4-1BB Ligand: A membrane bound member of the TNF superfamily that is expressed on activated B-LYMPHOCYTES; MACROPHAGES; and DENDRITIC CELLS. The ligand is specific for the 4-1BB RECEPTOR and may play a role in inducing the proliferation of activated peripheral blood T-LYMPHOCYTES.Antigens, CD137: A member of the tumor necrosis factor receptor superfamily that is specific for 4-1BB LIGAND. It is found in a variety of immune cell types including activated T-LYMPHOCYTES; NATURAL KILLER CELLS; and DENDRITIC CELLS. Activation of the receptor on T-LYMPHOCYTES plays a role in their expansion, production of cytokines and survival. Signaling by the activated receptor occurs through its association with TNF RECEPTOR-ASSOCIATED FACTORS.Ligands: A molecule that binds to another molecule, used especially to refer to a small molecule that binds specifically to a larger molecule, e.g., an antigen binding to an antibody, a hormone or neurotransmitter binding to a receptor, or a substrate or allosteric effector binding to an enzyme. Ligands are also molecules that donate or accept a pair of electrons to form a coordinate covalent bond with the central metal atom of a coordination complex. (From Dorland, 27th ed)Receptors, Nerve Growth Factor: Cell surface receptors that bind NERVE GROWTH FACTOR; (NGF) and a NGF-related family of neurotrophic factors that includes neurotrophins, BRAIN-DERIVED NEUROTROPHIC FACTOR and CILIARY NEUROTROPHIC FACTOR.Tumor Necrosis Factors: A family of proteins that were originally identified by their ability to cause NECROSIS of NEOPLASMS. Their necrotic effect on cells is mediated through TUMOR NECROSIS FACTOR RECEPTORS which induce APOPTOSIS.Receptors, Tumor Necrosis Factor: Cell surface receptors that bind TUMOR NECROSIS FACTORS and trigger changes which influence the behavior of cells.Rats, Inbred BB: A strain of Rattus norvegicus which is a model for spontaneous insulin-dependent diabetes mellitus (DIABETES MELLITUS, INSULIN-DEPENDENT).Antigens, CD: Differentiation antigens residing on mammalian leukocytes. CD stands for cluster of differentiation, which refers to groups of monoclonal antibodies that show similar reactivity with certain subpopulations of antigens of a particular lineage or differentiation stage. The subpopulations of antigens are also known by the same CD designation.Antigens, CD28: Costimulatory T-LYMPHOCYTE receptors that have specificity for CD80 ANTIGEN and CD86 ANTIGEN. Activation of this receptor results in increased T-cell proliferation, cytokine production and promotion of T-cell survival.Antigens, CD80: A costimulatory ligand expressed by ANTIGEN-PRESENTING CELLS that binds to CTLA-4 ANTIGEN with high specificity and to CD28 ANTIGEN with low specificity. The interaction of CD80 with CD28 ANTIGEN provides a costimulatory signal to T-LYMPHOCYTES, while its interaction with CTLA-4 ANTIGEN may play a role in inducing PERIPHERAL TOLERANCE.Lymphocyte Activation: Morphologic alteration of small B LYMPHOCYTES or T LYMPHOCYTES in culture into large blast-like cells able to synthesize DNA and RNA and to divide mitotically. It is induced by INTERLEUKINS; MITOGENS such as PHYTOHEMAGGLUTININS, and by specific ANTIGENS. It may also occur in vivo as in GRAFT REJECTION.Mice, Inbred C57BLT-Lymphocytes: Lymphocytes responsible for cell-mediated immunity. Two types have been identified - cytotoxic (T-LYMPHOCYTES, CYTOTOXIC) and helper T-lymphocytes (T-LYMPHOCYTES, HELPER-INDUCER). They are formed when lymphocytes circulate through the THYMUS GLAND and differentiate to thymocytes. When exposed to an antigen, they divide rapidly and produce large numbers of new T cells sensitized to that antigen.Tumor Necrosis Factor-alpha: Serum glycoprotein produced by activated MACROPHAGES and other mammalian MONONUCLEAR LEUKOCYTES. It has necrotizing activity against tumor cell lines and increases ability to reject tumor transplants. Also known as TNF-alpha, it is only 30% homologous to TNF-beta (LYMPHOTOXIN), but they share TNF RECEPTORS.CD40 Ligand: A membrane glycoprotein and differentiation antigen expressed on the surface of T-cells that binds to CD40 ANTIGENS on B-LYMPHOCYTES and induces their proliferation. Mutation of the gene for CD40 ligand is a cause of HYPER-IGM IMMUNODEFICIENCY SYNDROME, TYPE 1.Dendritic Cells: Specialized cells of the hematopoietic system that have branch-like extensions. They are found throughout the lymphatic system, and in non-lymphoid tissues such as SKIN and the epithelia of the intestinal, respiratory, and reproductive tracts. They trap and process ANTIGENS, and present them to T-CELLS, thereby stimulating CELL-MEDIATED IMMUNITY. They are different from the non-hematopoietic FOLLICULAR DENDRITIC CELLS, which have a similar morphology and immune system function, but with respect to humoral immunity (ANTIBODY PRODUCTION).B-Lymphocytes: Lymphoid cells concerned with humoral immunity. They are short-lived cells resembling bursa-derived lymphocytes of birds in their production of immunoglobulin upon appropriate stimulation.Encyclopedias as Topic: Works containing information articles on subjects in every field of knowledge, usually arranged in alphabetical order, or a similar work limited to a special field or subject. (From The ALA Glossary of Library and Information Science, 1983)Dendritic Cells, Follicular: Non-hematopoietic cells, with extensive dendritic processes, found in the primary and secondary follicles of lymphoid tissue (the B cell zones). They are different from conventional DENDRITIC CELLS associated with T-CELLS. They are derived from MESENCHYMAL STEM CELLS and are negative for class II MHC antigen and do not process or present antigen like the conventional dendritic cells do. Instead, follicular dendritic cells have FC RECEPTORS and C3B RECEPTORS that hold antigen in the form of ANTIGEN-ANTIBODY COMPLEXES on their surfaces for long periods for recognition by B-CELLS.Allergy and Immunology: A medical specialty concerned with the hypersensitivity of the individual to foreign substances and protection from the resultant infection or disorder.Fushi Tarazu Transcription Factors: Fushi tarazu transcription factors were originally identified in DROSOPHILA. They are found throughout ARTHROPODS and play important roles in segmentation and CENTRAL NERVOUS SYSTEM development.Lymphocytic choriomeningitis virus: The type species of ARENAVIRUS, part of the Old World Arenaviruses (ARENAVIRUSES, OLD WORLD), producing a silent infection in house and laboratory mice. In humans, infection with LCMV can be inapparent, or can present with an influenza-like illness, a benign aseptic meningitis, or a severe meningoencephalomyelitis. The virus can also infect monkeys, dogs, field mice, guinea pigs, and hamsters, the latter an epidemiologically important host.Lymphocytic Choriomeningitis: A form of meningitis caused by LYMPHOCYTIC CHORIOMENINGITIS VIRUS. MICE and other rodents serve as the natural hosts, and infection in humans usually occurs through inhalation or ingestion of infectious particles. Clinical manifestations include an influenza-like syndrome followed by stiff neck, alterations of mentation, ATAXIA, and incontinence. Maternal infections may result in fetal malformations and injury, including neonatal HYDROCEPHALUS, aqueductal stenosis, CHORIORETINITIS, and MICROCEPHALY. (From Joynt, Clinical Neurology, 1996, Ch26, pp1-3)CD8-Positive T-Lymphocytes: A critical subpopulation of regulatory T-lymphocytes involved in MHC Class I-restricted interactions. They include both cytotoxic T-lymphocytes (T-LYMPHOCYTES, CYTOTOXIC) and CD8+ suppressor T-lymphocytes.Exhibits as Topic: Discussions, descriptions or catalogs of public displays or items representative of a given subject.Arenaviridae Infections: Virus diseases caused by the ARENAVIRIDAE.Signal Transduction: The intracellular transfer of information (biological activation/inhibition) through a signal pathway. In each signal transduction system, an activation/inhibition signal from a biologically active molecule (hormone, neurotransmitter) is mediated via the coupling of a receptor/enzyme to a second messenger system or to an ion channel. Signal transduction plays an important role in activating cellular functions, cell differentiation, and cell proliferation. Examples of signal transduction systems are the GAMMA-AMINOBUTYRIC ACID-postsynaptic receptor-calcium ion channel system, the receptor-mediated T-cell activation pathway, and the receptor-mediated activation of phospholipases. Those coupled to membrane depolarization or intracellular release of calcium include the receptor-mediated activation of cytotoxic functions in granulocytes and the synaptic potentiation of protein kinase activation. Some signal transduction pathways may be part of larger signal transduction pathways; for example, protein kinase activation is part of the platelet activation signal pathway.TNF Receptor-Associated Factor 2: A signal transducing tumor necrosis factor receptor associated factor that is involved in TNF RECEPTOR feedback regulation. It is similar in structure and appears to work in conjunction with TNF RECEPTOR-ASSOCIATED FACTOR 1 to inhibit APOPTOSIS.Antigens, CD8: Differentiation antigens found on thymocytes and on cytotoxic and suppressor T-lymphocytes. CD8 antigens are members of the immunoglobulin supergene family and are associative recognition elements in MHC (Major Histocompatibility Complex) Class I-restricted interactions.Antigens, CD40: A member of the tumor necrosis factor receptor superfamily with specificity for CD40 LIGAND. It is found on mature B-LYMPHOCYTES and some EPITHELIAL CELLS, lymphoid DENDRITIC CELLS. Evidence suggests that CD40-dependent activation of B-cells is important for generation of memory B-cells within the germinal centers. Mutations of the gene for CD40 antigen result in HYPER-IGM IMMUNODEFICIENCY SYNDROME, TYPE 3. Signaling of the receptor occurs through its association with TNF RECEPTOR-ASSOCIATED FACTORS.Antigens, CD3: Complex of at least five membrane-bound polypeptides in mature T-lymphocytes that are non-covalently associated with one another and with the T-cell receptor (RECEPTORS, ANTIGEN, T-CELL). The CD3 complex includes the gamma, delta, epsilon, zeta, and eta chains (subunits). When antigen binds to the T-cell receptor, the CD3 complex transduces the activating signals to the cytoplasm of the T-cell. The CD3 gamma and delta chains (subunits) are separate from and not related to the gamma/delta chains of the T-cell receptor (RECEPTORS, ANTIGEN, T-CELL, GAMMA-DELTA).Tumor Necrosis Factor Ligand Superfamily Member 14: A member of tumor necrosis factor superfamily found on activated LYMPHOCYTES and MONOCYTES. It occurs as transmembrane protein that can be cleaved to release a secreted form that specifically binds to LYMPHOTOXIN BETA RECEPTOR and TUMOR NECROSIS FACTOR RECEPTOR SUPERFAMILY, MEMBER 14.Search Engine: Software used to locate data or information stored in machine-readable form locally or at a distance such as an INTERNET site.Databases, Genetic: Databases devoted to knowledge about specific genes and gene products.Tumor Necrosis Factor Ligand Superfamily Member 15: A member of tumor necrosis factor superfamily found on ENDOTHELIAL CELLS that plays a role in the inhibition of endothelial cell growth and PHYSIOLOGIC ANGIOGENESIS.Genome, Human: The complete genetic complement contained in the DNA of a set of CHROMOSOMES in a HUMAN. The length of the human genome is about 3 billion base pairs.OX40 Ligand: A membrane-bound tumor necrosis family member that is expressed on activated antigen-presenting cells such as B-LYMPHOCYTES and MACROPHAGES. It signals T-LYMPHOCYTES by binding the OX40 RECEPTOR.Antibodies: Immunoglobulin molecules having a specific amino acid sequence by virtue of which they interact only with the ANTIGEN (or a very similar shape) that induced their synthesis in cells of the lymphoid series (especially PLASMA CELLS).PubMed: A bibliographic database that includes MEDLINE as its primary subset. It is produced by the National Center for Biotechnology Information (NCBI), part of the NATIONAL LIBRARY OF MEDICINE. PubMed, which is searchable through NLM's Web site, also includes access to additional citations to selected life sciences journals not in MEDLINE, and links to other resources such as the full-text of articles at participating publishers' Web sites, NCBI's molecular biology databases, and PubMed Central.Periodicals as Topic: A publication issued at stated, more or less regular, intervals.BooksPublishing: "The business or profession of the commercial production and issuance of literature" (Webster's 3d). It includes the publisher, publication processes, editing and editors. Production may be by conventional printing methods or by electronic publishing.MEDLINE: The premier bibliographic database of the NATIONAL LIBRARY OF MEDICINE. MEDLINE® (MEDLARS Online) is the primary subset of PUBMED and can be searched on NLM's Web site in PubMed or the NLM Gateway. MEDLINE references are indexed with MEDICAL SUBJECT HEADINGS (MeSH).Serial Publications: Publications in any medium issued in successive parts bearing numerical or chronological designations and intended to be continued indefinitely. (ALA Glossary of Library and Information Science, 1983, p203)Biological Science Disciplines: All of the divisions of the natural sciences dealing with the various aspects of the phenomena of life and vital processes. The concept includes anatomy and physiology, biochemistry and biophysics, and the biology of animals, plants, and microorganisms. It should be differentiated from BIOLOGY, one of its subdivisions, concerned specifically with the origin and life processes of living organisms.Fetal Blood: Blood of the fetus. Exchange of nutrients and waste between the fetal and maternal blood occurs via the PLACENTA. The cord blood is blood contained in the umbilical vessels (UMBILICAL CORD) at the time of delivery.Hypersensitivity: Altered reactivity to an antigen, which can result in pathologic reactions upon subsequent exposure to that particular antigen.Hypersensitivity, Immediate: Hypersensitivity reactions which occur within minutes of exposure to challenging antigen due to the release of histamine which follows the antigen-antibody reaction and causes smooth muscle contraction and increased vascular permeability.Infant, Newborn: An infant during the first month after birth.Th2 Cells: Subset of helper-inducer T-lymphocytes which synthesize and secrete the interleukins IL-4, IL-5, IL-6, and IL-10. These cytokines influence B-cell development and antibody production as well as augmenting humoral responses.Th1 Cells: Subset of helper-inducer T-lymphocytes which synthesize and secrete interleukin-2, gamma-interferon, and interleukin-12. Due to their ability to kill antigen-presenting cells and their lymphokine-mediated effector activity, Th1 cells are associated with vigorous delayed-type hypersensitivity reactions.

4-1BBL cooperates with B7-1 and B7-2 in converting a B cell lymphoma cell line into a long-lasting antitumor vaccine. (1/160)

A20 is a B cell lymphoma that constitutively expresses the costimulatory molecule B7-2 yet grows readily as a tumor in syngeneic BALB/c mice. We have compared the tumorigenicity of A20 variants expressing either B7-1 (A20/B7-1) or B7-2 (A20/B7-2) with an A20 variant expressing B7-1 and B7-2 with 4-1BBL (A20/4-1BBL), a costimulatory member of the TNF family. Mice injected with tumors expressing the vector backbone (A20/CMV) or B7-1 developed tumors within 25 days of s.c. injection. In contrast, mice injected with A20/4-1BBL were tumor free for the 150-day follow-up period, while 25% of mice injected with A20/B7-2 developed tumors. Tumorigenicity experiments using nude mice indicated the requirement for T cells for variant rejection. Almost all mice that resisted the initial tumor challenge were resistant to further challenge with the parental tumor. Splenocytes from these mice showed high CTL lytic activity against the parental tumor, A20, as well as the syngeneic BALB/c lymphoma K46J, but showed background levels of lytic activity against the congenic SCID thymoma line ST-D2 or the allogeneic EL4 thymoma. In vitro blocking experiments with anti-B7-1 plus anti-B7-2 and/or soluble 4-1BB receptor showed B7-1, B7-2, and 4-1BBL all contributed to the CTL activity. Thus, the data show that neither B7-1 or B7-2 alone can confer full immunogenicity to the A20 lymphoma but that the addition of 4-1BBL results in a tumor that is highly immunogenic and can confer long-lasting protection against challenge with parental tumor in vivo.  (+info)

Cutting edge: 4-1BB is a bona fide CD8 T cell survival signal. (2/160)

After recognition of Ag/MHC and ligation of a costimulatory molecule, resting T cells will clonally expand and then delete to very low levels. Previously, it was shown that deletion can be prevented by coinjection of cytokines or proinflammatory agents such as adjuvants. Here, we demonstrate that ligation of 4-1BB blocks deletion of superantigen-activated T cells in the absence of adjuvant or additional cytokine treatment. Nearly 10 times as many staphylococcal enterotoxin A-specific T cells were detected in the spleens of mice injected 21 days previously with staphylococcal enterotoxin A and an agonist anti-4-1BB Ab compared with mice given staphylococcal enterotoxin A and a control IgG. Even though both CD4- and CD8-activated T cells expressed 4-1BB, a higher proportion of CD8 T cells were rescued compared CD4 T cells. These data suggest that although 4-1BB provides costimulation, it may also promote long-term T cell survival.  (+info)

Analysis of 4-1BB ligand (4-1BBL)-deficient mice and of mice lacking both 4-1BBL and CD28 reveals a role for 4-1BBL in skin allograft rejection and in the cytotoxic T cell response to influenza virus. (3/160)

4-1BB ligand (4-1BBL) is a member of the TNF family expressed on activated APC. 4-1BBL binds to 4-1BB (CD137) on activated CD4 and CD8 T cells and in conjunction with strong signals through the TCR provides a CD28-independent costimulatory signal leading to high level IL-2 production by primary resting T cells. Here we report the immunological characterization of mice lacking 4-1BBL and of mice lacking both 4-1BBL and CD28. 4-1BBL-/- mice mount neutralizing IgM and IgG responses to vesicular stomatitis virus that are indistinguishable from those of wild-type mice. 4-1BBL-/- mice show unimpaired CTL responses to lymphocytic choriomeningitis virus (LCMV) and exhibit normal skin allograft rejection but have a weaker CTL response to influenza virus than wild-type mice. 4-1BBL-/-CD28-/- mice retain the CTL response to LCMV, respond poorly to influenza virus, and exhibit a delay in skin allograft rejection. In agreement with these in vivo results, allogeneic CTL responses of CD28-/- but not CD28+/+ T cells to 4-1BBL-expressing APC are substantially inhibited by soluble 4-1BB receptor as is the in vitro secondary response of CD28+ T cells to influenza virus peptides. TCR-transgenic CD28-/- LCMV glycoprotein-specific T cells are insensitive to the presence of 4-1BBL when a wild-type peptide is used, but the response to a weak agonist peptide is greatly augmented by the presence of 4-1BBL. These results further substantiate the idea that different immune responses vary in their dependence on costimulation and suggest a role for 4-1BBL in augmenting suboptimal CTL responses in vivo.  (+info)

4-1BB ligand, a member of the TNF family, is important for the generation of antiviral CD8 T cell responses. (4/160)

4-1BB (CD137) is a costimulatory molecule expressed on activated T cells and interacts with 4-1BB ligand (4-1BBL) on APCs. To investigate the role of 4-1BB costimulation for the development of primary immune responses, 4-1BBL-deficient (4-1BBL-/-) mice were infected with lymphocytic choriomeningitis virus (LCMV). 4-1BBL-/- mice were able to generate CTL and eliminate acute LCMV infection with normal kinetics, but CD8 T cell expansion was 2- to 3-fold lower than in wild-type (+/+) mice. In the same mice, virus-specific CD4 Th and B cell responses were minimally affected, indicating that 4-1BB costimulation preferentially affects CD8 T cell responses. This result contrasts with our earlier work with CD40L-deficient (CD40L-/-) mice, in which the CD8 T cell response was unaffected and the CD4 T cell response was markedly impaired. When both 4-1BBL- and B7-dependent signals were absent, CD8 T cell expansion was further reduced, resulting in lower CTL activity and impairing their ability to clear LCMV. Altogether, these results indicate that T cells have distinct costimulatory requirements: optimal CD8 responses require 4-1BBL-dependent interactions, whereas CD4 responses are minimally affected by 4-1BB costimulation, but require CD40-CD40L and B7-dependent interactions.  (+info)

Critical contribution of OX40 ligand to T helper cell type 2 differentiation in experimental leishmaniasis. (5/160)

Infection of inbred mouse strains with Leishmania major is a well characterized model for analysis of T helper (Th)1 and Th2 cell development in vivo. In this study, to address the role of costimulatory molecules CD27, CD30, 4-1BB, and OX40, which belong to the tumor necrosis factor receptor superfamily, in the development of Th1 and Th2 cells in vivo, we administered monoclonal antibody (mAb) against their ligands, CD70, CD30 ligand (L), 4-1BBL, and OX40L, to mice infected with L. major. Whereas anti-CD70, anti-CD30L, and anti-4-1BBL mAb exhibited no effect in either susceptible BALB/c or resistant C57BL/6 mice, the administration of anti-OX40L mAb abrogated progressive disease in BALB/c mice. Flow cytometric analysis indicated that OX40 was expressed on CD4(+) T cells and OX40L was expressed on CD11c(+) dendritic cells in the popliteal lymph nodes of L. major-infected BALB/c mice. In vitro stimulation of these CD4(+) T cells showed that anti-OX40L mAb treatment resulted in substantially reduced production of Th2 cytokines. Moreover, this change in cytokine levels was associated with reduced levels of anti-L. major immunoglobulin (Ig)G1 and serum IgE. These results indicate that anti-OX40L mAb abrogated progressive leishmaniasis in BALB/c mice by suppressing the development of Th2 responses, substantiating a critical role of OX40-OX40L interaction in Th2 development in vivo.  (+info)

Immunomodulatory gene therapy with interleukin 12 and 4-1BB ligand: long- term remission of liver metastases in a mouse model. (6/160)

BACKGROUND: The success of immunomodulatory cancer therapy is frequently hampered by the transient nature of the antitumor immune response. We have shown previously in a mouse model that interleukin 12 (IL-12) generates a strong natural killer (NK) cell-mediated antitumor response and reduces liver metastases induced by a colon carcinoma cell line. However, only a small percentage of the treated animals developed the cytotoxic T-lymphocytic response required for a long-term systemic antitumor immunity. 4-1BB is a co-stimulatory molecule expressed on the surface of activated T cells. Interaction of 4-1BB with its natural ligand (4-1BBL) has been shown to amplify T-cell (especially CD8+)-mediated immunity. In this study, we investigated the effects of adenovirus-mediated gene therapy delivering both IL-12 and 4-1BBL genes on mice with hepatic metastases induced by colon cancer cells. METHODS: Syngeneic BALB/c mice received intrahepatic injection of poorly immunogenic MCA26 colon cancer cells. Various combinations of replication-defective adenoviruses expressing IL-12 and 4-1BBL genes were injected into the established liver tumors. Changes in tumor size and animal survival were then monitored. All statistical tests were two-sided. RESULTS: The long-term survival rate of mice treated with the combination of IL-12 and 4-1BBL was significantly improved over that of animals in the control group (P =.0001). In vivo depletion of NK cells or CD8+ T cells completely abolished the long-term survival advantage of the IL-12 plus 4-1BBL-treated animals (P<.002). Moreover, the systemic immunity induced by this combination treatment protected these animals against a subcutaneous challenge with parental MCA26 cells. CONCLUSION: Adenovirus-mediated transfer of IL-12 and 4-1BBL genes directly into liver tumors resulted in tumor regression that required both NK and CD8+ T cells and generated a potent, long-lasting antitumor immunity.  (+info)

4-1BB: still in the midst of darkness. (7/160)

4-1BB is a member of the tumor necrosis factor receptor superfamily. The receptor functions mainly as a costimulatory molecule in T lymphocytes. In addition, several lines of evidence have shown that interactions between 4-1BB and its ligand are involved in the antigen presentation process and the generation of cytotoxic T cells. Recent studies, however, have demonstrated that 4-1BB plays more diverse roles: Signals through 4-1BB are important for long-term survival of CD8+ T cells and the induction of helper T cell anergy. Clinically, there is great interest in 4-1BB, because T-cell activation induced by anti-4-1BB monoclonal antibodies is highly efficient in the eradication of established tumor cells in mice. Now, since mice deficient in 4-1BB or the 4-1BB ligand are available, subtle roles played by 4-1BB may be revealed in the near future.  (+info)

Rejection of disseminated metastases of colon carcinoma by synergism of IL-12 gene therapy and 4-1BB costimulation. (8/160)

In an orthotopic model of metastatic colon carcinoma established in the liver of mice, we have previously shown that the natural killer (NK) cells were the major effectors after intratumoral delivery of a recombinant adenovirus expressing the murine IL-12 gene. However, tumor cure and long-term survival were achieved only in a minority of animals. In the present study, we generated an effective antitumoral CD8(+ ) T-cell response by the combination of IL-12 gene therapy and systemic delivery of an agonistic monoclonal antibody against 4-1BB, a costimulatory molecule expressed on activated T cells. In the IL-12 plus anti-4-1BB combination treatment, the effective dose of IL-12 could even be reduced even up to 18-fold and still achieved a better efficacy than the maximal dose of either treatment alone. We further demonstrate that the innate and the adaptive antitumoral immune responses were synergistic, as animals bearing hepatic as well as multiple pulmonary metastases were quantitatively cured of their diseases after IL-12 gene therapy + anti-4-1BB combination treatment. Both NK and CD8(+) T cells were necessary in maintaining the long-term antitumor immunity, as depletion of either cell type in the cured animals abolished their abilities to reject tumor cells implanted at distal sites. These results indicate that synergism between innate and adaptive immune responses may be effectively exploited to treat patients with metastatic diseases.  (+info)

A membrane bound member of the TNF superfamily that is expressed on activated B-LYMPHOCYTES; MACROPHAGES; and DENDRITIC CELLS. The ligand is specific for the 4-1BB RECEPTOR and may play a role in inducing the proliferation of activated peripheral blood T-LYMPHOCYTES ...
4-1BBL, a member of the TNF superfamily, is expressed in B cells, dendritic cells, activated T cells and macrophages. 4-1BBL binds to its receptor
Get glycol chiller quotes from multiple suppliers based on total brite tanks (no jacketed brite tanks, 1, 2, 3, 4, 5, 6, 7, 8, 9+), winery usage (fermentation vessels, storage / cellar, fermentation and storage, not applicable), total fermenters (no jacketed fermenters, 1, 2, 3, 4, 5, 6, 7, 8, 9+), brewhouse capacity (3 bbl, 3.5 bbl, 5 bbl, 7 bbl, 10 bbl, 15 bbl, 20 bbl, 25 bbl, 30 bbl, 40 bbl, 50 bbl, 60 bbl, 70 bbl, 80 bbl, 90 bbl, 100 bbl), indoor or outdoor (indoors, outdoors, not sure), power supply (triple phase, single phase), fermenter capacity (3 bbl, 3.5 bbl, 5 bbl, 7 bbl, 10 bbl, 15 bbl, 20 bbl, 25 bbl, 30 bbl, 40 bbl, 50 bbl, 60 bbl, 70 bbl, 100 bbl, 200 bbl, 300 bbl, 400 bbl, 500 bbl, 600 bbl, 700 bbl, 800 bbl, 800+ bbl, no jacketed fermenters), application (winery, brewery, pasteurizer, machine cooling, food processing, air conditioning, cidery, distillery, restaurant), wine types (red, white, red and white, not applicable), conditioning tank capacity (3 bbl, 3.5 bbl, 5 bbl, 7 bbl, 10 bbl,
Novel 4-1BB ligand (4-1BB-L) polypeptides and a human cell surface receptor designated 4-1BB that binds 4-1BB-L are provided. Isolated 4-1BB-L-encoding and human 4-1BB-encoding DNA sequences, recombinant expression vectors comprising the isolated DNA sequences, and host cells transformed with the recombinant expression vectors are disclosed, along with methods for producing the novel polypeptides by cultivating such transformed host cells. Soluble forms of the 4-1BB-L or 4-1BB polypeptides are derived from the extracellular domains thereof.
Yes, for BB30 a circlip goes in a groove in the BB shell, then the bearing gets pushed into the BB until it hits the circlip. Some BB30 frames have a step milled into the BB shell and dont use the circlips. For PF30 the bearings are pressed into platic cups and the cups are pressed in the BB shell until flanges on the cups hit the shell ...
Yes, for BB30 a circlip goes in a groove in the BB shell, then the bearing gets pushed into the BB until it hits the circlip. Some BB30 frames have a step milled into the BB shell and dont use the circlips. For PF30 the bearings are pressed into platic cups and the cups are pressed in the BB shell until flanges on the cups hit the shell ...
Looking for Forever Young BBL™ Photorejuvenation in Modesto, CA? Call 209-890-4470 to schedule your private consultation at Skinfinite Solutions.
This item requires 3-5 Business Days to process and prepare for shipping.Description Double Swab Product has red cap Specimen Collection and Transport Systems Stock # : 413522Manufacturer # : 220109Brand : BBL CultureswabManufacturer : BDApplication : SwabstickColor : TransparentLength : 13 cmSterility : SterileUNSPSC
The BD BBL CultureSwab EZ Collection and Transport System features awesome swabs that protect and safely release organisms from their own environment.
... historical data, charts, stats and more. US High Yield BB Effective Yield is at 4.32%, compared to 4.31% the previous market day and 4.65% last year. This is lower than the long term average of 7.19%..
Anti-UQCRC2 antibody [13G12AF12BB11] (ab14745) has been cited in 63 publications. References for Human, Mouse, Rat, Ce in ICC/IF, IF, IHC-Fr, WB
The latest weekly supply report from the U.S. Energy Information Administration shows domestic ethanol supply declined for the second straight week.
description.provenance : Approved for entry into archive by Sue Kunda([email protected]) on 2013-07-31T23:54:34Z (GMT) No. of bitstreams: 3 license_rdf: 1232 bytes, checksum: bb87e2fb4674c76d0d2e9ed07fbb9c86 (MD5) BB 450_550 Lecture 15 Highlights.pdf: 6598 bytes, checksum: b2e4bb47727ec1571eddb340d1f3d6a1 (MD5) #15 Biochemistry Enzyme Regulation II Lecture for Kevin Aherns BB 450_550.mp4: 137334642 bytes, checksum: 4328d439bb165b885074c48ea054dda6 (MD5 ...
Theyre chasing their second BBL title. Heres the Sydney Sixers team guide for the BBL|09 season, including their fixtures and squad.
... made by Holley, for as low as $3,637.99. Free shipping when your order includes this part.
Active acneEvery patient is different. Your clinician will advise you on a treatment plan to achieve your desired results. We recommend a consult before your first treatment to better inform you of how BBL works, what to expect during and after your treatment, and the best aftercare to maximize your results ...
description.provenance : Approved for entry into archive by Sue Kunda([email protected]) on 2013-07-16T23:57:43Z (GMT) No. of bitstreams: 3 license_rdf: 1232 bytes, checksum: bb87e2fb4674c76d0d2e9ed07fbb9c86 (MD5) #8 Biochemistry Lecture (Gels_Enzymes) from Kevin Aherns BB 350.M4A: 46798132 bytes, checksum: 8d0475a48bfe969186d59ad4f1d95f5b (MD5) BB350 Lecture 8 Highlights.pdf: 7830 bytes, checksum: a9be16216feab15f68370e32e9f686db (MD5 ...
根據歐洲醫學期刊指出,淨透明亮膚質是肌膚看起來年輕、健康的關鍵,同時也顯著影響個人吸引力;而擁有光滑勻亮的膚色,也會使人看起來更年輕,魅力也因此提升。每個文化對美的標準有所不同,亞洲女性在乎肌膚暗沉、斑點、膚色不均等肌膚困擾,努力追求更加明亮
I was reading today about the Promises, Page 83-84 from the BB. Those are the famous promises. I was looking though the BB, and found many others. This one stood...
敏兒安safeT21expressTM是一項高敏性胎兒染色體疾病檢測技術,利用孕婦懷孕期間,其胎兒釋放於母體血循環中的DNA作出分析。採用新一代DNA測序技術對媽媽和BB的游離DNA進行深度測序,並將測序結果進行生物信息分析,可以從中得知BB的遺傳信息,常見的包括 ...
Clone TKS-1 recognizes the mouse CD137L antigen, a Single-pass type II membrane protein also known as 4-1BB ligand (4-1BBL) or Tumor necrosis factor ligand superfamily member 9 (Tnfsf9). CD137L is expressed on activated APC and plays an essential role in regulating adaptive immune responses. Its receptor, 4-1BB is an inducible costimulatory member of the tumor necrosis factor receptor family expressed on activated CD4 and CD8 T cells. 4-1BB can enhance both the proliferation and the survival of murine CD4 and CD8 T cells. Recent evidence in mouse models suggests that 4-1BB/CD137L interaction plays an important role in the memory CD8 T cell response to viruses. - USA
Purpose: Cultured tumor fragments from melanoma metastases have been used as a source of tumor-infiltrating lymphocytes (TIL) for adoptive cell therapy. The expansion of tumor-reactive CD8+ T cells with IL-2 in these early cultures is critical in generating clinically active TIL infusion products, with a population of activated 4-1BB CD8+ T cells recently found to constitute the majority of tumor-specific T cells. Experimental Design:We used an agonistic anti-4-1BB antibody added during the initial tumor fragment cultures to provide in situ 4-1BB co-stimulation. Results: Addition of an agonistic anti-4-1BB antibody could activate 4-1BB signaling within early cultured tumor fragments and accelerated the rate of memory CD8+ TIL outgrowth that were highly enriched for melanoma antigen specificity. This was associated with NFkappaB activation and the induction of T-cell survival and memory genes, as well as enhanced IL-2 responsiveness, in the CD8+ T cells in the fragments and emerging from the ...
Immune checkpoints are one of the protective mechanisms in normal organisms. Under the initiation of the usual immune system, T cells can perform antigen-specific cytotoxicity and guide other immune responses against foreign organisms with antigens different from the host itself; however, such functions need to have a set of regulatory functions to avoid causing autoimmune reactions or injuring their own cells or tissues when fighting foreign cells. This set of regulatory functions, which we call immune checkpoint mechanisms, simply means that different groups of ligand and receptor reactions increase or inhibit the immune effects of T cells.. With years experience, Creative BioMart provides a wide range of immune checkpoint proteins and the bio-activity of all those products has been assayed and confirmed, making them essential materials for mechanistic studies and development of new therapeutics.. Creative BioMart immune checkpoint proteins mainly include: 2B4, 4-1BB, 4-1 BB Ligand, B7-1, ...
Immune checkpoints are one of the protective mechanisms in normal organisms. Under the initiation of the usual immune system, T cells can perform antigen-specific cytotoxicity and guide other immune responses against foreign organisms with antigens different from the host itself; however, such functions need to have a set of regulatory functions to avoid causing autoimmune reactions or injuring their own cells or tissues when fighting foreign cells. This set of regulatory functions, which we call immune checkpoint mechanisms, simply means that different groups of ligand and receptor reactions increase or inhibit the immune effects of T cells.. With years experience, Creative BioMart provides a wide range of immune checkpoint proteins and the bio-activity of all those products has been assayed and confirmed, making them essential materials for mechanistic studies and development of new therapeutics.. Creative BioMart immune checkpoint proteins mainly include: 2B4, 4-1BB, 4-1 BB Ligand, B7-1, ...
Immune checkpoints are one of the protective mechanisms in normal organisms. Under the initiation of the usual immune system, T cells can perform antigen-specific cytotoxicity and guide other immune responses against foreign organisms with antigens different from the host itself; however, such functions need to have a set of regulatory functions to avoid causing autoimmune reactions or injuring their own cells or tissues when fighting foreign cells. This set of regulatory functions, which we call immune checkpoint mechanisms, simply means that different groups of ligand and receptor reactions increase or inhibit the immune effects of T cells.. With years experience, Creative BioMart provides a wide range of immune checkpoint proteins and the bio-activity of all those products has been assayed and confirmed, making them essential materials for mechanistic studies and development of new therapeutics.. Creative BioMart immune checkpoint proteins mainly include: 2B4, 4-1BB, 4-1 BB Ligand, B7-1, ...
Immune checkpoints are one of the protective mechanisms in normal organisms. Under the initiation of the usual immune system, T cells can perform antigen-specific cytotoxicity and guide other immune responses against foreign organisms with antigens different from the host itself; however, such functions need to have a set of regulatory functions to avoid causing autoimmune reactions or injuring their own cells or tissues when fighting foreign cells. This set of regulatory functions, which we call immune checkpoint mechanisms, simply means that different groups of ligand and receptor reactions increase or inhibit the immune effects of T cells.. With years experience, Creative BioMart provides a wide range of immune checkpoint proteins and the bio-activity of all those products has been assayed and confirmed, making them essential materials for mechanistic studies and development of new therapeutics.. Creative BioMart immune checkpoint proteins mainly include: 2B4, 4-1BB, 4-1 BB Ligand, B7-1, ...
Lot 4 at 2014 Austin, TX Microbrewery - Lot List Posted: 20BBL Brewhouse Package, (6) 20BBL Fermenters, (8) 20BBL Serving Tanks, Keg Wash/Fill + Support from New Mill Capital.
Lot 6 at 2014 Austin, TX Microbrewery - Lot List Posted: 20BBL Brewhouse Package, (6) 20BBL Fermenters, (8) 20BBL Serving Tanks, Keg Wash/Fill + Support from New Mill Capital.
TENTANG BB PLUS COLLAGEN BB Plus ni dihasilkan untuk membantu dan merangsang pengeluaran kolagen pada kulit. Kolagen penting untuk mengembalikan keremajaan dan kehalusan kulit secara menyeluruh. BB Plus diperbuat daripada 5000mg kolagen terhidrolisis bagi memudahkan penyerapan dalam badan. Tambahan ekstrak biji anggur dan juga Vitamin C menjadi kofaktor untuk melindungi rangkaian kolagen. BB PLUS BERTINDAK…
Shop a large selection of products and learn more about CD49b Hamster anti-Mouse, BB700, Clone: HMα2, BD Optibuild 50μg; BB700 50μg; BB700.
Missha Signature CC BB krém (Complexion Coordinating), azaz arcszín kiegyenlítő, szabályozó krém. Még természetesebb, még tisztább megjelenés!
I am trying to find an equation to get a rough estimate of CO2 produced during fermentation. I figure that it should be able to be calculated by Degree Plato per Bbl. So to figure CO2 produced over fermentation one could go CO2(by the ton)=(Bbls)*(x)*(O.G.-F.G). So for one Bbl changing one degree it would be CO2=(1)(x)(1). I just need to know if this is reasonable and what one Bbl produces, which would be my x. I believe this should be somewhat constant as it just reflects CO2 output by
Pentek 255495, ECP20-20BB Pleated Cellulose-Polyester, 4.5 x 20, 20 Micron-Pentek 255495, ECP20-20BB Pleated Cellulose-Polyester, 4.5 x 20, 20 M
KATRVRKQIVDGKKVRVAVASGKTID. Chain W. MKIKLVRSVIGRPGNQVKTVQALGLRKIGDSREVSDTPAVRGMVKTVKHLLEVQE. Chain 1. MAKDGPRIIVKMESSAGTGFYYTTTKNRRNTQAKLELKKYDPVAKKHVVFREKKV. Chain 3. MPKMKTHKMAKRRIKITGTGKVMAFKSGKRHQNTGKSGDEIRGKGKGFVLAKAEWARMKLMLPRGK. Chain 2. MKRTYQPNNRKRAKTHGFRARMKTKSGRNILARRRAKGRHQLTVSDE. Chain 5. S(BB9)T(DBU)(BB9)(3GL)(BB9)C(BB9)(MH6)(BB9)(DHA)(NH2). Chain 4. MKVRSSVKKMCDNCKVVRRHGRVLVICSNVKHKQRQG. Chain B. MKGILGTKIGMTQIWKNDRAIPVTVVLAGPCPIVQRKTAQTDGYEAVQIGYAPKAERKVNKPMQGHFAKAGVAPTRILRE ...
Kert szked s, Az reged s ellen - t bb t ma is , Kinek milyen tiszt t k ra, m regtelen t k ra javasolt? , F lnek a fenyeget st l, Tudom ny, DR KENDE P TER: Isten hozz d, hal l!, Olvas s a WC-n – rtalmas szok s, K r mvir g, ❤K R MVIR G s GY GY T HAT SAi❤, Term szetesen a sz vinfarktus ellen, Ah ny nyelv, annyi ember, Gy gyn v nyek s felhaszn l suk I,
Buy 3LAB Aqua BB SPF40 Moisturiser - Shade 03 30ml online at SkinStore! We have a great range of 3LAB Skin Care products available. Free delivery over $49!
Plasmid pSpCas9n(BB)-2A-Puro (PX462) from Dr. Feng Zhangs lab contains the insert hSpCas9n-2A-Puro and is published in Nat Protoc. 2013 Nov;8(11):2281-308. doi: 10.1038/nprot.2013.143. Epub 2013 Oct 24. This plasmid is available through Addgene.
This Histri was built automatically but not manually verified. As a consequence, the Histri can be incomplete or can contain errors ...
Esquemas de colores, pinturas, paletas de colores y combinaciones, gradientes y conversiones de espacio de color para el código de color hexadecimal #bb26b1.
x3A3;το βιβλίο του Κροπότκιν, "Η Μεγάλη Γαλλική Επανάσταση" μπορεί κάποιος ...
Made a big batch of helios using 1%ba 3%bb and peg300. Problem is, its too thick, way too thick to go through even a 25g. I upped the bb to 20%, but
A tclkitsh-8.6.3-win32-x86_64.exe win32-x86_64 3827d0c8fab8a88fad26b62bb1becae808ce6d5a D 2014-11-24T03:44:52.776 U rkeene Z 08392679201561126127f2b233bdcc94 ...
... dapat dibeli di SupplierHerbalMurah.com. Cepat, Aman, Terpercaya. Call: 0821.390.63541. SMS: 0821.390.63541, PIN BB: 53B52B9C
Clone REA254 recognizes the CD137L antigen, a type II transmembrane glycoprotein belonging to the TNF superfamily, which is also known as 4-1BB ligand or tumor necrosis factor ligand superfamily member 9. CD137L is expressed on a variety of antigen-presenting cells, including dendritic cells (DCs), B cells, and macrophages as well as on activated T Lymphocytes. CD137L cross-links its receptor, CD137, which is expressed on activated T cells, and co-stimulates T cell activities. Signaling through interaction with CD137 by soluble CD137L has been shown to cause T cell-expansion, cytokine induction, and upregulation of antiapoptotic genes, and to prevent activation-induced cell death. In monocytes, macrophages, and DCs, CD137L signaling induces activation, migration, survival, and differentiation. The role of CD137 signaling has been studied in several autoimmune processes, including rheumatoid arthritis, experimental autoimmune encephalomyelitis, and systemic lupus erythematosus. Additional information:
NK cell cytotoxicity is most powerful against acute myeloid leukemia (AML) cells, whereas their capacity to lyse ALL cells is generally low and difficult to predict. A novel method has been developed to redirect NK cells towards CD19, a molecule highly expressed on the surface of B-lineage ALL cells, but not expressed on normal cells other than B-lymphocytes. In this method, donor NK cells are first expanded by co-culture with irradiated K562 cell line modified to express membrane bound IL-15 and 41BB ligand (K562-mb15-41BBL). Overexpansion of these proteins promotes selective growth of NK cells. Then, the expanded NK cells are transduced with a signaling receptor that binds to CD19 (anti-CD19-BB-zeta). NK cells expressing these receptors showed powerful anti-leukemic activity against CD19+ ALL cells in vitro and in an animal model of leukemia.. This study represents the translation of laboratory findings into clinical application. It will allow us to assess the safety of infusing genetically ...
A large number of natural killer (NK) cells with high function are expected to generate especially in tumor adoptive immunotherapy. Here K562 cells were genetically modified to co-express major histocompatibility complex class I chain-related protein A (MICA), 4-1BB ligand, and IL-15, called K562-MICA-4-1BBL-IL-15. The modified K562 cells not only promoted activation, proliferation, and survival of NK cells, but also enhanced NK cell cytotoxicity. In long-term culture tests, K562-MICA-4-1BBL-IL-15 cells stimulated NK cell to expand mean 550 folds in 24-day culture and to cover from 14.8% of total peripheral blood monoclonal lymphocytes on day 1 to 86.7% on day 24. Prevalent NK cells after expansion enhanced the ability of killing targets and producing interferon gamma (IFN-γ), and kept high expression of activating receptors. The results indicated that K562-MICA-4-1BBL-IL-15 cells would be developed for expansion of NK cells ex vivo and may have important implications for clinical immunotherapy.
pure IgG SA-20001-1 pure IgG SA-20001-2-1 pure IgG SA-20003-1 SA-20003-1-B SA-20003-1-Cy5 SA-20003-1-F SA-20003-1-HP SA-20003-1-PC5 SA-20003-1-PE pure IgG SA-20003-1AH pure IgG SA-20003-2-1 pure IgG SA-20004-1 pure IgG SA-20004-2-1 pure IgG SA-20005-1 SA-20005-1-200 pure IgG SA-20005-1-FAB pure IgG SA-20005-1-FAB2 pure IgG SA-20005-1-FC pure IgG SA-20005-10 SA-20005-11 SA-20005-11-B SA-20005-11-F SA-20005-11-HP SA-20005-11-PC5 SA-20005-11-PE SA-20005-12 SA-20005-12-APC SA-20005-12-B SA-20005-12-F SA-20005-12-HP SA-20005-12-PC5 SA-20005-12-PE SA-20005-13 SA-20005-13-B SA-20005-13-F SA-20005-13-HP SA-20005-13-PC5 SA-20005-13-PE SA-20005-21-B SA-20005-21-F SA-20005-21-HP SA-20005-21-PE Aff support SA-20005-AS-1 pure IgG SA-20006-1 pure IgG SA-20006-2 pure IgG SA-20006-3 pure IgG SA-20007-1-25 pure IgG SA-20007-1-5 pure IgG SA-20007-1-FAB pure IgG SA-20007-1-FAB2 pure IgG SA-20007-1-FC SA-20007-1-HP pure IgG SA-20007-2 pure IgG SA-20007-2-10 pure IgG SA-20007-2-5 pure IgG SA
More news on the BB Cream front comes from 3LAB today. Not sure what a BB Cream is? Read here for more deets! 3LAB Perfect BB Cream SPF 40 PA+++ launched e
Need Stains and Reagents & other medical supplies? Head to Medex Supply and check out the BD BBL Indole Diagnostic Reagent and Stain Droppers, 50/Bx
Seria Aqua Petit Jelly zawiera 40% wody wraz z ekstraktem z mięty, dzięki czemu odświeża skórę, przynosząc ukojenie. Aqua Petite BB SPF20PA++ to lekki krem BB, który delikatnie nawilża i odświeża skórę sprawiając, że wygląda ona na atrakcyjną i zdrową Bardzo dobrze się wchłania ukrywając wszelkie niedoskonałości, blizny oraz przebarwienia Zmniejsza widoczność porów
Schwarz H (2005). "Biological activities of reverse signal transduction through CD137 ligand". J. Leukoc. Biol. 77 (3): 281-6. ... receptor and ligand and potential applications in cancer therapy". Arch. Immunol. Ther. Exp. (Warsz.). 47 (5): 275-9. PMID ... Zhou Z, Kim S, Hurtado J, Lee ZH, Kim KK, Pollok KE, Kwon BS (1995). "Characterization of human homologue of 4-1BB and its ... ligand". Immunol. Lett. 45 (1-2): 67-73. doi:10.1016/0165-2478(94)00227-I. PMID 7622190. Alderson MR, Smith CA, Tough TW, Davis ...
Its ligand is ICOSL, expressed mainly on B cells and dendritic cells. The molecule seems to be important in T cell effector ... The ligand for GITR is mainly expressed on antigen presenting cells. Antibodies to GITR have been shown to promote an anti- ... PD-1 - short for Programmed Death 1 (PD-1) receptor, has two ligands, PD-L1 and PD-L2. This checkpoint is the target of Merck ... Binding with its two ligands are CD80 and CD86, expressed on dendritic cells, prompts T cell expansion. CD28 was the target of ...
"Costimulation as a platform for the development of vaccines: a peptide-based vaccine containing a novel form of 4-1BB ligand ...
CD28 and CTLA-4 each interact with both B7-1 and B7-2. There are several steps to activation of the immune system against a ... Binding of the B7 of APC to CTLA-4 of T-cells causes inhibition of the activity of T-cells. There are two major types of B7 ... In the TNF family of molecules, the protein 4-1BB (CD137) on the T cell may bind to 4-1BB ligand (4-1BBL) on the APC. The B7 ( ... CTLA-4-knockout mice are unable to stop immune responses, and develop a fatal massive lymphocyte proliferation. Apart from B7-1 ...
Ligand at the US National Library of Medicine Medical Subject Headings (MeSH) ... 4-1BB is a type 2 transmembrane glycoprotein receptor belonging to the TNF superfamily, expressed on activated T Lymphocytes.[1 ... 4-1BBL (4-1BB ligand) is found on APCs (antigen presenting cells) and binds to 4-1BB. ... Retrieved from "https://en.wikipedia.org/w/index.php?title=4-1BB_ligand&oldid=842807712" ...
In step 4, the N-acetyl-glucosamine-1-phosphate, which is now a monophosphate, attacks UTP. Uridine triphosphate, which is a ... Each MurNAc is attached to a short (4- to 5-residue) amino acid chain, containing L-alanine, D-glutamic acid, meso- ... The sugar component consists of alternating residues of β-(1,4) linked N-acetylglucosamine (NAG) and N-acetylmuramic acid (NAM ... 4). (When UDP is used as an energy source, it gives off an inorganic phosphate.) This initial stage, is used to create the ...
66 (4): 421-9. doi:10.1002/pros.20372. PMID 16302265.. *^ Singh AP, Chaturvedi P, Batra SK (January 2007). "Emerging roles of ... 4] They bind to pathogens as part of the immune system. Overexpression of the mucin proteins, especially MUC1, is associated ...
Certain members are considered members of the "small leucine-rich proteoglycan family" (SLRP).[4] These include decorin, ...
"pH-dependency of basic ligand binding to alpha 1-acid glycoprotein (orosomucoid)". The Biochemical Journal. 280 ( Pt 1) (1): ... The effect of these changes on drug protein binding and drug delivery, however, appear to be minimal.[4] AGP shows a complex ...
A variety of methods used in detection, purification, and structural analysis of glycoproteins are[4]:525[11][12] ... Monosaccharides commonly found in eukaryotic glycoproteins include:[4]:526 The principal sugars found in human glycoproteins[5] ... 585 (4): 645-650. doi:10.1016/j.febslet.2011.01.023. ISSN 0014-5793. PMID 21251913.. ...
Text is available under the Creative Commons Attribution-ShareAlike License; additional terms may apply. By using this site, you agree to the Terms of Use and Privacy Policy. Wikipedia® is a registered trademark of the Wikimedia Foundation, Inc., a non-profit organization ...
... is a receptor for hyaluronic acid and can also interact with other ligands, such as osteopontin, collagens, and matrix ... Oxley SM, Sackstein R (Nov 1994). "Detection of an L-selectin ligand on a hematopoietic progenitor cell line". Blood. 84 (10): ... Burdick MM, Chu JT, Godar S, Sackstein R (May 2006). "HCELL is the major E- and L-selectin ligand expressed on LS174T colon ... Sackstein R, Dimitroff CJ (Oct 2000). "A hematopoietic cell L-selectin ligand that is distinct from PSGL-1 and displays N- ...
CXCL10, hemokin (C-X-C motiv) ligand 10, ili IP-10[1] je mali citokin iz CXC hemokin familije koji je takođe poznat kao 10 kDa ... CXCL10 - chemokine (C-X-C motif) ligand 10". Архивирано из оригинала на датум 20. 04. 2010. Приступљено 17. 07. 2010.. ... O'Donovan (1999). „Physical mapping of the CXC chemokine locus on human chromosome 4.". Cytogenet. Cell Genet. 84: 39-42. PMID ... 4] CXCL10 gen je lociran na ljudskom hromozomu 4 u klasteru sa nekoliko drugih CXC hemokina.[5] Ovaj hemokin dejstvuje putem ...
TNF (ligand) superfamilija. *4-1BB ligand. *Faktor aktivacije B-ćelija. *FAS ligand ... 1996 Dec 15;4(12):1453-63. PMID 8994971. *↑ Knox C, Law V, Jewison T, Liu P, Ly S, Frolkis A, Pon A, Banco K, Mak C, Neveu V, ...
TNF (ligand) superfamilija. *4-1BB ligand. *Faktor aktivacije B-ćelija. *FAS ligand ... 86 (4): 1243-1254. PMID 7632928.. *^ Yoshida K, Taga T, Saito M, Suematsu S, Kumanogoh A, Tanaka T, Fujiwara H, Hirata M, ... 53 (4): 974-81. PMID 8547494. doi:10.1095/biolreprod53.4.974.. *. Mosley B; De Imus C; Friend D; et al. (1997). „Dual ... 82 (4): 1120-6. PMID 8353278.. *. Davis S; Aldrich TH; Stahl N; et al. (1993). „LIFR beta and gp130 as heterodimerizing signal ...
TNF (ligand) superfamilija. *4-1BB ligand. *Faktor aktivacije B-ćelija. *FAS ligand ... BLyS (Belimumab) • CTLA-4 (Ipilimumab, Tremelimumab) • CAT (Bertilimumab, Lerdelimumab, Metelimumab) • Integrin (Natalizumab ...
CXCL6, hemokin (C-X-C motiv) ligand 6, je mali citokin iz CXC hemokin familije koji je takođe poznat kao granulocit hemotaksni ... O'Donovan N, Galvin M, Morgan J (1999). „Physical mapping of the CXC chemokine locus on human chromosome 4". Cytogenet Cell ... Modi W, Chen Z (1998). „Localization of the human CXC chemokine subfamily on the long arm of chromosome 4 using radiation ... CXCL6 gen je lociran na ljudskom hromozomu 4 u klasteru sa drugim CXC hemokin genima.[3][4][5] ...
CXCL2, hemokin (C-X-C motiv) ligand 2, je mali citokin koji pripada CXC hemokin familiji. Os se takođe zove makrofagni ... O'Donovan, N., Galvin, M., Morgan, J. G. (1999). „Physical mapping of the CXC chemokine locus on human chromosome 4". Cytogenet ... 4] CXCL2 mobiliše ćelije putem interakcije sa hemokin receptorom na ćelijskoj površini koji se zove CXCR2.[3][5] ... Gen za CXCL2 je lociran na ljudskom hromozomu 4 u klasteru sa drugim CXC hemokinima.[ ...
TNF (ligand) superfamilija. *4-1BB ligand. *Faktor aktivacije B-ćelija. *FAS ligand ... Ljudski TNF gen (TNFA) je bio kloniran 1985.[9] On se nalazi na hromozomu 6p21.3, sadrži oko 3 kb i ima 4 eksona. Zadnji ekson ... 316 (6028): 552-4. PMID 2993897. doi:10.1038/316552a0.. *^ Beutler B, Milsark IW, Cerami AC (1985). „Passive immunization ... Nansi H. Ruddle sa Jelskog univerziteta, koja je istovremeno nezavisno objavila tu istu aktivnost.[4] Naknadno 1975 godine dr. ...
CCL, hemokin (C-C motiv) ligand 1, je mali glikoprotein koji izlučuju aktivirane T ćelije iz familije inflamatornih citokina ... 89 (7): 2950-4. PMC 48781 . PMID 1557400.. *^ Roos RS, Loetscher M, Legler DF, Clark-Lewis I, Baggiolini M, Moser B (1997). „ ... 272 (28): 17251-4. PMID 9211859.. *^ Mire-Sluis, Anthony R.; Thorpe, Robin, ур. (1998). Cytokines (Handbook of ...
1996). „The lymphocyte chemoattractant SDF-1 is a ligand for LESTR/fusin and blocks HIV-1 entry". Nature. 382: 829-833.. CS1 ... Ovaj molekul je zvanično zove hemokin (C-X-C motiv) ligand 12.[1] ... Entrez Gene: CXCL12 chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1)".. ... 2007). „Clinical importance and therapeutic implications of the pivotal CXCL12-CXCR4 (chemokine ligand-receptor) interaction in ...
CCL13, hemokin (C-C motiv) ligand 13, je mali citokin iz CC hemokin familije. Njegov gen se nalazi na ljudskom hromozomu 17 ... 1996). „Human monocyte chemoattractant protein (MCP)-4 is a novel CC chemokine with activities on monocytes, eosinophils, and ... 2000). „Monocyte chemoattractant protein (MCP)-4 expression in the airways of patients with asthma. Induction in epithelial ... 4] CCL13 može biti indukovan inflamatornim citokinima interleukin 1 i TNF-α.[5] ...
CCL8, hemokine (C-C motiv) ligand 8, je mali citokin iz CC hemokin familije koji se nekad zvao monocit hemotaksni protein-2 ( ... U toj grupi receptora su CCR1, CCR2B i CCR5.[4][5] Reference[уреди]. *^ Van Coillie; et al. (1997). „The human MCP-2 gene ( ... 4,0 4,1 Gong; et al. (1998). „Monocyte Chemotactic Protein-2 Activates CCR5 and Blocks CD4/CCR5-mediated HIV-1 Entry/ ... 4] CCL8 dejstvuje putem vezivanja za nekoliko različitih hemokin receptora na ćelijskoj površini. ...
CCL24, hemokine (C-C motiv) ligand 24, takođe poznat kao mijeloidni progenitor inhibitorni faktor 2 (MPIF-2), ili eozinofilni ... CCL24 interaguje sa hemokinskim receptorom CCR3 i indukuje hemotaksu eozinofila.[4] Ovaj hemokin je takođe snažno hemotaksan za ...
TNF (ligand) superfamilija. *4-1BB ligand. *Faktor aktivacije B-ćelija. *FAS ligand ... 2 (4): 283-29.. *↑ Tian Li; Larisa M. Wiggins & Christopher S. von Bartheld (2010). „Insulin-like Growth Factor-1 and ...
... due to ligand-defective apo B; 144010; APOB Hypercholesterolemia, familial; 143890; LDLR Hypercholesterolemia, familial, 3; ... 1BB; 612877; DSG2 Cardiomyopathy, dilated, 1CC; 613122; NEXN Cardiomyopathy, dilated, 1D; 601494; TNNT2 Cardiomyopathy, dilated ... 4; 604352; GPR98 COPD, rate of decline of lung function in; 606963; MMP1 Coproporphyria; 121300; CPOX Cornea plana congenita, ... KRAS Noonan syndrome 4; 610733; SOS1 Noonan syndrome 5; 611553; RAF1 Noonan syndrome 6; 613224; NRAS Noonan-like syndrome with ...
Ligand at the US National Library of Medicine Medical Subject Headings (MeSH) ... 4-1BB is a type 2 transmembrane glycoprotein receptor belonging to the TNF superfamily, expressed on activated T Lymphocytes.[1 ... 4-1BBL (4-1BB ligand) is found on APCs (antigen presenting cells) and binds to 4-1BB. ... Retrieved from "https://en.wikipedia.org/w/index.php?title=4-1BB_ligand&oldid=842807712" ...
4-1BBL, a member of the TNF superfamily, is expressed in B cells, dendritic cells, activated T cells and macrophages. 4-1BBL ... 4-1BBL binds to its receptor 4-1BB, and provides a co-stimulatory signal for T cell activation and expansion. The human 4-1BBL ... 4-1BBL, a member of the TNF superfamily, is expressed in B cells, dendritic cells, activated T cells and macrophages. ... The soluble form of 4-1BBL contains the TNF-like portion of the extracellular domain of 4-1BBL. Recombinant Human 4-1BBL is a ...
Immunogen: E.coli derived Recombinant Human 4-1BB Ligand (PeproTech catalog# 310-11) ... Anti-Human 4-1BBL specific antibody was purified by affinity chromatography employing immobilized Human 4-1BBL matrix. ... This antigen affinity purified antibody, in conjunction with PeproTechs Biotinylated Anti-Human 4-1BBL (500-P169Bt) as a ... Preparation: Produced from sera of rabbits pre-immunized with highly pure recombinant Human 4-1BBL. ...
4-1BB Ligand/TNFSF9 Antibody Pairs available through Novus Biologicals. Browse our 4-1BB Ligand/TNFSF9 Antibody Pair catalog ... ligand) superfamily, member 9 antibody pair, tumor necrosis factor ligand superfamily member 9 antibody pair ... Our 4-1BB Ligand/TNFSF9 Antibody Pairs can be used in a variety of model species: Human. Use the list below to choose the 4-1BB ... Each 4-1BB Ligand/TNFSF9 Antibody Pair is fully covered by our Guarantee+, to give you complete peace of mind and the support ...
CD137 Ligand, TNFSF9 binds to 4-1BBR also called 4-1bb Receptor and CD137, TNFRSF9. 4-1BBL stimulates the growth of activated ... 4-1BB Ligand takes part in initialization of induced cell death aka AICD.4-1BBL is also involved in cognate interactions among ... CD137L is a two directional signal transducer that has a role as a ligand to TNFRSF9 aka 4-1BBR, which is a co-stimulation ... CD137 Ligand, TNFSF9 binds to 4-1BBR also called 4-1bb Receptor and CD137, TNFRSF9. 4-1BBL stimulates the growth of activated ...
4-1BB ligand, also known as CDw137L, is a 97 kD member of the TNF superfamily mainly expressed on APCs, activated B and T cells ... It has been reported to be important in T cell proliferation and cytokine production through interaction with 4-1BB receptor. 4 ... 1BB ligand appears to be able to act as a c ... Ligand Receptor 4-1BB (CDw137) Cell Type Antigen-presenting ... 4-1BBL, CDw137L, TNFSF9, 41BBL Isotype Mouse IgG1, κ Ave. Rating Submit a Review Product Citations publications Human T ...
4-1BB Ligand. By Technical Data. 4-1BB Ligand - Proteins. 4-1BB Ligand - Recombinant protein - Proteins. Human - 4-1BB Ligand ... 4-1BBL binds to its receptor 4-1BB and provides a co-stimulatory signal for T cell activation and expansion. The human 4-1BBL ... 4-1BBL, a member of the TNF superfamily, is expressed in B cells, dendritic cells, activated T cells and macrophages. ... 4-1BB Ligand - from E. coli - Proteins. Recombinant protein - Proteins. Human - Recombinant protein - Proteins. Recombinant ...
4-1BB Ligand Receptor or T Cell Antigen 4-1BB Homolog or T Cell Antigen ILA or CD137 or TNFRSF9) - Pipeline Review, H1 2018 ... Tumor Necrosis Factor Receptor Superfamily Member 9 (4-1BB Ligand Receptor or T Cell Antigen 4-1BB Homolog or T Cell Antigen ... Tumor Necrosis Factor Receptor Superfamily Member 9 (4-1BB Ligand Receptor or T Cell Antigen 4-1BB Homolog or T Cell Antigen ... Tumor Necrosis Factor Receptor Superfamily Member 9 (4-1BB Ligand Receptor or T Cell Antigen 4-1BB Homolog or T Cell Antigen ...
Ligand is a recombinant protein optimized for use in cell culture, differentiation studies, and functional assays. ... Like other Ligands from the TNFSF family, active CD137-Ligand is expected to form a non-covalent homotrimer. ... CD137-Ligand, also known as 4-1BB-Ligand or TNFRSF9-Ligand, is the natural agonist of the CD137 receptor, and a member of the ... CD137-Ligand is expressed on antigen presenting cells, such as dendritic cells, B cells, and macrophages. The binding of CD137- ...
CD137 Ligand , Tumor Necrosis Factor (Ligand) Superfamily, Member 9 , Tumor Necrosis Factor Ligand Superfamily Member 9 ... The ligand is specific for the 4-1BB RECEPTOR and may play a role in inducing the proliferation of activated peripheral blood T ... 4-1BB Ligand Equivalent Terms 4 1BB Ligand , 4 1BBL Protein , 4-1BBL Protein , ...
The ligand is specific for the 4-1BB RECEPTOR and may play a role in inducing the proliferation of activated peripheral blood T ... "4-1BB Ligand" is a descriptor in the National Library of Medicines controlled vocabulary thesaurus, MeSH (Medical Subject ... This graph shows the total number of publications written about "4-1BB Ligand" by people in this website by year, and whether " ... Below are the most recent publications written about "4-1BB Ligand" by people in Profiles. ...
CD137 ligand mediates opposite effects in human and mouse NK cells and impairs NK-cell reactivity against human acute myeloid ... CD137 and CD137 ligand constitutively coexpressed on human T and B leukemia cells signal proliferation and survival. Int J ... Mice deficient for CD137 ligand are predisposed to develop germinal center-derived B-cell lymphoma. Blood 2009;114:2280-9. ... CD137 ligand, a member of the tumor necrosis factor family, regulated immune responses via reverse signal transduction. J ...
We have brought together our full range of anti-4-1BBL antibodies in one place, making it easy for you to find exactly what you ... Our range of 4-1BBL antibodies (also known as 4-1BB Ligand / CD137L) come in a variety of different formats and to a number of ... Characterization Anti-IgG Fc Antibodies Biosimilar Antibodies for Research Use Characterization of Critical Reagents for Ligand ...
To buy Human 4-1BB Ligand please click on the Shopping List Symbol right from the indicated price. This will add the product to ... Description of Human 4-1BB Ligand. 4 1BBL Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain ... It is recommended to reconstitute the lyophilized 4 1BBL in sterile 18M-cm H2O not less than 100 g/ml, which can then be ... Lyophilized 4 1BBL although stable at room temperature for 3 weeks, should be stored desiccated below -18 C. Upon ...
... Author: Buechele, ... 4-1BB ligand modulates direct and Rituximab-induced NK-cell reactivity in chronic lymphocytic leukemia. DSpace Repository. ...
R Recombinant Cynomolgus Monkey 4-1BB/TNFRSF9 Fc Chimera Protein, Carrier-free Quantity: 100µg Life Sciences:Protein Biology: ... The Recombinant Cynomolgus 4-1BB/TNFRSF9 Fc Chimera Protein is derived from HEK293. The Recombinant Cynomolgus 4-1BB/TNFRSF9 Fc ... 4-1BB ligand receptor; 41BB; 4-1BB; CD137 antigen; CD137; CD137MGC2172; CDw137; FLJ43501; ILA; ILAhomolog of mouse 4-1BB; ... R&D Systems Recombinant Cynomolgus Monkey 4-1BB/TNFRSF9 Fc Chimera Protein, Carrier-free ...
Sample size antibodies available through Novus Biologicals. Browse our sample size antibodies all backed by our Guarantee+.
1995) Regulation of immune responses by the ligands for CD27, CD30, and 4-1BB. Circulatory Shock 44:73-76, pmid:7743603.. ... 1993) Molecular cloning of a ligand for the inducible T cell gene 4-1BB: a member of an emerging family of cytokines with ... For instance, all of the antibodies, regardless of avidity or isotype, that bound near or at the ligand binding site were most ... Cells were washed twice in PBS, incubated with PE-conjugated anti-CD8 mAb, and assayed by FACS® for ligand binding. ...
found in: Murine MEC (CCL28), Fibroblast Growth Factor-Basic; Bovine FGF-Basic, 4-1BB Receptor/TNFRSF9, Human, Ebola virus-like ... B-cell activating factor (BlyS), also known as BAFF, TALL-1, TNAK, and zTNF4, is a TNF ligand superfamily member and has been ...
OX40 Ligand. PCSK9. PD-1. PD-L1. PD-L2. Prolactin. Protein L. ROR1. ROR2. SCF. Siglec-2. Siglec-3. ... Figure 4. Biotinylated Human PD-1(Cat. No. PD1-H82F1(at 1 μg/mL (5 μL/well) can bind Human PDL1 (Cat. No. PD1-H5229) with a ... Figures 4 and 5 demonstrate that the biotinylated PD1 can be applied to AlphaLISA to detect the binding activity with its ... ligand PD-L1 and PD-L2. Figures 6 and 7 demonstrate that the affinity between protein and therapeutic antibodies in SPR assay ...
We tested the effect of combining PD ligand 1 (PD-L1) blockade with an agonistic regimen that induces 4-1BB costimulation ... We tested the effect of combining PD ligand 1 (PD-L1) blockade with an agonistic regimen that induces 4-1BB costimulation ... We tested the effect of combining PD ligand 1 (PD-L1) blockade with an agonistic regimen that induces 4-1BB costimulation ... We tested the effect of combining PD ligand 1 (PD-L1) blockade with an agonistic regimen that induces 4-1BB costimulation ...
ILA Ligand (TNF-related), Ly63L, Receptor 4-1BB Ligand, Tumor Necrosis Factor (Ligand) Superfamily Member 9), 0004-01V - Get ... 4-1BB Ligand (4-1BBL, 4-1BB-L, CD137L, CD157L, Homolog of Mouse 4-1BB-L, Homolog of Mouse 4-1BBL, ... 1993) Molecular cloning of a ligand for the inducible T cell gene 4-1BB: a member of an emerging family of cytokines with ... Ligand) Superfamily Member 9). Cat no: 0004-01V. Supplier: United States Biological ...
Involvement of CD40 ligand-CD40 and CTLA4-B7 pathways in murine acute graft-versus-host disease induced by allogeneic T cells ... α4-1BB mAb increased the graft-vs-leukemia effect of a suboptimal number of donor splenocytes given later post bone marrow ... Molecular cloning of a ligand for the inducible T cell gene 4-1BB: a member of an emerging family of cytokines with homology to ... CD62 ligand) on CD4+ T cells was similar for each one in the two groups (data not shown). Restimulation of washed control or ...
CD28 and its ligands CD80 and CD86 have been the most extensively studied. It is documented that CD28 ligation helps T cells to ... this receptor/ligand pair can facilitate anti-tumor activity (18). Thus, 4-1BB is a costimulatory molecule that heightens CD8 T ... 4-1BB is a member of the TNF receptor family and its ligand 4-1BB ligand is a member of the TNF family (13, 14). 4-1BB has been ... Cutting Edge: 4-1BB Is a Bona Fide CD8 T Cell Survival Signal. Chikara Takahashi, Robert S. Mittler and Anthony T. Vella ...
T Cell Co-Signaling Pathway: Ligand-Receptor Interactions. T Cell Co-Signaling Pathway: Ligand-Receptor Interactions ... Characterization of human homologue of 4-1BB and its ligand. (PMID: 7622190) Zhou Z … Kwon BS (Immunology letters 1995) 3 4 22 ... 4) Ensembl transcripts including schematic representations, and UCSC links where relevant :. * ENST00000377507 (uc057bxz.1) ... Molecular and biological characterization of human 4-1BB and its ligand. (PMID: 8088337) Alderson MR … Din WS (European journal ...
  • Anti-Human 4-1BBL specific antibody was purified by affinity chromatography employing immobilized Human 4-1BBL matrix. (peprotech.com)
  • This antigen affinity purified antibody, in conjunction with PeproTech's Biotinylated Anti-Human 4-1BBL (500-P169Bt) as a detection antibody, allows the detection of at least 0.2 - 0.4 ng/well of recombinant h4-1BBL. (peprotech.com)
  • Immunotherapy targeting CD8+ T cells with agonistic anti-4-1BB (CD137) monoclonal antibody (mAb) fulfills these requirements because 4-1BB-mediated signals are biased toward CD8+ T cells, promoting their survival, differentiation, and acquisition of potent cytolytic properties ( 1 ). (aacrjournals.org)
  • Our previous study illuminated that the blockade of the 4-1BB/4-1BBL costimulatory pathway with 4-1BBL monoclonal antibody decreased the acute rejection in rat with liver transplantation [ 11 ]. (hindawi.com)
  • This antibody detects endogenous levels of 4-1BBL protein. (acris-antibodies.com)
  • CD19-4-1BBL(RG6076) is a bispecific antibody targeting the 4-1BB ligand to cells bearing CD19 acting as an NK- and T-cell co-stimulator. (roche.com)
  • The recent U.S. Food and Drug Administration approval of ipilumimab, an antibody that blocks the inhibitory action of CTLA-4, and clinical trials targeting 4-1BB and PD-1 or PD-L1, have underscored the therapeutic potential of using immunomodulatory antibodies to stimulate protective immunity in human patients. (aacrjournals.org)
  • Also disclosed are methods of simulating hybridoma cells to increase monoclonal antibody production by administering a CD40 ligand polypeptide that stimulates B cell proliferation. (google.com.au)
  • 12. A nucleic acid encoding the antibody, or an antigen-binding portion thereof, of claim 4. (freepatentsonline.com)
  • The T cells are genetically modified through transduction with a lentiviral vector expressing scFv of anti-MDM2 antibody linked to 4-1BB(CD137), OX40 and CD3ζ signaling domains. (creative-biolabs.com)
  • 2012) Targeting of 4-1BB by monoclonal antibody PF-05082566 enhances T-cell function and promotes anti-tumor activity. (guidetoimmunopharmacology.org)
  • Anti-4-1BBL antibody also inhibited osteoclast formation to a lesser extent, indicating involvement of reverse signaling through 4-1BBL during inhibition of osteoclast formation. (elsevier.com)
  • Growing evidence indicates that anti-4-1BB monoclonal antibodies possess strong antitumor properties, which in turn are the result of their powerful CD8+ T-cell activating, IFN-γ producing, and cytolytic marker-inducing capabilities. (aacrjournals.org)
  • In vivo examination of the effects of anti-4-1BB monoclonal antibodies (mAbs) on antigen-induced T cell activation have shown that the administration of epitope-specific anti-4-1BB mAbs amplified the generation of H-2 d -specific cytotoxic T cells in a murine model of acute graft versus host disease (GVHD) and enhanced the rapidity of cardiac allograft or skin transplant rejection in mice. (rupress.org)
  • We have recently developed a new class of inhibitory (CTLA-4) and agonistic (4-1BB and OX-40) ligands composed of short oligonucleotide (ODN) aptamers that exhibited bioactivities comparable or superior to that of antibodies. (aacrjournals.org)
  • The cell-free chemically synthesized ODN aptamers offer significant advantages over antibodies in terms of synthesis, cost, as well as conjugation chemistry needed to generate bispecific ligand fusions. (aacrjournals.org)
  • Third, used as targeting ligands (see below), chemical conjugation of antibodies to their therapeutic cargo is complex and costly, requiring skill sets that are not readily available, especially in academic settings. (aacrjournals.org)
  • Its effectiveness is not tumor specific, and as a natural ligand, it does not cause toxicity, as is found with 4-1BB agonist antibodies. (eurekalert.org)
  • Antibodies that are immunoreactive with 4-1BB-L or human 4-1BB also are provided. (justia.com)
  • 2005) Fully human antibodies against human 4-1bb (cd137). (guidetoimmunopharmacology.org)
  • The classical structure of CAR is built with a intracellular costimulatory domain, a intracellular CD3ζ and a chimera of single chain fragment (scFv) of antibodies that can directly target tumor associated antigens (TAA) in a major histocompatibility complex (MHC)-independent manner [ 4 ]. (jcancer.org)
  • Expression of murine 4-1BB is induced by concanavalin A (con A) in spleen cells, cloned helper T cells, cytolytic T cells, and cytolytic T cell hybridomas (Kwon et al. (justia.com)
  • Murine 4-1BB cDNA was isolated from a cDNA library made from induced RNA isolated from both a helper T cell line and a cytotoxic T cell line (Kwon et al. (justia.com)
  • The present invention provides purified 4-1BB-L polypeptides, exemplified by the murine and human 4-1BB-L proteins disclosed herein, and purified human 4-1BB polypeptides. (justia.com)
  • The NKR-P1B/D ligand is osteoclast inhibitory lectin (Ocil), also known as Clr-b, a member of a previously cloned group of C-type lectin-related (Clr) proteins linked to the NKR-P1 receptors in the mouse NK gene complex (NKC). (jove.com)
  • 4-1BBL (4-1BB ligand) is found on APCs (antigen presenting cells) and binds to 4-1BB. (wikipedia.org)
  • 4-1BBL binds to its receptor 4-1BB, and provides a co-stimulatory signal for T cell activation and expansion. (peprotech.com)
  • The soluble form of 4-1BBL contains the TNF-like portion of the extracellular domain of 4-1BBL. (peprotech.com)
  • 4-1BBL stimulates the growth of activated peripheral blood T-cells. (prospecbio.com)
  • 4-1BB Ligand takes part in initialization of induced cell death aka AICD.4-1BBL is also involved in cognate interactions among T-cells and B-cells aka macrophages. (prospecbio.com)
  • 4-1BBL antigen is a type 2 transmembrane glycoprotein which is part of the TNF superfamily that is expressed on activated T Lymphocytes. (prospecbio.com)
  • 4-1BBL is essential for CD8 optimal reactions in CD8 T cells. (prospecbio.com)
  • In addition, targeting of tumors with variants of 4-1BBL directed against 4-1BB also have potent antitumor effects. (aacrjournals.org)
  • In this review, we discuss the basis of the therapeutic potential of targeting the 4-1BB-4-1BBL pathway in cancer treatment. (aacrjournals.org)
  • 4 1BBL Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 184 amino acids and having a molecular mass of 19.5kDa.The 4 1BBL is purified by proprietary chromatographic techniques. (active-bioscience.de)
  • It is recommended to reconstitute the lyophilized 4 1BBL in sterile 18M-cm H2O not less than 100 g/ml, which can then be further diluted to other aqueous solutions. (active-bioscience.de)
  • Lyophilized 4 1BBL although stable at room temperature for 3 weeks, should be stored desiccated below -18 C. Upon reconstitution 4 1BBL should be stored at 4 C between 2-7 days and for future use below -18 C. Please avoid repeated freeze-thaw cycles. (active-bioscience.de)
  • Currently, all published studies addressing the functional activities of the 4-1BB/4-1BBL system have been carried out in vitro and have focused on costimulatory signals generated through the 4-1BB receptor on unseparated T cells. (rupress.org)
  • This study was conducted to determine the effect of 4-1BB receptor/4-1BBL interaction on regulating alloresponses in vivo. (jimmunol.org)
  • For this purpose, we used mice with a deletion in either 4-1BB or 4-1BBL and a mitogenic anti-4-1BB mAb. (jimmunol.org)
  • Synthetic peptide corresponding to Human 4-1BBL (internal sequence). (abcam.com)
  • ab64912, at a 1/500 dilution, staining Human 4-1BBL in HeLa cells, by Immunofluorescence, with (+) or without (-) immunising peptide. (abcam.com)
  • Receptor for TNFSF14/4-1BBL. (creativebiomart.net)
  • 2009) Immune regulation by 4-1BB and 4-1BBL: complexities and challenges. (miltenyibiotec.com)
  • Zhu H, Wang M, Du Y, Liu X, Weng X, Li C. 4-1BBL has a Possible Role in Mediating Castration-Resistant Conversion of Prostate Cancer via Up-Regulation of Androgen Receptor. (jcancer.org)
  • 4-1BB ligand (4-1BBL) was a transmembrane glycoprotein belonging to the tumor necrosis factor family. (jcancer.org)
  • In addition to its role in immune regulation, 4-1BBL transmitted signals into the cells on which it was expressed (reverse signaling). (jcancer.org)
  • 4-1BBL represented a promising target for enhancing antitumor immune responses. (jcancer.org)
  • Recent studies indicated that 4-1BBL also expressed in non-immune cells and possessed different functions in various types of cells. (jcancer.org)
  • Here, we reported that 4-1BBL didn't express in normal prostate tissues and benign prostatic hyperplasia tissues, but it expressed in prostate cancer (PCa) tissues at moderate level. (jcancer.org)
  • Expression of 4-1BBL was up-regulated during the transition from PCa to castration resistant prostate cancer (CRPC). (jcancer.org)
  • Increasing expression of 4-1BBL not only promoted expression of androgen receptor (AR), but also augmented proliferation and invasion ability of prostate cancer cells in androgen deprivation environment. (jcancer.org)
  • Meanwhile, inhibiting AR signal pathway by chemical antagonist was able to significantly reduce 4-1BBL mediated proliferation and invasion of PCa cells. (jcancer.org)
  • These novel findings indicated that 4-1BBL might mediate prostate cancer progression to castration-resistant prostate cancer via enhancing expression and function of AR. (jcancer.org)
  • Among TNF superfamily members, 4-1BBL had emerged as an important mediator of survival signaling. (jcancer.org)
  • In addition to acting as a ligand by cross-linking 4-1BB, 4-1BBL could receive signals and transmit them into the cells on which it was expressed, a process referred to as reverse signal transduction. (jcancer.org)
  • The effects of reverse 4-1BBL signaling had received comparatively little attention in the past. (jcancer.org)
  • However, during the last few years, a number of studies appeared to shed light on the biology of 4-1BBL signaling. (jcancer.org)
  • Synthetic peptide, corresponding to amino acids 50-100 of Human 4-1BBL. (acris-antibodies.com)
  • Surprisingly, when the researchers treated normal healthy mice with SA-4-1BBL alone, the mice were protected when the researchers later exposed them to different types of tumor cells. (eurekalert.org)
  • In the research, published today in Cancer Research , mice that had never had cancer were treated with SA-4-1BBL alone, then challenged with cervical and lung cancer tumor cells at various time intervals. (eurekalert.org)
  • The mice showed significant protection against tumor development, with the greatest protection when challenged two weeks after treatment with SA-4-1BBL. (eurekalert.org)
  • The cancer immunoprevention effect generated by SA-4-1BBL lasted more than eight weeks. (eurekalert.org)
  • Just giving SA-4-1BBL alone prevents the formation of tumors in animal models," Shirwan said. (eurekalert.org)
  • Although the research, which was conducted in collaboration with FasCure Therapeutics, LLC, tested the mice for cervical and lung cancers, the protective function of SA-4-1BBL works without context of specific tumor antigens, giving it the potential to be effective in preventing any number of tumor types. (eurekalert.org)
  • Our study demonstrates a new pathway for generating a large quantity of stimulatory monocyte-derived DCs (Mo-DCs) from human monocytes using anti-4-1BB ligand (4-1BBL) mAb to trigger reverse signaling. (scialert.net)
  • The anti-4-1BBL-driven Mo-DCs (DCs -4-1BBL ) not only express higher levels of CD86, CD83 and HLA-DR, when compared with the Mo-DCs matured by tumor necrosis factor , but also exhibit a unique phenotype that expresses lower levels of PD-L1. (scialert.net)
  • High levels of GM-CSF, M-CSF and Flt3 ligand (FL) were found in the anti-4-1BBL-differentiation culture. (scialert.net)
  • Neutralizing M-CSF, GM-CSF and FL inhibited Mo-DC proliferation stimulated by anti-4-1BBL mAb, suggesting that M-CSF, GM-CSF and FL are involved in cell proliferation stimulated by anti-4-1BBL. (scialert.net)
  • Further analysis of the DCs -4-1BBL showed increased secretion of T h 1-type cytokines IL-12 and IFN- and decreased secretion of IL-10. (scialert.net)
  • DCs -4-1BBL induced much stronger proliferative responses in the mixed lymphocyte reaction assay when compared with DCs derived by GM-CSF. (scialert.net)
  • Bone marrow cells and the macrophage-like cell lines J774 and RAW264.7 were found to express 4-1BB ligand (4-1BBL). (elsevier.com)
  • A casein kinase I (CKI) inhibitor markedly suppressed the inhibitory effect of r4-1BB on M-CSF/ RANKL-induced osteoclast formation, suggesting that CKI might be involved in 4-1BB/4-1BBL reverse signaling. (elsevier.com)
  • r4-1BB showed no effects on M-CSF- or RANKL-induced phosphorylation of I-κB, ERK1/2, p38, or JNK, whereas RANKL-induced phosphorylation of Akt, a downstream target of phosphatidylinositol 3-kinase (PI3K), was completely abolished by r4-1BB, suggesting that 4-1BB/4-1BBL reverse signaling may interfere with PI3K/Akt pathway. (elsevier.com)
  • Soluble Fas ligand is generated by cleaving membrane-bound FasL at a conserved cleavage site by the external serine matrix metalloproteinase MMP-7. (bionity.com)
  • DcR3 is a soluble receptor that has no signal transduction capabilities (hence a "decoy") and functions to prevent FasR -FasL interactions by competitively binding to membrane-bound Fas ligand and rendering them inactive . (bionity.com)
  • Soluble forms of the 4-1BB-L or 4-1BB polypeptides are derived from the extracellular domains thereof. (justia.com)
  • Nearly 10 times as many staphylococcal enterotoxin A-specific T cells were detected in the spleens of mice injected 21 days previously with staphylococcal enterotoxin A and an agonist anti-4-1BB Ab compared with mice given staphylococcal enterotoxin A and a control IgG. (jimmunol.org)
  • After ligation of 4-1BB on SAg-activated CD8 T cells in vivo, using an agonist mAb, peripheral deletion is almost entirely inhibited. (jimmunol.org)
  • The agonist anti-4-1BB mAb 3H3 and biotinylated anti-4-1BB mAb 1D8 were used as a receptor agonist or staining reagent, respectively ( 17 ). (jimmunol.org)
  • In this study, we show that anti-4-1BB mAbs preferentially activate CD8 + T cells both in vitro and in vivo, alter the kinetics of tyrosine phosphorylation as well as substrates and markedly amplify the generation of antigen-specific CTL responses in vivo. (rupress.org)
  • The results of these studies suggest that regulatory signals delivered by the 4-1BB receptor play an important role in the regulation of cytotoxic T cells in cellular immune responses to antigen. (rupress.org)
  • Interactions between CD137 and its ligand are involved in antigen presentation and the generation of cytotoxic T cells. (acris-antibodies.com)
  • B-cell activating factor (BlyS), also known as BAFF, TALL-1, TNAK, and zTNF4, is a TNF ligand superfamily member and has been designated TNFSF13B. (thomassci.com)
  • This observation suggests that 4-1BB may be linked to the src tyrosine kinase family signaling pathway. (rupress.org)
  • Much research has been directed to identifying receptor(s) that bind a given cytokine (often referred to as the "ligand" for the receptor in question), and exploring the roles that endogenous ligands and receptors play in vivo. (justia.com)
  • 4-1BB-L is absent of a signal sequence and N-linked glycosylation domain, however comprises a ser/pro-rich site proximal to the transmembrane region which is comprised of O-linked carbohydrates. (prospecbio.com)
  • Up-regulation of 4-1BB was also observed by infection with Escherichia coli, Salmonella typhimurium, and Staphylococcus aureus, and by treatment with lipopolysaccharides and heat-killed BCG. (elsevier.com)
  • By quantifying graft-vs-host disease alloresponses in vivo, we demonstrate that both CD4 + and CD8 + T cell-mediated alloresponses are regulated by 4-1BB/4-1BB ligand interactions to approximately the same extent. (jimmunol.org)
  • In this study, we have investigated the effect of gene silencing of 4-1BB by RNA interference (RNAi) on the acute rejection in rats with liver transplantation. (hindawi.com)
  • The recombination vector of lentivirus that contains shRNA targeting the 4-1BB gene (LV-sh4-1BB) was constructed. (hindawi.com)
  • Lentivirus-mediated delivery of shRNA targeting 4-1BB gene prolonged the survival time of recipient and alleviated the injury of liver morphology in recipient rats with liver transplantation. (hindawi.com)
  • Therefore, the aim of present study was to investigate the effect of gene silencing of 4-1BB by RNA interference on the acute rejection in rats with liver transplantation. (hindawi.com)
  • RAR-RXR heterodimers act as ligand‐dependent transcription factors that bind to RA responsive elements (RAREs) in the gene promoter region. (els.net)
  • A gene encoding 4-1BB (CD137), a member of the tumor necrosis factor-α receptor family, was found to be one of the up-regulated genes. (elsevier.com)
  • We report the cloning and characterization of a cognate ligand for the inhibitory mouse NK receptors (NKR)-P1B and NKR-P1D (CD161b/d). (jove.com)
  • Merus and Incyte are co-developing a 4-1BB/PD-L1 bispecific named MCLA-145 that has progressed to Phase 1 trial in patients with advanced or recurrent/metastatic solid tumours (see NCT03922204 ). (guidetoimmunopharmacology.org)
  • In vivo CTL generation against both alloantigen ( 17 ) and tumor Ag-bearing targets ( 20 ) can be enhanced by the administration of a mitogenic anti-4-1BB mAb infusion. (jimmunol.org)
  • Our laboratory has previously found that these MDSCs can induce CD4 + CD25 + Foxp3 + T regulatory cell (Treg) in vitro and in vivo in murine cancer models ( 4 , 5 ). (aacrjournals.org)