Ligand, TNFSF9 binds to 4-1BBR also called 4-1bb Receptor and CD137, TNFRSF9. 4-1BBL stimulates the growth of activated ... 4-1BB Ligand takes part in initialization of induced cell death aka AICD.4-1BBL is also involved in cognate interactions among ... CD137L is a two directional signal transducer that has a role as a ligand to TNFRSF9 aka 4-1BBR, which is a co-stimulation ... CD137 Ligand, TNFSF9 binds to 4-1BBR also called 4-1bb Receptor and CD137, TNFRSF9. 4-1BBL stimulates the growth of activated ...
4-1BB ligand, also known as CDw137L, is a 97 kD member of the TNF superfamily mainly expressed on APCs, activated B and T cells ... It has been reported to be important in T cell proliferation and cytokine production through interaction with 4-1BB receptor. 4 ... 1BB ligand appears to be able to act as a c ... Ligand Receptor 4-1BB (CDw137) Cell Type Antigen-presenting ... 4-1BBL, CDw137L, TNFSF9, 41BBL Isotype Mouse IgG1, κ Ave. Rating Submit a Review Product Citations publications Human T ...
CD40L, CD40 ligand; GvHD. graft-versus-host disease. iTreg. induced regulatory T cell. mDC. myeloid dendritic cell. NOG. NOD.Cg ... A T cell-specific enhancer of the human CD40 ligand gene. J. Biol. Chem. 277: 7386-7395. ... Percentages of 4-1BB+ T cells are indicated after gating on Foxp3− (left column) and Foxp3+ (right column) CD4+ T cells. (A-E) ... B) 4-1BB+ T cells after short-term stimulation are mainly Treg. Human CD4+ T cells were stimulated for 3.5 h with P/I and FACS ...
The NKT cell ligand α-GalCer was incubated with CD1d dimer (BD Pharmingen, catalog No. 557599) at a molar ratio of 10:1. α- ... α-Galactosylceramide, a ligand of natural killer T cells, inhibits allergic airway inflammation. Am. J. Respir. Cell Mol. Biol. ... NKT cell ligand α-galactosylceramide blocks the induction of oral tolerance by triggering dendritic cell maturation. Eur. J. ... Asthma is induced by intranasal coadministration of allergen and natural killer T-cell ligand in a mouse model. J. Allergy Clin ...
4-1BB Ligand. By Technical Data. 4-1BB Ligand - Proteins. 4-1BB Ligand - Recombinant protein - Proteins. Human - 4-1BB Ligand ... 4-1BBL binds to its receptor 4-1BB and provides a co-stimulatory signal for T cell activation and expansion. The human 4-1BBL ... 4-1BBL, a member of the TNF superfamily, is expressed in B cells, dendritic cells, activated T cells and macrophages. ... 4-1BB Ligand - from E. coli - Proteins. Recombinant protein - Proteins. Human - Recombinant protein - Proteins. Recombinant ...
4-1BB Ligand Receptor or T Cell Antigen 4-1BB Homolog or T Cell Antigen ILA or CD137 or TNFRSF9) - Pipeline Review, H1 2018 ... Tumor Necrosis Factor Receptor Superfamily Member 9 (4-1BB Ligand Receptor or T Cell Antigen 4-1BB Homolog or T Cell Antigen ... Tumor Necrosis Factor Receptor Superfamily Member 9 (4-1BB Ligand Receptor or T Cell Antigen 4-1BB Homolog or T Cell Antigen ... Tumor Necrosis Factor Receptor Superfamily Member 9 (4-1BB Ligand Receptor or T Cell Antigen 4-1BB Homolog or T Cell Antigen ...
Ligand is a recombinant protein optimized for use in cell culture, differentiation studies, and functional assays. ... Like other Ligands from the TNFSF family, active CD137-Ligand is expected to form a non-covalent homotrimer. ... CD137-Ligand, also known as 4-1BB-Ligand or TNFRSF9-Ligand, is the natural agonist of the CD137 receptor, and a member of the ... CD137-Ligand is expressed on antigen presenting cells, such as dendritic cells, B cells, and macrophages. The binding of CD137- ...
Transduction of HMCLs with B7-1 and/or 4-1BBL retroviruses induced a high expression of B7-1 and 4-1BBL molecules and a strong ... Long-term cultured CD8(+) T-cell lines could be obtained by stimulation with the autologous B7-1/4-1BBL XG-19 HMCL. These ... Allogeneic or autologous T cells were stimulated by coculture with B7-1- and/or 4-1BBL-transduced HMCLs in the presence of ... RESULTS: Neither primary multiple myeloma cells (MMCs) nor HMCLs expressed B7-1 or 4-1BBL, and these molecules could not be ...
s4-1BBL in SF9 cell supernatants was detected by capture ELISA using antibodies to the HA tag (12CA5) for capture and s4-1BB ... Molecular cloning of a ligand for the inducible T cell gene 4-1BB: a member of an emerging family of cytokines with homology to ... The ligand for 4-1BB is found on activated B cells, macrophages, and cultured dendritic cells, as well as on several B ... Effect of 4-1BBL titration on CD28+ and CD28− T cell responses. High density resting T cells isolated from the spleens of CD28+ ...
CD137 Ligand , Tumor Necrosis Factor (Ligand) Superfamily, Member 9 , Tumor Necrosis Factor Ligand Superfamily Member 9 ... The ligand is specific for the 4-1BB RECEPTOR and may play a role in inducing the proliferation of activated peripheral blood T ... 4-1BB Ligand Equivalent Terms 4 1BB Ligand , 4 1BBL Protein , 4-1BBL Protein , ...
The ligand is specific for the 4-1BB RECEPTOR and may play a role in inducing the proliferation of activated peripheral blood T ... "4-1BB Ligand" is a descriptor in the National Library of Medicines controlled vocabulary thesaurus, MeSH (Medical Subject ... This graph shows the total number of publications written about "4-1BB Ligand" by people in this website by year, and whether " ... Below are the most recent publications written about "4-1BB Ligand" by people in Profiles. ...
CD137 ligand mediates opposite effects in human and mouse NK cells and impairs NK-cell reactivity against human acute myeloid ... CD137 and CD137 ligand constitutively coexpressed on human T and B leukemia cells signal proliferation and survival. Int J ... Mice deficient for CD137 ligand are predisposed to develop germinal center-derived B-cell lymphoma. Blood 2009;114:2280-9. ... CD137 ligand, a member of the tumor necrosis factor family, regulated immune responses via reverse signal transduction. J ...
We have brought together our full range of anti-4-1BBL antibodies in one place, making it easy for you to find exactly what you ... Our range of 4-1BBL antibodies (also known as 4-1BB Ligand / CD137L) come in a variety of different formats and to a number of ... Characterization Anti-IgG Fc Antibodies Biosimilar Antibodies for Research Use Characterization of Critical Reagents for Ligand ...
To buy Human 4-1BB Ligand please click on the Shopping List Symbol right from the indicated price. This will add the product to ... Description of Human 4-1BB Ligand. 4 1BBL Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain ... It is recommended to reconstitute the lyophilized 4 1BBL in sterile 18M-cm H2O not less than 100 g/ml, which can then be ... Lyophilized 4 1BBL although stable at room temperature for 3 weeks, should be stored desiccated below -18 C. Upon ...
... Author: Buechele, ... 4-1BB ligand modulates direct and Rituximab-induced NK-cell reactivity in chronic lymphocytic leukemia. DSpace Repository. ...
R Recombinant Cynomolgus Monkey 4-1BB/TNFRSF9 Fc Chimera Protein, Carrier-free Quantity: 100µg Life Sciences:Protein Biology: ... The Recombinant Cynomolgus 4-1BB/TNFRSF9 Fc Chimera Protein is derived from HEK293. The Recombinant Cynomolgus 4-1BB/TNFRSF9 Fc ... 4-1BB ligand receptor; 41BB; 4-1BB; CD137 antigen; CD137; CD137MGC2172; CDw137; FLJ43501; ILA; ILAhomolog of mouse 4-1BB; ... R&D Systems Recombinant Cynomolgus Monkey 4-1BB/TNFRSF9 Fc Chimera Protein, Carrier-free ...
Sample size antibodies available through Novus Biologicals. Browse our sample size antibodies all backed by our Guarantee+.
4-1BB (CD137, TNFRSF9) is a costimulatory receptor expressed on several subsets of activated immune cells. Numerous studies of ... 4-1BB agonist mAbs have demonstrated efficacy in prophylactic … ... mouse and human T cells indicate that 4-1BB promotes cellular ... Targeting of 4-1BB by monoclonal antibody PF-05082566 enhances T-cell function and promotes anti-tumor activity Cancer Immunol ... 4-1BB (CD137, TNFRSF9) is a costimulatory receptor expressed on several subsets of activated immune cells. Numerous studies of ...
found in: Murine MEC (CCL28), Fibroblast Growth Factor-Basic; Bovine FGF-Basic, 4-1BB Receptor/TNFRSF9, Human, Ebola virus-like ... B-cell activating factor (BlyS), also known as BAFF, TALL-1, TNAK, and zTNF4, is a TNF ligand superfamily member and has been ...
OX40 Ligand. PCSK9. PD-1. PD-L1. PD-L2. Prolactin. Protein L. ROR1. ROR2. SCF. Siglec-2. Siglec-3. ... Figure 4. Biotinylated Human PD-1(Cat. No. PD1-H82F1(at 1 μg/mL (5 μL/well) can bind Human PDL1 (Cat. No. PD1-H5229) with a ... Figures 4 and 5 demonstrate that the biotinylated PD1 can be applied to AlphaLISA to detect the binding activity with its ... ligand PD-L1 and PD-L2. Figures 6 and 7 demonstrate that the affinity between protein and therapeutic antibodies in SPR assay ...
1995) Regulation of immune responses by the ligands for CD27, CD30, and 4-1BB. Circulatory Shock 44:73-76, pmid:7743603.. ... 1993) Molecular cloning of a ligand for the inducible T cell gene 4-1BB: a member of an emerging family of cytokines with ... For instance, all of the antibodies, regardless of avidity or isotype, that bound near or at the ligand binding site were most ... Cells were washed twice in PBS, incubated with PE-conjugated anti-CD8 mAb, and assayed by FACS® for ligand binding. ...
The B lymphoma M12 expresses low levels of 4-1BB-L but can be induced to express higher levels by treatment of the B ceils with ... 4-1BB-AP also blocks antigen presentation by normal spleen cells. When the antigen-presenting cells express B7 molecules as ... In this paper we report that this costimulatory activity is mediated at least in part by 4-1BB ligand, a member of the tumor ... A fusion protein between 4-1BB and alkaline phosphatase (4-1BB-AP) blocks T cell activation by K46J lymphomas in both an ...
We tested the effect of combining PD ligand 1 (PD-L1) blockade with an agonistic regimen that induces 4-1BB costimulation ... We tested the effect of combining PD ligand 1 (PD-L1) blockade with an agonistic regimen that induces 4-1BB costimulation ... We tested the effect of combining PD ligand 1 (PD-L1) blockade with an agonistic regimen that induces 4-1BB costimulation ... We tested the effect of combining PD ligand 1 (PD-L1) blockade with an agonistic regimen that induces 4-1BB costimulation ...
  • 4-1BBL also called 4-1BB Ligand and CD137L, CD137 Ligand, TNFSF9 binds to 4-1BBR also called 4-1bb Receptor and CD137, TNFRSF9. (prospecbio.com)
  • CD137L is a two directional signal transducer that has a role as a ligand to TNFRSF9 aka 4-1BBR, which is a co-stimulation receptor protein in T lymphocytes. (prospecbio.com)
  • Our range of 4-1BBL antibodies (also known as 4-1BB Ligand / CD137L) come in a variety of different formats and to a number of target species. (bio-rad-antibodies.com)
  • Recognizes murine CD137L (4-1BBL). (biosave.com)
  • As a member of the TNF receptor superfamily (TNFRSF9) expressed on the cell surface, 4-1BB/CD137 provides a costimulatory signal through binding to its ligand 4-1BBL (CD137L/TNFRSF9). (diabetesjournals.org)
  • The C65-485 monoclonal antibody specifically recognizes the type II membrane protein known as 4-1BB Ligand (4-1BB-L) or CD137 Ligand (CD137L). (bdbiosciences.com)
  • The C65-485 antibody is able to react with recombinant human 4-1BB Ligand (rh4-1BB-L/CD137L) bound to CD137 (4-1BB receptor) expressed on phytohemagglutinin (PHA)-stimulated PBMC. (bdbiosciences.com)
  • Although it is thought to function mainly in co-stimulating those cell types to support their activation by antigen presenting cells expressing its ligand (CD137L), CD137 is also expressed on dendritic cells, B cells, NK cells, neutrophils and macrophages. (wikipedia.org)
  • Clone REA962 recognizes the mouse CD137L antigen, a single-pass type II membrane protein also known as 4-1BB ligand (4-1BBL) or tumor necrosis factor ligand superfamily member 9 (Tnfsf9). (miltenyibiotec.com)
  • Recent evidence in mouse models suggests that 4-1BB/CD137L interaction plays an important role in the memory CD8 T cell response to viruses. (miltenyibiotec.com)
  • CD137L-DCs are human monocyte-derived DC that are generated by CD137 ligand (CD137L) signaling. (nus.edu.sg)
  • We demonstrate that the gene signature of in vitro generated CD137L-DCs is most similar to those of GM-CSF and IL-4-generated immature DCs and of macrophages. (nus.edu.sg)
  • We offer 4-1BB Ligand/TNFSF9 Antibody Pairs for use in common research applications: Sandwich ELISA. (novusbio.com)
  • Each 4-1BB Ligand/TNFSF9 Antibody Pair is fully covered by our Guarantee+, to give you complete peace of mind and the support when you need it. (novusbio.com)
  • Our 4-1BB Ligand/TNFSF9 Antibody Pairs can be used in a variety of model species: Human. (novusbio.com)
  • Choose from our 4-1BB Ligand/TNFSF9 Antibody Pairs. (novusbio.com)
  • Receptor for TNFSF9/4-1BBL. (genecards.org)
  • The ligand encoded by this gene, TNFSF9/4-1BBL, has been shown to reactivate anergic T lymphocytes in addition to promoting T lymphocyte proliferation. (genecards.org)
  • Tumor Necrosis Factor Receptor Superfamily Member 9 (4-1BB Ligand Receptor or T Cell Antigen 4-1BB Homolog or T Cell Antigen ILA or CD137 or TNFRSF9) - Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), also known as CD137 is a member of the tumor necrosis factor (TNF) receptor family. (researchandmarkets.com)
  • Tumor Necrosis Factor Receptor Superfamily Member 9 (4-1BB Ligand Receptor or T Cell Antigen 4-1BB Homolog or T Cell Antigen ILA or CD137 or TNFRSF9) pipeline Target constitutes close to 28 molecules. (researchandmarkets.com)
  • The latest report Tumor Necrosis Factor Receptor Superfamily Member 9 - Pipeline Review, H1 2018, outlays comprehensive information on the Tumor Necrosis Factor Receptor Superfamily Member 9 (4-1BB Ligand Receptor or T Cell Antigen 4-1BB Homolog or T Cell Antigen ILA or CD137 or TNFRSF9) targeted therapeutics, complete with analysis by indications, stage of development, mechanism of action (MoA), route of administration (RoA) and molecule type. (researchandmarkets.com)
  • It also reviews key players involved in Tumor Necrosis Factor Receptor Superfamily Member 9 (4-1BB Ligand Receptor or T Cell Antigen 4-1BB Homolog or T Cell Antigen ILA or CD137 or TNFRSF9) targeted therapeutics development with respective active and dormant or discontinued projects. (researchandmarkets.com)
  • Anti-Human 4-1BBL specific antibody was purified by affinity chromatography employing immobilized Human 4-1BBL matrix. (peprotech.com)
  • This antigen affinity purified antibody, in conjunction with PeproTech's Biotinylated Anti-Human 4-1BBL (500-P169Bt) as a detection antibody, allows the detection of at least 0.2 - 0.4 ng/well of recombinant h4-1BBL. (peprotech.com)
  • 4-1BBL expression was inducible on splenic B cells by stimulation with anti-IgM antibody plus anti-CD40 mAb, on peritoneal macrophages by stimulation with lipopolysaccharide (LPS) and on splenic dendritic cells (DC) by stimulation with anti-CD40 mAb or LPS. (unboundmedicine.com)
  • Immunotherapy targeting CD8+ T cells with agonistic anti-4-1BB (CD137) monoclonal antibody (mAb) fulfills these requirements because 4-1BB-mediated signals are biased toward CD8+ T cells, promoting their survival, differentiation, and acquisition of potent cytolytic properties ( 1 ). (aacrjournals.org)
  • Our previous study illuminated that the blockade of the 4-1BB/4-1BBL costimulatory pathway with 4-1BBL monoclonal antibody decreased the acute rejection in rat with liver transplantation [ 11 ]. (hindawi.com)
  • This antibody detects endogenous levels of 4-1BBL protein. (acris-antibodies.com)
  • CD19-4-1BBL(RG6076) is a bispecific antibody targeting the 4-1BB ligand to cells bearing CD19 acting as an NK- and T-cell co-stimulator. (roche.com)
  • Also disclosed are methods of simulating hybridoma cells to increase monoclonal antibody production by administering a CD40 ligand polypeptide that stimulates B cell proliferation. (google.com.au)
  • 12. A nucleic acid encoding the antibody, or an antigen-binding portion thereof, of claim 4. (freepatentsonline.com)
  • Role of 4-1BB Ligand in Costimulation of T Lymphocyte Growth and its U" by M. A. DeBenedette, N. R. Chu et al. (dartmouth.edu)
  • These data suggest that 4-1BB ligand plays an important role in costimulation of IL-2 production and proliferation by T cells. (dartmouth.edu)
  • and Watts, Tania H., "Role of 4-1BB Ligand in Costimulation of T Lymphocyte Growth and its Upregulation on M12 B Lymphomas by cAMP" (1995). (dartmouth.edu)
  • We tested the effect of combining PD ligand 1 (PD-L1) blockade with an agonistic regimen that induces 4-1BB costimulation during chronic LCMV infection. (elsevier.com)
  • There is a boosting effect in the rescue of LCMV-specific CD8 T cell responses after dual treatment with PD-L1 blockade and 4-1BB agonistic Abs when the amount and timing of 4-1BB costimulation are carefully controlled. (elsevier.com)
  • In comparison, CD28-mediated costimulatory signals appear to function in a reciprocal manner to those induced through 4-1BB costimulation. (rupress.org)
  • Cytokine analysis of in vitro activated CD4 + and CD8 + T cells revealed that anti-4-1BB costimulation markedly enhanced interferon-γ production by CD8 + T cells and that anti-4-1BB mediated proliferation of CD8 + T cells appears to be IL-2 independent. (rupress.org)
  • In this regard, costimulation through 4-1BB and CD28 are reciprocal in nature and complimentary to one another by activating individually CD8 + and CD4 + T cells, respectively. (rupress.org)
  • 4-1BB/4-1BB ligand (4-1BBL) signaling provides T-cells activation with costimulation, that is, dependent or independent of CD28 [ 4 ]. (hindawi.com)
  • CD137 costimulation preferentially induced anti-CD3-induced redirected cytotoxicity within 4 h. (wikigenes.org)
  • CD137-Ligand, also known as 4-1BB-Ligand or TNFRSF9-Ligand, is the natural agonist of the CD137 receptor, and a member of the TNF superfamily. (miltenyibiotec.com)
  • The Recombinant Cynomolgus 4-1BB/TNFRSF9 Fc Chimera Protein is derived from HEK293. (fishersci.com)
  • The Recombinant Cynomolgus 4-1BB/TNFRSF9 Fc Chimera Protein has been validated for the following applications: Bioactivity. (fishersci.com)
  • 4-1BB (CD137, TNFRSF9) is a costimulatory receptor expressed on several subsets of activated immune cells. (nih.gov)
  • As a member of the tumor necrosis factor receptor superfamily (TNFRSF9) expressed on immune cells, 4-1BB/CD137 provides a bidirectional inflammatory signal through binding to its ligand 4-1BBL. (diabetesjournals.org)
  • This transmembrane cytokine is a bidirectional signal transducer that acts as a ligand for TNFRSF9/4-1BB, which is a costimulatory receptor molecule in T lymphocytes. (genecards.org)
  • The receptor TNFRSF9/4-1BB is absent from resting T lymphocytes but rapidly expressed upon antigenic stimulation. (genecards.org)
  • Its alternative names are tumor necrosis factor receptor superfamily member 9 (TNFRSF9), 4-1BB and induced by lymphocyte activation (ILA). (wikipedia.org)
  • 4-1BB ligand appears to be able to act as a costimulatory molecule without the engagement of other costimulatory molecules such as CD28. (biolegend.com)
  • Reports suggest that stimulation of activated T cells via CD137 Ligand does not require the presence of other costimulatory molecules, including CD28. (bdbiosciences.com)
  • Under the condition of repeated antigen stimulation, the downregulationg expresion of CD28 protein in activated T cells results in activation-induced celll death (AICD), whereas very few 4-1BB molecules may supply sufficient costimulatory signals to sustain T-cells activation and inhibit AICD [ 6 ]. (hindawi.com)
  • Our group also discovered the B7-1 and B7-2 molecules that bind to the costimulatory CD28 and coinhibitory CTLA-4 receptor and provide the critical costimulatory signal for full T cell activation, clonal expansion, and development of effector function through their interaction with CD28 on T cells. (dana-farber.org)
  • Current studies focus on the function of these novel B7 genes and their interactions with the B7/CD28-CTLA-4 pathway. (dana-farber.org)
  • Co-culture of splenic DC with 4-1BBL-transfected cells or 4-1BBL-expressing tumor cell lines led to cytokine (IL-6 and IL-12) production and co-stimulatory molecule up-regulation by splenic DC, indicating that 4-1BBL can directly activate DC. (unboundmedicine.com)
  • Our study suggests that 4-1BB on NKT cells functions as a costimulatory molecule and exacerbates the induction of NKT cell-mediated AHR, which is dependent on the IL-4Rα-mediated pathway. (jimmunol.org)
  • A member of the TNF receptor superfamily, 4-1BB (CD137), functions mainly as a costimulatory molecule for T cells ( 12 ). (jimmunol.org)
  • 4-1BB (CD137), a member of the TNF receptor superfamily, is an activation-induced T-cell costimulatory molecule. (aacrjournals.org)
  • Many studies have established that 4-1BB is a potent costimulatory molecule ( 3-5 ). (aacrjournals.org)
  • nevertheless, the available data strongly suggest that 4-1BB is a bona fide CD8+ T-cell-activating molecule ( 9 ). (aacrjournals.org)
  • It was expressed on activated T lymphocytes and function as a co-stimulatory molecule via cross-linking with 4-1BB (a.k.a, CD137). (jcancer.org)
  • 4. The nucleic acid molecule of claim 1 further comprising a linker domain encoding a peptide of at least one amino acid that links the CD154 Domain III to the TNF.alpha. (patentgenius.com)
  • The recombinant protein molecule SA-4-1BBL has been used to enhance the therapeutic efficacy of cancer vaccines with success in pre-clinical animal models. (eurekalert.org)
  • 4-1BB (CDw137) and its ligand (4-1BBL) have been implicated in cellular immune responses. (unboundmedicine.com)
  • Growing evidence indicates that anti-4-1BB monoclonal antibodies possess strong antitumor properties, which in turn are the result of their powerful CD8+ T-cell activating, IFN-γ producing, and cytolytic marker-inducing capabilities. (aacrjournals.org)
  • In vivo examination of the effects of anti-4-1BB monoclonal antibodies (mAbs) on antigen-induced T cell activation have shown that the administration of epitope-specific anti-4-1BB mAbs amplified the generation of H-2 d -specific cytotoxic T cells in a murine model of acute graft versus host disease (GVHD) and enhanced the rapidity of cardiac allograft or skin transplant rejection in mice. (rupress.org)
  • Its effectiveness is not tumor specific, and as a natural ligand, it does not cause toxicity, as is found with 4-1BB agonist antibodies. (eurekalert.org)
  • Also, 4-1BB signaling provided by 3H3, an agonistic anti-4-1BB mAb, promoted NKT cell activation resulting in enhanced cytokine production of NKT cells driven by α-GalCer. (jimmunol.org)
  • It engages with an agonistic anti-4-1BB mAb, thereby promoting the clonal expansion and survival of CD8 + T cells ( 13 , 14 ), the eradication of large established tumors ( 15 , 16 ), the abrogation of T cell-dependent Ab production ( 17 , 18 ), and the prevention of autoimmune diseases ( 19 , 20 ). (jimmunol.org)
  • These results suggest that 4-1BB expressed on DC may be involved in DC activation through DC--tumor interaction and DC--DC interaction. (unboundmedicine.com)
  • CONCLUSIONS These findings suggest that 4-1BB and 4-1BBL may be useful therapeutic targets for combating obesity-induced inflammation and metabolic disorders. (diabetesjournals.org)
  • This observation suggests that 4-1BB may be linked to the src tyrosine kinase family signaling pathway. (rupress.org)
  • It has been reported to be important in T cell proliferation and cytokine production through interaction with 4-1BB receptor. (biolegend.com)
  • Signaling via 4-1BB upregulates survival genes, enhances cell division, induces cytokine production, and prevents activation-induced cell death in T cells. (aacrjournals.org)
  • In vitro 4-1BB signaling (left panel) costimulates CD4+ and CD8+ T cells to comparable extents with respect to cytokine production and upregulation of cell survival genes, and prevents their AICD ( 3-5 ). (aacrjournals.org)
  • Numerous studies of mouse and human T cells indicate that 4-1BB promotes cellular proliferation, survival, and cytokine production. (nih.gov)
  • Following the discovery of PD-L1 and PD-L2 as the ligands for the PD-1 receptor on T cells, we demonstrated the inhibitory function of PD-L1 and PD-L2 on T cells and showed that blockade of this pathway enhanced T cell activation, proliferation, and cytokine production. (dana-farber.org)
  • Flow cytometric analyses using TKS-1 and an anti-mouse 4-1BB mAb indicated that 4-1BB was inducible on both CD4(+) and CD8(+) splenic T cells by stimulation with immobilized anti-CD3 mAb, but 4-1BBL was not expressed on resting or activated T cells. (unboundmedicine.com)
  • The human 4-1BBL gene codes for a 254 amino acid type II transmembrane containing a 28 amino acid cytoplasmic domain, a 21 amino acid transmembrane protein domain, and a 205 amino acid extracellular domain. (peprotech.com)
  • Recombinant Human 4-1BBL is a soluble 19.5 kDa protein consisting of 185 amino acid residues. (peprotech.com)
  • Human CD137 (4-1BB)-Ligand is a recombinant protein optimized for use in cell culture, differentiation studies, and functional assays. (miltenyibiotec.com)
  • A fusion protein between 4-1BB and alkaline phosphatase (4-1BB-AP) blocks T cell activation by K46J lymphomas in both an antigen-specific system and with polyclonally (anti-CD3) activated T cells. (dartmouth.edu)
  • The 4-1BB receptor is an inducible type I membrane protein and member of the tumor necrosis factor receptor (TNFR) superfamily that is rapidly expressed on the surface of CD4 + and CD8 + T cells after antigen- or mitogen-induced activation. (rupress.org)
  • The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. (genecards.org)
  • In addition, there are also 3 proteins in humans encompassing internal bona fide TRAF domains: tripartite motif (TRIM)-37, ubiquitin specific protease (USP)-7 and speckle-type POZ protein (SPOP) ( 4 ). (frontiersin.org)
  • Human T cells expressing CAR targeting mesothelin or fibroblast activation protein and containing CD3ζ and 4-1BB cytoplasmic domains were intravenously injected into immunodeficient mice bearing large, established human mesothelin-expressing flank tumors. (aacrjournals.org)
  • iPS-MEF-Ng-20D-17 cell generated from male C57BL/6 mouse embryonic fibroblasts by introducing the 4 factors (Oct3/4, Sox2, Klf4, and c-Myc) is carrying Nanog promoter-driven green fluorescent protein (GFP)/internal ribosome entry site (IRES)/puromycin-resistant gene ( 11 ). (aacrjournals.org)
  • The Fas ligand or FasL is a type II transmembrane protein that belongs to the tumor necrosis factor (TNF) family. (bionity.com)
  • Fas ligand or FasL is a type II transmembrane protein. (bionity.com)
  • Fas ligand is a homotrimeric protein and signals through trimerization of FasR , which spans the membrane of the "target" cell. (bionity.com)
  • 4-1BBR protein solution (0.5mg/ml) contains Phosphate Buffered Saline (pH 7.4) and 10% glycerol. (prospecbio.com)
  • Avidin has a very strong affinity for biotin with a K D ( dissociation constant ) of approximately 10 -15 M -1 [1] , the highest known affinity between any protein and its ligand, and, as such, prevents biotin absorption in the gastrointestinal tract. (bionity.com)
  • 4-1BB is a type 2 transmembrane glycoprotein receptor belonging to the TNF superfamily, expressed on activated T Lymphocytes . (wikipedia.org)
  • 4-1BBL antigen is a type 2 transmembrane glycoprotein which is part of the TNF superfamily that is expressed on activated T Lymphocytes. (prospecbio.com)
  • 4-1BBR is promptly produced upon antigenic stimulation but is absent from latent T lymphocytes. (prospecbio.com)
  • The ligand is specific for the 4-1BB RECEPTOR and may play a role in inducing the proliferation of activated peripheral blood T-LYMPHOCYTES. (ctdbase.org)
  • The results showed that gene silencing of 4-1BB by RNAi downregulated the 4-1BB gene expression of the splenic lymphocytes in vitro , and the splenic lymphocytes isolated from the rats with liver transplantation. (hindawi.com)
  • CD137, also designated ILA and 4-1BB in mouse, belongs to the tumor necrosis factor receptor family and delivers a costimulatory signal to T lymphocytes. (acris-antibodies.com)
  • Crosslinking of the CD137 ligand induces apoptosis in resting lymphocytes. (acris-antibodies.com)
  • 4 , 5 Tregs are phenotypically distinct CD4 + CD25 + Foxp3 + immunosuppressive lymphocytes residing in lymphoid organs and peripheral blood (PB). (bloodjournal.org)
  • Endogenous costimulatory molecules on T cells such as 4-1BB (CD137) can be leveraged for cancer immunotherapy. (rcsb.org)
  • Combination of FAP-4-1BBL with tumor antigen-targeted T cell bispecific (TCB) molecules in human tumor samples led to increased IFN-γ and granzyme B secretion. (rcsb.org)
  • RESULTS: Neither primary multiple myeloma cells (MMCs) nor HMCLs expressed B7-1 or 4-1BBL, and these molecules could not be induced by CD40 triggering. (inserm.fr)
  • Transduction of HMCLs with B7-1 and/or 4-1BBL retroviruses induced a high expression of B7-1 and 4-1BBL molecules and a strong T-cell activation ability. (inserm.fr)
  • When the antigen-presenting cells express B7 molecules as well as 4-1BB ligand, we find that B7 molecules and 4-1BB-AP both contribute to T cell activation. (dartmouth.edu)
  • Thus, like all of the other members of the TNFR family, the ligand for 4-1BB is also a member of the TNF family of molecules. (rupress.org)
  • 28-31 Additional co-stimulatory molecules include ICOS and CD40/CD40 ligand (CD40L). (bmj.com)
  • In the absence of ligand, RAR-RXR heterodimers are bound to DNA and recruit corepressors that serve as adaptor molecules to recruit factors such as histone deacetylases (HDACs), which make promoter regions unavailable for transcriptional activation. (els.net)
  • 4-1BBL, a member of the TNF superfamily, is expressed in B cells, dendritic cells, activated T cells and macrophages. (peprotech.com)
  • 4-1BB Ligand takes part in initialization of induced cell death aka AICD.4-1BBL is also involved in cognate interactions among T-cells and B-cells aka macrophages. (prospecbio.com)
  • CD137-Ligand is expressed on antigen presenting cells, such as dendritic cells, B cells, and macrophages. (miltenyibiotec.com)
  • Once expressed, 4-1BB binds to a high-affinity 4-1BB ligand (4-1BBL) that is present on a variety of APCs, including DCs, B cells, and macrophages ( 3-5 ). (aacrjournals.org)
  • In addition to its effects on T cells, ligation of the 4-1BB receptor on DCs and macrophages induces the production of IL-12 and IL-8, respectively, by these cells ( 3-5 ). (aacrjournals.org)
  • The 4-1BB-deficient mice fed an HFD showed less body weight gain, adiposity, adipose infiltration of macrophages/T cells, and tissue levels of inflammatory cytokines (e.g. (diabetesjournals.org)
  • The inflammatory cascade is triggered by cross talk between T cells and macrophages, and interaction of cell surface receptors (e.g., antigen receptor and costimulatory receptors) with their counterpart ligands is involved in this cross talk ( 8 ). (diabetesjournals.org)
  • However, given the accumulation of T cells and macrophages in obese adipose tissue, 4-1BB/4-1BBL may well have a role in obesity-induced adipose tissue inflammation and obesity-related metabolic disorders. (diabetesjournals.org)
  • It had been shown that 4-1BBL expresses on mature B cells, macrophages, and dendritic cells. (jcancer.org)
  • CD137 is expressed on activated T cells and binds an inducible ligand that is found on B cells, macrophages and dendritic cells. (acris-antibodies.com)
  • 4-1BBL (4-1BB ligand) is found on APCs (antigen presenting cells) and binds to 4-1BB. (wikipedia.org)
  • Further, combination of FAP- or CD19-4-1BBL with CEA-TCB (RG7802) or CD20-TCB (RG6026), respectively, resulted in tumor remission in mouse models, accompanied by intratumoral accumulation of activated effector CD8 + T cells. (rcsb.org)
  • FAP- and CD19-4-1BBL thus represent an off-the-shelf combination immunotherapy without requiring genetic modification of effector cells for the treatment of solid and hematological malignancies. (rcsb.org)
  • TY - JOUR T1 - Expression and function of 4-1BB and 4-1BB ligand on murine dendritic cells. (unboundmedicine.com)
  • 4-1BBL stimulates the growth of activated peripheral blood T-cells. (prospecbio.com)
  • The absence of 4-1BBR in murine subjects demonstrate augmented T cell activation, which results due to the lack of CD137 in regulatory T cells. (prospecbio.com)
  • 4-1BB participates along with OX40 on activated T cells, establishing a complex that prevents Treg and CD8+ T cell production. (prospecbio.com)
  • 4-1BBL is essential for CD8 optimal reactions in CD8 T cells. (prospecbio.com)
  • 4-1BB ligand, also known as CDw137L, is a 97 kD member of the TNF superfamily mainly expressed on APCs, activated B and T cells. (biolegend.com)
  • In this study, we demonstrate that activated nTreg and activated conventional T cells differ in their 4-1BB and CD40 ligand (CD40L) expression signatures, allowing a clear dissection from each other. (jimmunol.org)
  • Multiple studies have demonstrated that 4-1BB (CD137), a member of the TNF receptor superfamily, is expressed on several immune cells including activated T cells. (jimmunol.org)
  • However, the expression and the role of 4-1BB on natural killer T (NKT) cells have not been fully characterized. (jimmunol.org)
  • In this study, it was shown that 4-1BB was not expressed on naive NKT cells but was rapidly induced on activated NKT cells by TCR engagement with α-galactosylceramide (α-GalCer). (jimmunol.org)
  • A marine sponge glycolipid, α-galactosylceramide (α-GalCer), is well known to activate these CD1d-restricted NKT cells through CD1d-mediated Ag presentation and to induce rapidly large quantities of the Th1 cytokine IFN-γ and the Th2 cytokine IL-4, as well as TNF-α and IL-2 ( 2 , 3 ). (jimmunol.org)
  • This rapid production of cytokines regulates the activity of conventional T cells, NK cells, dendritic cells, and B cells ( 4 , 5 , 6 ). (jimmunol.org)
  • The binding of CD137-Ligand to its receptor plays a central role in co-stimulation of T cells by antigen presenting cells, and it is required for development of memory T cells. (miltenyibiotec.com)
  • B7-1 and 4-1BB ligand expression on a myeloma cell line makes it possible to expand autologous tumor-specific cytotoxic T cells in vitro. (inserm.fr)
  • Allogeneic or autologous T cells were stimulated by coculture with B7-1- and/or 4-1BBL-transduced HMCLs in the presence of interleukin-2. (inserm.fr)
  • Furthermore, the adoptive transfer of ex vivo anti-4-1BB-activated CD8+ T cells from previously tumor-treated animals efficiently inhibits progression of tumors in recipient mice that have been inoculated with fresh tumors. (aacrjournals.org)
  • Functional 4-1BB expression has also been observed on myeloid cells, such as monocytes, neutrophils, mast cells, and eosinophils ( 6 ). (aacrjournals.org)
  • Kinetic studies and expression analyses have revealed that although levels of 4-1BB expression are comparable in CD4+ and CD8+ T cells, CD8+ T cells have a considerably higher proliferative potential than CD4+ T cells ( 7 ). (aacrjournals.org)
  • 4-1BB-AP also blocks antigen presentation by normal spleen cells. (dartmouth.edu)
  • The B lymphoma M12 expresses low levels of 4-1BB-L but can be induced to express higher levels by treatment of the B ceils with cAMP, which also induces B7-1 and B7-2 in these cells. (dartmouth.edu)
  • When PD-L1-blocking Abs are given together with a single low dose of anti-4-1BB agonistic Abs, there is an enhanced and stable expansion of viral-specific CD8 T cells. (elsevier.com)
  • Conversely, when blocking Abs to PD-L1 are given with a repetitive high dose of anti-4-1BB, there is an initial synergistic expansion of viral-specific CD8 T cells by day 7, followed by dramatic apoptosis by day 14. (elsevier.com)
  • Cross-linking of 4-1BB and the T cell receptor (TCR) on activated T cells has been shown to deliver a costimulatory signal to T cells. (rupress.org)
  • Here, we expand upon previously published studies by demonstrating that CD8 + T cells when compared with CD4 + T cells are preferentially responsive to both early activation events and proliferative signals provided via the TCR and 4-1BB. (rupress.org)
  • The results of these studies suggest that regulatory signals delivered by the 4-1BB receptor play an important role in the regulation of cytotoxic T cells in cellular immune responses to antigen. (rupress.org)
  • Although not expressed in resting T cells, 4-1BB mRNA can be detected within 1.5 h of CD3/TCR or PMA/ionomycin stimulation (( 6 )), followed by cell surface expression within 10 h of activation (our personal observation). (rupress.org)
  • Currently, all published studies addressing the functional activities of the 4-1BB/4-1BBL system have been carried out in vitro and have focused on costimulatory signals generated through the 4-1BB receptor on unseparated T cells. (rupress.org)
  • In this study, we show that anti-4-1BB mAbs preferentially activate CD8 + T cells both in vitro and in vivo, alter the kinetics of tyrosine phosphorylation as well as substrates and markedly amplify the generation of antigen-specific CTL responses in vivo. (rupress.org)
  • ab64912, at a 1/500 dilution, staining Human 4-1BBL in HeLa cells, by Immunofluorescence, with (+) or without (-) immunising peptide. (abcam.com)
  • The expression of TNF superfamily receptors and ligands by T cells and DCs suggests an important role for this molecular superfamily in T cell-DC crosstalk. (nature.com)
  • TNF superfamily receptors on T cells can provide co-stimulation for the T cell response when they interact with their corresponding TNF superfamily ligands that have been upregulated on DCs. (nature.com)
  • CD137 Ligand has been reported to have costimulatory function on activated T cells. (bdbiosciences.com)
  • Some studies have reported human CD137 Ligand to be expressed preferentially on primary B cells and B-cell lines. (bdbiosciences.com)
  • 13-21 Allergens induce CD4+ T helper cells to produce type 2 (Th2) cytokines such as IL-4, IL-5, IL-6, IL-10, and IL-13. (bmj.com)
  • CD8+ T cells may lead to IgE class switching via IL-13 rather than IL-4. (bmj.com)
  • 4-1BB is expressed in activated T cells and antigen presenting cells such as dendritic cells [ 3 ]. (hindawi.com)
  • 4-1BB can supply sufficient costimulatory signals for T-cells activation [ 5 ]. (hindawi.com)
  • 4. Centrifuge for 5 minutes 300 xg to pellet cells and remove the supernatant.5. (creativebiomart.net)
  • Aliquot 1 mL cells into cryogenic vials.4. (creativebiomart.net)
  • Its receptor, 4-1BB is an inducible co-stimulatory member of the tumor necrosis factor receptor family expressed on activated CD4 and CD8 T cells. (miltenyibiotec.com)
  • 4-1BB can enhance both the proliferation and the survival of murine CD4 and CD8 T cells. (miltenyibiotec.com)
  • iPS cells can be differentiated into progenitor T cells in vitro by stimulation with the Notch ligand Delta-like 1 (DL1) overexpressed on bone marrow stromal cells, with complete maturation occurring upon adoptive transfer into Rag1 -deficient mice. (aacrjournals.org)
  • Several groups have generated induced pluripotent stem (iPS) cells from somatic cells by transduction of 1 to 4 transcription factors ( 2, 3 ). (aacrjournals.org)
  • This approach provides an opportunity to generate patient- or disease-specific pluripotent stem cells ( 4 ). (aacrjournals.org)
  • The 'switch' on the T cells activated by the drug is called 4-1BB. (innovations-report.com)
  • In addition to its role in immune regulation, 4-1BBL transmitted signals into the cells on which it was expressed (reverse signaling). (jcancer.org)
  • Recent studies indicated that 4-1BBL also expressed in non-immune cells and possessed different functions in various types of cells. (jcancer.org)
  • Increasing expression of 4-1BBL not only promoted expression of androgen receptor (AR), but also augmented proliferation and invasion ability of prostate cancer cells in androgen deprivation environment. (jcancer.org)
  • Meanwhile, inhibiting AR signal pathway by chemical antagonist was able to significantly reduce 4-1BBL mediated proliferation and invasion of PCa cells. (jcancer.org)
  • In addition to acting as a ligand by cross-linking 4-1BB, 4-1BBL could receive signals and transmit them into the cells on which it was expressed, a process referred to as reverse signal transduction. (jcancer.org)
  • Interactions between CD137 and its ligand are involved in antigen presentation and the generation of cytotoxic T cells. (acris-antibodies.com)
  • Recent basic science observations have suggested that the fate and activity of T cells (i.e., activation, proliferation, acquisition of memory, and cytolytic function versus induction of anergy, ignorance, and programmed death) are ultimately governed by the balance between positive and negative signaling within T cells conferred through interactions between various T-cell coregulatory receptors and ligands ( 15 ). (aacrjournals.org)
  • 4-1BBR produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 172 amino acids (24-187 a.a.) and having a molecular mass of 18.6kDa (Migrates at 18-28kDa on SDS-PAGE under reducing conditions). (prospecbio.com)
  • however, the potential ramifications of tonic 4-1BB signaling in CAR T cells remain unclear. (nih.gov)
  • Here, we found that tonic CAR-derived 4-1BB signaling can produce toxicity in T cells via continuous TRAF2-dependent activation of the nuclear factor κB (NF-κB) pathway and augmented FAS-dependent cell death. (nih.gov)
  • 1 In contrast, NK cells reconstituting after transplantation can overcome this major histocompatibility complex barrier by KIR ligand mismatching to mediate a potent anti-leukemia reaction by decreased triggering through inhibitory KIR. (bloodjournal.org)
  • T cells of the γδ subtype express on their surface a heterodimer involved in ligand recognition, the T-cell receptor (TCR), which is composed of a γ chain and δ chain distinct from, but related to, the α chain and β chain that form the TCR of αβ T cells. (biomedcentral.com)
  • Surprisingly, when the researchers treated normal healthy mice with SA-4-1BBL alone, the mice were protected when the researchers later exposed them to different types of tumor cells. (eurekalert.org)
  • In the research, published today in Cancer Research , mice that had never had cancer were treated with SA-4-1BBL alone, then challenged with cervical and lung cancer tumor cells at various time intervals. (eurekalert.org)
  • Following T cell activation, the B7-1-B7-2 interaction with CTLA-4, expressed on activated T cells, leads to down-regulation of T cell activation, whereas stimulation of the TCR alone leads to T cell clonal anergy. (dana-farber.org)
  • Zeng W, Su M, Anderson KS, Sasada T. Artificial antigen-presenting cells expressing CD80, CD70 and 4-1BB ligand efficiently expand functional T cells specific to tumor-associated antigens. (asu.edu)
  • The soluble form of 4-1BBL contains the TNF-like portion of the extracellular domain of 4-1BBL. (peprotech.com)
  • CD137-Ligand exists as a membrane-bound and a soluble form resulting from proteolytic cleavage of the extracellular domain. (miltenyibiotec.com)
  • PF-05082566 is a fully human IgG2 that binds to the extracellular domain of human 4-1BB with high affinity and specificity. (nih.gov)
  • 4-1BB agonist mAbs have demonstrated efficacy in prophylactic and therapeutic settings in both monotherapy and combination therapy tumor models and have established durable anti-tumor protective T-cell memory responses. (nih.gov)
  • 1993) Molecular cloning of a ligand for the inducible T cell gene 4-1BB: a member of an emerging family of cytokines with homology to tumor necrosis factor. (biosave.com)
  • Interestingly, splenic DC expressed 4-1BB constitutively, which was down-regulated by anti-CD40 stimulation. (unboundmedicine.com)
  • Our laboratory has previously found that these MDSCs can induce CD4 + CD25 + Foxp3 + T regulatory cell (Treg) in vitro and in vivo in murine cancer models ( 4 , 5 ). (aacrjournals.org)
  • To overcome these issues, we engineered proteins simultaneously targeting 4-1BB and a tumor stroma or tumor antigen: FAP-4-1BBL (RG7826) and CD19-4-1BBL. (rcsb.org)
  • These inflammatory proteins cause insulin resistance by modulating insulin signaling and lipid metabolism ( 1 , 4 ). (diabetesjournals.org)
  • The NKR-P1B/D ligand is osteoclast inhibitory lectin (Ocil), also known as Clr-b, a member of a previously cloned group of C-type lectin-related (Clr) proteins linked to the NKR-P1 receptors in the mouse NK gene complex (NKC). (jove.com)
  • Comparison of OX40 ligand and CD70 in the promotion of CD4+ T cell responses. (bio-connect.nl)
  • In this paper we report that this costimulatory activity is mediated at least in part by 4-1BB ligand, a member of the tumor necrosis factor (TNF) gene family that binds to 4-1BB, a T cell activation antigen with homology to the TNF/nerve growth factor receptor family. (dartmouth.edu)
  • Produced from sera of rabbits pre-immunized with highly pure recombinant Human 4-1BBL. (peprotech.com)
  • Based on the expression of 4-1BB and absence of CD40L expression, human alloantigen-reactive Foxp3 + nTreg can be directly isolated from MLR cultures with high purity. (jimmunol.org)
  • 4 1BBL Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 184 amino acids and having a molecular mass of 19.5kDa.The 4 1BBL is purified by proprietary chromatographic techniques. (active-bioscience.de)
  • To buy Human 4-1BB Ligand please click on the Shopping List Symbol right from the indicated price. (active-bioscience.de)
  • Synthetic peptide corresponding to Human 4-1BBL (internal sequence). (abcam.com)
  • Moreover, modulation of 4-1BB/4-1BBL signaling has been shown to affect several inflammatory processes (e.g., asthma, colitis, rheumatoid arthritis, multiple sclerosis, type 1 diabetes, atherosclerosis, and cancer) in rodents ( 13 - 15 ) and is an attractive possibility for immune therapy of human cancers ( 16 , 17 ). (diabetesjournals.org)
  • Human 4-1BB (CD137) signals are mediated by TRAF2 and activate nuclear factor-kappa B". Biochemical and Biophysical Research Communications. (wikipedia.org)
  • E.coli derived recombinant Human 4-1BBL. (lsbio.com)
  • Synthetic peptide, corresponding to amino acids 50-100 of Human 4-1BBL. (acris-antibodies.com)
  • Importantly, isolated 4-1BB + CD40L − nTreg maintain the nTreg phenotype and alloantigen-reactivity after in vitro expansion. (jimmunol.org)
  • The binding of Fas ligand with its receptor induces apoptosis . (bionity.com)
  • We could show targeting of FAP-4-1BBL to FAP-expressing tumor stroma and lymph nodes in a colorectal cancer-bearing rhesus monkey. (rcsb.org)
  • 4-1BBL binds to its receptor 4-1BB, and provides a co-stimulatory signal for T cell activation and expansion. (peprotech.com)
  • To further characterize the expression and function of 4-1BBL, we newly generated an anti-mouse 4-1BBL mAb (TKS-1), which can inhibit the interaction of 4-1BBL with 4-1BB. (unboundmedicine.com)
  • OBJECTIVE: The aim of this study was to confer an antigen-presenting cell (APC) ability on multiple myeloma cell lines (HMCLs) using B7-1 and/or 4-1BBL gene transfer. (inserm.fr)
  • MATERIALS AND METHODS: HMCLs were retrovirally transduced with B7-1 and/or 4-1BBL cDNAs. (inserm.fr)
  • Long-term cultured CD8(+) T-cell lines could be obtained by stimulation with the autologous B7-1/4-1BBL XG-19 HMCL. (inserm.fr)
  • It is recommended to reconstitute the lyophilized 4 1BBL in sterile 18M-cm H2O not less than 100 g/ml, which can then be further diluted to other aqueous solutions. (active-bioscience.de)
  • Lyophilized 4 1BBL although stable at room temperature for 3 weeks, should be stored desiccated below -18 C. Upon reconstitution 4 1BBL should be stored at 4 C between 2-7 days and for future use below -18 C. Please avoid repeated freeze-thaw cycles. (active-bioscience.de)
  • In addition, targeting of tumors with variants of 4-1BBL directed against 4-1BB also have potent antitumor effects. (aacrjournals.org)
  • In this review, we discuss the basis of the therapeutic potential of targeting the 4-1BB-4-1BBL pathway in cancer treatment. (aacrjournals.org)
  • Receptor for TNFSF14/4-1BBL. (abcam.com)
  • Both 4-1BB and 4-1BBL have been shown to play an important role in the pathogenesis of various inflammatory diseases. (diabetesjournals.org)
  • The involvement of 4-1BB/4-1BBL signaling in metabolic diseases has not been established. (diabetesjournals.org)
  • 2009) Immune regulation by 4-1BB and 4-1BBL: complexities and challenges. (miltenyibiotec.com)
  • Zhu H, Wang M, Du Y, Liu X, Weng X, Li C. 4-1BBL has a Possible Role in Mediating Castration-Resistant Conversion of Prostate Cancer via Up-Regulation of Androgen Receptor. (jcancer.org)
  • 4-1BB ligand (4-1BBL) was a transmembrane glycoprotein belonging to the tumor necrosis factor family. (jcancer.org)
  • 4-1BBL represented a promising target for enhancing antitumor immune responses. (jcancer.org)
  • Here, we reported that 4-1BBL didn't express in normal prostate tissues and benign prostatic hyperplasia tissues, but it expressed in prostate cancer (PCa) tissues at moderate level. (jcancer.org)
  • Expression of 4-1BBL was up-regulated during the transition from PCa to castration resistant prostate cancer (CRPC). (jcancer.org)
  • These novel findings indicated that 4-1BBL might mediate prostate cancer progression to castration-resistant prostate cancer via enhancing expression and function of AR. (jcancer.org)
  • Among TNF superfamily members, 4-1BBL had emerged as an important mediator of survival signaling. (jcancer.org)
  • The effects of reverse 4-1BBL signaling had received comparatively little attention in the past. (jcancer.org)
  • However, during the last few years, a number of studies appeared to shed light on the biology of 4-1BBL signaling. (jcancer.org)
  • The mice showed significant protection against tumor development, with the greatest protection when challenged two weeks after treatment with SA-4-1BBL. (eurekalert.org)
  • The cancer immunoprevention effect generated by SA-4-1BBL lasted more than eight weeks. (eurekalert.org)
  • Just giving SA-4-1BBL alone prevents the formation of tumors in animal models," Shirwan said. (eurekalert.org)
  • Although the research, which was conducted in collaboration with FasCure Therapeutics, LLC, tested the mice for cervical and lung cancers, the protective function of SA-4-1BBL works without context of specific tumor antigens, giving it the potential to be effective in preventing any number of tumor types. (eurekalert.org)
  • 4-1BB-L is absent of a signal sequence and N-linked glycosylation domain, however comprises a ser/pro-rich site proximal to the transmembrane region which is comprised of O-linked carbohydrates. (prospecbio.com)
  • In this study, we have investigated the effect of gene silencing of 4-1BB by RNA interference (RNAi) on the acute rejection in rats with liver transplantation. (hindawi.com)
  • The recombination vector of lentivirus that contains shRNA targeting the 4-1BB gene (LV-sh4-1BB) was constructed. (hindawi.com)
  • Lentivirus-mediated delivery of shRNA targeting 4-1BB gene prolonged the survival time of recipient and alleviated the injury of liver morphology in recipient rats with liver transplantation. (hindawi.com)
  • Therefore, the aim of present study was to investigate the effect of gene silencing of 4-1BB by RNA interference on the acute rejection in rats with liver transplantation. (hindawi.com)
  • RAR-RXR heterodimers act as ligand‐dependent transcription factors that bind to RA responsive elements (RAREs) in the gene promoter region. (els.net)
  • 4-1BBR, is located on the cell surface in the immune system. (prospecbio.com)
  • CD137-Ligand is studied for its role in the activation of immune response against infections and cancer, and for its involvement in autoimmunity. (miltenyibiotec.com)
  • Fas ligand-receptor interactions play an important role in the regulation of the immune system and the progression of cancer . (bionity.com)
  • Finally, sunitinib in combination with our immune therapy protocol (IL-12 and 4-1BB activation) significantly improves the long-term survival rate of large tumor-bearing mice. (aacrjournals.org)
  • The tumor necrosis factor receptor (TNFR)/TNF superfamily represented a key group of receptor/ ligands for controlling life and death in the immune system [ 3 ]. (jcancer.org)
  • Soluble Fas ligand is generated by cleaving membrane-bound FasL at a conserved cleavage site by the external serine matrix metalloproteinase MMP-7. (bionity.com)
  • DcR3 is a soluble receptor that has no signal transduction capabilities (hence a "decoy") and functions to prevent FasR -FasL interactions by competitively binding to membrane-bound Fas ligand and rendering them inactive [1] . (bionity.com)
  • Among its related pathways are T Cell Co-Signaling Pathway: Ligand-Receptor Interactions and Akt Signaling . (genecards.org)
  • Alloantigen-reactive 4-1BB + CD40L − nTreg were characterized by a completely demethylated Treg-specific demethylated region and showed alloantigen-specific suppressive properties superior to polyclonal Treg. (jimmunol.org)
  • 4-1BB was discovered more than 2 decades ago in screens for receptors on mouse concanavalin A (ConA)-activated helper and cytotoxic T-cell lines ( 2 ). (aacrjournals.org)
  • We report the cloning and characterization of a cognate ligand for the inhibitory mouse NK receptors (NKR)-P1B and NKR-P1D (CD161b/d). (jove.com)