Enoyl-(Acyl-Carrier-Protein) Reductase (NADH): An NAD-dependent enzyme that catalyzes the oxidation of acyl-[acyl-carrier protein] to trans-2,3-dehydroacyl-[acyl-carrier protein]. It has a preference for acyl groups with a carbon chain length between 4 to 16.Triclosan: A diphenyl ether derivative used in cosmetics and toilet soaps as an antiseptic. It has some bacteriostatic and fungistatic action.Acyl Carrier Protein: Consists of a polypeptide chain and 4'-phosphopantetheine linked to a serine residue by a phosphodiester bond. Acyl groups are bound as thiol esters to the pantothenyl group. Acyl carrier protein is involved in every step of fatty acid synthesis by the cytoplasmic system.3-Oxoacyl-(Acyl-Carrier-Protein) Reductase: A 3-oxoacyl reductase that has specificity for ACYL CARRIER PROTEIN-derived FATTY ACIDS.Enoyl-(Acyl-Carrier Protein) Reductase (NADPH, B-Specific): An enzyme that catalyzes the oxidation of acyl-[acyl-carrier protein] to trans-2,3-dehydroacyl-[acyl-carrier protein] in the fatty acid biosynthesis pathway. It has a preference for acyl derivatives with carbon chain length from 4 to 16.Pantetheine: An intermediate in the pathway of coenzyme A formation in mammalian liver and some microorganisms.Oxidoreductases: The class of all enzymes catalyzing oxidoreduction reactions. The substrate that is oxidized is regarded as a hydrogen donor. The systematic name is based on donor:acceptor oxidoreductase. The recommended name will be dehydrogenase, wherever this is possible; as an alternative, reductase can be used. Oxidase is only used in cases where O2 is the acceptor. (Enzyme Nomenclature, 1992, p9)Fatty Acid Synthases: Enzymes that catalyze the synthesis of FATTY ACIDS from acetyl-CoA and malonyl-CoA derivatives.Alcohol Oxidoreductases: A subclass of enzymes which includes all dehydrogenases acting on primary and secondary alcohols as well as hemiacetals. They are further classified according to the acceptor which can be NAD+ or NADP+ (subclass 1.1.1), cytochrome (1.1.2), oxygen (1.1.3), quinone (1.1.5), or another acceptor (1.1.99).Fatty Acids: Organic, monobasic acids derived from hydrocarbons by the equivalent of oxidation of a methyl group to an alcohol, aldehyde, and then acid. Fatty acids are saturated and unsaturated (FATTY ACIDS, UNSATURATED). (Grant & Hackh's Chemical Dictionary, 5th ed)Fatty Acid Synthase, Type II: The form of fatty acid synthase complex found in BACTERIA; FUNGI; and PLANTS. Catalytic steps are like the animal form but the protein structure is different with dissociated enzymes encoded by separate genes. It is a target of some ANTI-INFECTIVE AGENTS which result in disruption of the CELL MEMBRANE and CELL WALL.3-Oxoacyl-(Acyl-Carrier-Protein) Synthase: An enzyme of long-chain fatty acid synthesis, that adds a two-carbon unit from malonyl-(acyl carrier protein) to another molecule of fatty acyl-(acyl carrier protein), giving a beta-ketoacyl-(acyl carrier protein) with the release of carbon dioxide. EC 2.3.1.41.Bacterial Proteins: Proteins found in any species of bacterium.Crystallography, X-Ray: The study of crystal structure using X-RAY DIFFRACTION techniques. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)Polyketide Synthases: Large enzyme complexes composed of a number of component enzymes that are found in STREPTOMYCES which biosynthesize MACROLIDES and other polyketides.Molecular Sequence Data: Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.Acyl-Carrier Protein S-Malonyltransferase: This enzyme catalyzes the transacylation of malonate from MALONYL CoA to activated holo-ACP, to generate malonyl-(acyl-carrier protein), which is an elongation substrate in FATTY ACIDS biosynthesis. It is an essential enzyme in the biosynthesis of FATTY ACIDS in all BACTERIA.Transferases (Other Substituted Phosphate Groups): A class of enzymes that transfers substituted phosphate groups. EC 2.7.8.Acyltransferases: Enzymes from the transferase class that catalyze the transfer of acyl groups from donor to acceptor, forming either esters or amides. (From Enzyme Nomenclature 1992) EC 2.3.Models, Molecular: Models used experimentally or theoretically to study molecular shape, electronic properties, or interactions; includes analogous molecules, computer-generated graphics, and mechanical structures.Antitubercular Agents: Drugs used in the treatment of tuberculosis. They are divided into two main classes: "first-line" agents, those with the greatest efficacy and acceptable degrees of toxicity used successfully in the great majority of cases; and "second-line" drugs used in drug-resistant cases or those in which some other patient-related condition has compromised the effectiveness of primary therapy.NAD: A coenzyme composed of ribosylnicotinamide 5'-diphosphate coupled to adenosine 5'-phosphate by pyrophosphate linkage. It is found widely in nature and is involved in numerous enzymatic reactions in which it serves as an electron carrier by being alternately oxidized (NAD+) and reduced (NADH). (Dorland, 27th ed)Coenzyme APantothenic Acid: A butyryl-beta-alanine that can also be viewed as pantoic acid complexed with BETA ALANINE. It is incorporated into COENZYME A and protects cells against peroxidative damage by increasing the level of GLUTATHIONE.Escherichia coli: A species of gram-negative, facultatively anaerobic, rod-shaped bacteria (GRAM-NEGATIVE FACULTATIVELY ANAEROBIC RODS) commonly found in the lower part of the intestine of warm-blooded animals. It is usually nonpathogenic, but some strains are known to produce DIARRHEA and pyogenic infections. Pathogenic strains (virotypes) are classified by their specific pathogenic mechanisms such as toxins (ENTEROTOXIGENIC ESCHERICHIA COLI), etc.Carbon-Sulfur Ligases: Enzymes that catalyze the joining of two molecules by the formation of a carbon-sulfur bond. EC 6.2.Carrier Proteins: Transport proteins that carry specific substances in the blood or across cell membranes.Amino Acid Sequence: The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.Acylation: The addition of an organic acid radical into a molecule.Thiolester HydrolasesMalonyl Coenzyme A: A coenzyme A derivative which plays a key role in the fatty acid synthesis in the cytoplasmic and microsomal systems.Substrate Specificity: A characteristic feature of enzyme activity in relation to the kind of substrate on which the enzyme or catalytic molecule reacts.Streptomyces: A genus of bacteria that form a nonfragmented aerial mycelium. Many species have been identified with some being pathogenic. This genus is responsible for producing a majority of the ANTI-BACTERIAL AGENTS of practical value.Cerulenin: An epoxydodecadienamide isolated from several species, including ACREMONIUM, Acrocylindrum, and Helicoceras. It inhibits the biosynthesis of several lipids by interfering with enzyme function.Sequence Homology, Amino Acid: The degree of similarity between sequences of amino acids. This information is useful for the analyzing genetic relatedness of proteins and species.Saccharopolyspora: A genus of gram-positive bacteria whose spores are round to oval and covered by a sheath.Acyl Coenzyme A: S-Acyl coenzyme A. Fatty acid coenzyme A derivatives that are involved in the biosynthesis and oxidation of fatty acids as well as in ceramide formation.Apoproteins: The protein components of a number of complexes, such as enzymes (APOENZYMES), ferritin (APOFERRITINS), or lipoproteins (APOLIPOPROTEINS).Mycobacterium tuberculosis: A species of gram-positive, aerobic bacteria that produces TUBERCULOSIS in humans, other primates, CATTLE; DOGS; and some other animals which have contact with humans. Growth tends to be in serpentine, cordlike masses in which the bacilli show a parallel orientation.Cloning, Molecular: The insertion of recombinant DNA molecules from prokaryotic and/or eukaryotic sources into a replicating vehicle, such as a plasmid or virus vector, and the introduction of the resultant hybrid molecules into recipient cells without altering the viability of those cells.Nitrate Reductases: Oxidoreductases that are specific for the reduction of NITRATES.Multienzyme Complexes: Systems of enzymes which function sequentially by catalyzing consecutive reactions linked by common metabolic intermediates. They may involve simply a transfer of water molecules or hydrogen atoms and may be associated with large supramolecular structures such as MITOCHONDRIA or RIBOSOMES.Kinetics: The rate dynamics in chemical or physical systems.Hydroxymethylglutaryl CoA Reductases: Enzymes that catalyze the reversible reduction of alpha-carboxyl group of 3-hydroxy-3-methylglutaryl-coenzyme A to yield MEVALONIC ACID.Anthraquinones: Compounds based on ANTHRACENES which contain two KETONES in any position. Substitutions can be in any position except on the ketone groups.Coriandrum: A plant genus of the family APIACEAE. The leaves are the source of cilantro and the seeds are the source of coriander, both of which are used in SPICES.Base Sequence: The sequence of PURINES and PYRIMIDINES in nucleic acids and polynucleotides. It is also called nucleotide sequence.Metabolome: The dynamic collection of metabolites which represent a cell's or organism's net metabolic response to current conditions.Acyl-Carrier Protein S-Acetyltransferase: A enzyme that catalyzes the transfer of acetyl groups from ACETYL CoA to acyl-carrier protein to form COENZYME A and acetyl-acyl-carrier protein.Open Reading Frames: A sequence of successive nucleotide triplets that are read as CODONS specifying AMINO ACIDS and begin with an INITIATOR CODON and end with a stop codon (CODON, TERMINATOR).Metabolomics: The systematic identification and quantitation of all the metabolic products of a cell, tissue, organ, or organism under varying conditions. The METABOLOME of a cell or organism is a dynamic collection of metabolites which represent its net response to current conditions.
enoyl-(acyl-carrier-protein) reductase (NADPH, B-specific) Ja 1.3.1.20 trans-1,2-dihydrobenzene-1,2-diol dehydrogenase Ja ... L-xylulose reductase Ja 1.1.1.11 D-arabitol + NAD+ ⇌. {\displaystyle \rightleftharpoons }. D-xylulose + NADH + H+ D-arabitol 4- ... D-xylulose reductase 1.1.1.10 Xylitol + NADP+ ⇌. {\displaystyle \rightleftharpoons }. L-xylulose + NADPH + H+ ... Glycerol-3-fosfaatdehydrogenase (NAD+) Ja 1.1.1.9 Xylitol + NAD+ ⇌. {\displaystyle \rightleftharpoons }. D-xylulose + NADH + H+ ...
... acyl-carrier-protein) reductase Christensen, Caspar Elo; Kragelund, Birthe B.; von Wettstein-Knowles, Penny; Henriksen, Anette ... acyl-carrier-protein) synthase III (FabH)". Biotechnology and Bioengineering. 112 (8): 1613-1622. doi:10.1002/bit.25583. ISSN ... acyl-carrier-protein) synthase III (FabH)". Biotechnology and Bioengineering. 112 (8): 1613-22. doi:10.1002/bit.25583. PMID ... and genetic studies of beta-ketoacyl-acyl carrier protein synthases I and II of Escherichia coli". Journal of Biological ...
... acyl-carrier-protein) reductase (NADH) EC 1.3.1.10: enoyl-(acyl-carrier-protein) reductase (NADPH, B-specific) EC 1.3.1.11: 2- ... acyl-carrier-protein) reductase (NADPH, A-specific) EC 1.3.1.40: 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate reductase EC 1.3. ... long-chain acyl-(acyl-carrier-protein) reductase EC 1.2.1.81: sulfoacetaldehyde dehydrogenase (acylating) EC 1.2.1.82: beta-apo ... acyl-carrier-protein) reductase EC 1.1.1.101: acylglycerone-phosphate reductase EC 1.1.1.102: 3-dehydrosphinganine reductase EC ...
... acyl-carrier-protein] reductase, beta-hydroxyacyl-[acylcarrier-protein] dehydrase, and enoyl-[acyl-carrier-protein] reductase ... acyl-carrier protein](ACP) reductase, beta-ketoacyl acyl carrier protein (ACP) reductase, beta-ketoacyl reductase, beta- ... ketoacyl thioester reductase, beta-ketoacyl-ACP reductase, beta-ketoacyl-acyl carrier protein reductase, 3-ketoacyl acyl ... Preparation and general properties of beta-ketoacyl acyl carrier protein reductase from Escherichia coli". Biochim. Biophys. ...
... acyl-carrier-protein] reductase (NADH) (EC 1.1.1.212) is an enzyme that catalyzes the chemical reaction (3R)-3-hydroxyacyl-[ ... acyl-carrier-protein] reductase (NADH). Caughey I, Kekwick RG (1982). "The characteristics of some components of the fatty acid ... acyl carrier protein] (reduced nicotinamide adenine, dinucleotide) reductase, and 3-oxoacyl-[ ... acyl-carrier-protein] + NADH + H+ Thus, the two substrates of this enzyme are [[(3R)-3-hydroxyacyl-[acyl-carrier-protein]]] and ...
... acyl-carrier-protein hydrolase activity]. • enoyl-[acyl-carrier-protein reductase (NADPH, B-specific) activity]. • protein ... acyl-[acyl-carrier-protein hydrolase activity]. • hydrolase activity. • palmitoyl-[acyl-carrier-protein hydrolase activity]. • ... acyl-carrier-protein dehydratase activity]. • protein homodimerization activity. • catalytic activity. • [acyl-carrier-protein ... acyl-carrier-protein reductase (NADPH) activity]. • drug binding. • NADPH binding. • lyase activity. • identical protein ...
... acyl-carrier-protein hydrolase activity]. • enoyl-[acyl-carrier-protein reductase (NADPH, B-specific) activity]. • protein ... acyl-[acyl-carrier-protein hydrolase activity]. • hydrolase activity. • palmitoyl-[acyl-carrier-protein hydrolase activity]. • ... acyl-carrier-protein dehydratase activity]. • protein homodimerization activity. • catalytic activity. • [acyl-carrier-protein ... acyl-carrier-protein reductase (NADPH) activity]. • drug binding. • NADPH binding. • lyase activity. • identical protein ...
... acyl-carrier-protein) reductase (nadh) MeSH D08.811.682.660.390 --- enoyl-(acyl-carrier protein) reductase (nadph, b-specific) ... acyl-carrier protein s-acetyltransferase MeSH D08.811.913.050.134.060 --- acetyl-CoA C-acetyltransferase MeSH D08.811.913.050. ... acyl-carrier protein s-malonyltransferase MeSH D08.811.913.050.173 --- 1-acylglycerol-3-phosphate O-acyltransferase MeSH ... acyl-carrier-protein) synthase MeSH D08.811.913.050.625 --- phosphatidylcholine-sterol O-acyltransferase MeSH D08.811.913.050. ...
The reaction proceeds as such: acyl-[acyl-carrier protein] + a malonyl-[acyl-carrier protein] → a 3-oxoacyl-[acyl-carrier ... and enoyl reductase to create a fully saturated acyl backbone. Unlike FASs, however, PKSs typically use a larger number of ... The reaction proceeds as such: (Z)-hexadec-11-enoyl-[acyl-carrier protein] + malonyl-[acyl-carrier protein] → (Z)-3-oxooctadec- ... 13-enoyl-[acyl-carrier protein] + CO2 + [acyl-carrier protein In Streptococcus pneumonia, for example, synthase II is used as ...
... acyl-carrier-protein) S-acetyltransferase EC 2.3.1.39: (acyl-carrier-protein) S-malonyltransferase EC 2.3.1.40: acyl-(acyl- ... receptor protein serine/threonine kinase EC 2.7.11.31: (hydroxymethylglutaryl-CoA reductase (NADPH)) kinase EC 2.7.11.32: ( ... acyl-carrier-protein) synthase II EC 2.3.1.180: beta-ketoacyl-(acyl-carrier-protein) synthase III EC 2.3.1.181: lipoyl(octanoyl ... ribosomal-protein-alanine N-acetyltransferase EC 2.3.1.129: acyl-(acyl-carrier-protein)-UDP-N-acetylglucosamine O- ...
... acyl-carrier-protein] reductase, beta-hydroxyacyl-[acylcarrier-protein] dehydrase, and enoyl-[acyl-carrier-protein] reductase ... acyl-carrier protein](ACP) reductase, beta-ketoacyl acyl carrier protein (ACP) reductase, beta-ketoacyl reductase, beta- ... ketoacyl thioester reductase, beta-ketoacyl-ACP reductase, beta-ketoacyl-acyl carrier protein reductase, 3-ketoacyl acyl ... Preparation and general properties of beta-ketoacyl acyl carrier protein reductase from Escherichia coli". Biochim. Biophys. ...
... acyl-carrier-protein] reductase (NADH) (EC 1.1.1.212) is an enzyme that catalyzes the chemical reaction (3R)-3-hydroxyacyl-[ ... acyl-carrier-protein] reductase (NADH). Caughey I, Kekwick RG (1982). "The characteristics of some components of the fatty acid ... acyl carrier protein] (reduced nicotinamide adenine, dinucleotide) reductase, and 3-oxoacyl-[ ... acyl-carrier-protein] + NADH + H+ Thus, the two substrates of this enzyme are [[(3R)-3-hydroxyacyl-[acyl-carrier-protein]]] and ...
The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex ... This protein in other organisms (by gene name): A9MA73 - Brucella canis (strain ATCC 23365 / NCTC 10854) 1 * P73574 - ... Protein disorder predictions are based on JRONN (Troshin, P. and Barton, G. J. unpublished), a Java implementation of RONN * ... The Protein Feature View requires a browser that supports SVG (Scalable Vector Graphics). Mouse over tracks and labels for more ...
... acyl-carrier-protein] reductase FabG1 (EC:1.1.1.100*Search proteins in UniProtKB for this EC number. ... acyl-carrier-protein] reductase (NADPH) activity Source: UniProtKB-EC. *3-oxo-glutaryl-[acp] methyl ester reductase activity ... acyl-carrier-protein] reductase FabG1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=fabG1 PE=3 SV=1 ... to allow unambiguous identification of a protein.,p>,a href=/help/protein_names target=_top>More...,/a>,/p>Protein namesi. ...
... acyl-carrier-protein) reductase (target EFI-506442) from agrobacterium tumefaciens C58 with NADP bound ... acyl-carrier-protein) reductase (target EFI-506442) from agrobacterium tumefaciens C58 with NADP bound. Note: Use your mouse to ...
Exhibits a marked preference for [acyl-carrier-protein] derivatives over CoA derivatives as substrates. ...
... acyl carrier protein] reductaseImported. ,p>Information which has been imported from another database using automatic ... acyl carrier protein] reductase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) OX=300852 GN=TTHB020 PE=4 SV=1 ... Protein predictedi ,p>This indicates the type of evidence that supports the existence of the protein. Note that the protein ... to allow unambiguous identification of a protein.,p>,a href=/help/protein_names target=_top>More...,/a>,/p>Protein namesi. ...
... acyl-carrier-protein] reductase,Estradiol 17-beta-dehydrogenase 8,Hsd17b8,Rat,Rattus norvegicus,Testosterone 17-beta- ... acyl-carrier-protein] reductase,Estradiol 17-beta-dehydrogenase 8,Hsd17b8,Rat,Rattus norvegicus,Testosterone 17-beta- ... acyl-carrier-protein] reductase,Estradiol 17-beta-dehydrogenase 8,Hsd17b8,Rat,Rattus norvegicus,Testosterone 17-beta- ... acyl-carrier-protein] reductase,Estradiol 17-beta-dehydrogenase 8,Hsd17b8,Rat,Rattus norvegicus,Testosterone 17-beta- ...
... one ORF containing motifs also found in plant storage proteins and 13 ORFs with weak or no homology to known proteins." Yeast ... Protein Sequence. ,3-oxoacyl-[acyl-carrier-protein] reductase MHYLPVAIVTGATRGIGKAICQKLFQKGLSCIILGSTKESIERTAIDRGQLQSGLSYQRQ ... "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095 ... "Global analysis of protein expression in yeast." Nature 425:737-741.14562106 ...
... acyl carrier protein) reductase (TM1169) from Thermotoga maritima at 2.50 A resolution ... acyl carrier protein) reductase (TM1169) from Thermotoga maritima at 2.50 A resolution. Coordinates. PDB Format Method. X-RAY ... acyl carrier protein) reductase (TM1169) from Thermotoga maritima at 2.50 A resolution. To be published Release Date. 2003-09- ... Joint Center for Structural Genomics (JCSG), Crystal structure of 3-oxoacyl-( ...
ACYL-CARRIER-PROTEIN) REDUCTASE (FABG) FROM PSEUDOMONAS AERUGINOSA IN COMPLEX WITH AN UNKNOWN LIGAND AT 1.6A RESOLUTION. ... Genes and Proteins , Diseases , Protein Families , 3D Structures , Cell Lines , Compounds , Tools , Browse. ...
ACYL-CARRIER-PROTEIN) REDUCTASE (FABG) FROM PSEUDOMONAS AERUGINOSA IN COMPLEX WITH 1-(2-AMINO-4-PHENYLIMIDAZOL-1-YL)-3-(2- ... Genes and Proteins , Diseases , Protein Families , 3D Structures , Cell Lines , Compounds , Tools , Browse. ... 1-(2-AMINO-4-PHENYLIMIDAZOL-1-YL)-3-(2-FLUOROPHENY.... C16 H14 F N5 O. ...
... acyl-carrier-protein] reductase FabG. Rickettsia conorii (strain ATCC VR-613 / Malish 7) ... acyl-carrier-protein] reductase FabG UniProtKBInterProInteractive Modelling. 241 aa; Sequence (Fasta) ...
enoyl-(acyl-carrier-protein) reductase (NADPH, B-specific) Ja 1.3.1.20 trans-1,2-dihydrobenzene-1,2-diol dehydrogenase Ja ... L-xylulose reductase Ja 1.1.1.11 D-arabitol + NAD+ ⇌. {\displaystyle \rightleftharpoons }. D-xylulose + NADH + H+ D-arabitol 4- ... D-xylulose reductase 1.1.1.10 Xylitol + NADP+ ⇌. {\displaystyle \rightleftharpoons }. L-xylulose + NADPH + H+ ... Glycerol-3-fosfaatdehydrogenase (NAD+) Ja 1.1.1.9 Xylitol + NAD+ ⇌. {\displaystyle \rightleftharpoons }. D-xylulose + NADH + H+ ...
... acyl-carrier-protein] reductase [KO:K00023] [EC:1.1.1.36]. Daro_1610 ... 4Fe-4S ferredoxin, iron-sulfur binding:Protein of unknown function DUF224, cysteine-rich region [KO:K11473] ... Ethylmalonyl-CoA mutase from Rhodobacter sphaeroides defines a new subclade of coenzyme B12-dependent acyl-CoA mutases. ... NAD-binding protein [KO:K00018] [EC:1.1.1.29] ...
... acyl-carrier-protein] reductase antibody. *3-oxoacyl-acyl-carrier protein reductase, E. coli, homolog of antibody ... Lysates/proteins at 10 µg per lane.. Secondary. All lanes : HRP labeled goat anti-rabbit at 1/2000 dilution. Predicted band ... Proteins and Peptides. Proteomics tools. Agonists, activators, antagonists and inhibitors. Lysates. Multiplex Assays. By ... The Universal Protein Resource (UniProt) in 2010. Nucleic Acids Res. 38:D142-D148 (2010) . ...
... acyl-carrier-protein] reductase [KO:K00023] [EC:1.1.1.36]. Bpro_2141 ... D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding protein [KO:K00090] [EC:1.1.1.215 1.1.1.81 1.1.1.79] ... D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding protein [KO:K00090] [EC:1.1.1.215 1.1.1.81 1.1.1.79] ... D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding protein [KO:K12972] [EC:1.1.1.81 1.1.1.79] ...
... acyl-carrier protein]reductase (FabG)from Listeria monocytogenes in complex with NADP+. (tree view) ...
... acyl-carrier protein] reductase FT activity; GO_function: GO:0018454 - acetoacetyl-CoA FT reductase activity; GO_process: GO: ... acyl-carrier FT protein] reductase activity; GO_function: GO:0018454 - FT acetoacetyl-CoA reductase activity; GO_process: GO: ... "possible acyl carrier protein" FT /note="GO_function: GO:0000036 - acyl carrier activity; FT GO_function: GO:0048037 - cofactor ... acyl-carrier-protein] reductase" FT /EC_number="1.1.1.100" FT /note="GO_component: GO:0005737 - cytoplasm; GO_function: FT GO: ...
Rhizobial acyl carrier proteins and their roles in the formation of bacterial cell-surface components that are required for the ... SMb20651 is another acyl carrier protein from Sinorhizobium meliloti.. Ramos-Vega AL, Dávila-Martínez Y, Sohlenkamp C, ... SMc01553 is the sixth acyl carrier protein in Sinorhizobium meliloti 1021.. Dávila-Martínez Y, Ramos-Vega AL, Contreras- ... The nodulation protein NodG shows the enzymatic activity of an 3-oxoacyl-acyl carrier protein reductase. ...
... acyl-carrier-protein] reductase (NADPH) activity; IEA:UniProtKB-EC. DR InterPro; IPR036291; NAD(P)-bd_dom_sf. DR InterPro; ... acyl-carrier-protein] reductase {ECO:0000313,EMBL:CBJ79530.1}; DE EC=1.1.1.100 {ECO:0000313,EMBL:CBJ79530.1}; GN ... methyl ester reductase activity; IEA:UniProtKB-EC. DR GO; GO:0102132; F:3-oxo-pimeloyl-[acp] methyl ester reductase activity; ... DR GO; GO:0102131; F:3-oxo-glutaryl-[acp] ...
Protein Coding), Carbonyl Reductase 4, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards ... Acyl-Carrier-Protein] Reductase Beta Subunit 3 4 * Short Chain Dehydrogenase/Reductase Family 45C Member 1 3 4 ... Protein Symbol:. Q8N4T8-CBR4_HUMAN. Recommended name:. Carbonyl reductase family member 4. Protein Accession:. Q8N4T8. ... CBR4 (Carbonyl Reductase 4) is a Protein Coding gene. Diseases associated with CBR4 include Pancreatic Cancer 1 and Myopathy, ...
protein_id. CAB15280.1. Genomic View of Gene/Segment yusS Show/Hide (Legend) ... putative 3-oxoacyl-acyl-carrier protein reductase. transl_table. 11. note. Evidence 3: Function proposed based on presence of ...
protein_id. CAB15279.1. Genomic View of Gene/Segment yusR Show/Hide (Legend) ... Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product ...
... acyl-carrier-protein) reductase Geoth_2381 Glycerol dehydrogenase Geoth_3237 Alcohol dehydrogenase GroES domain protein Geoth_ ... 1.1.1.303 diacetyl reductase [(R)-acetoin forming] Geoth_3827 L-iditol 2-dehydrogenase K00004 BDH; (R,R)-butanediol ... 1.1.1.304 diacetyl reductase [(S)-acetoin forming] 1.1.1.305 UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid ... K00004 BDH; (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303] ...
  • Putative proteins were identified by 2D SDS-PAGE and LC MS/MS. The most significant match is shown for each protein spot scoring above the MASCOT score significance threshold of 47 (spot numbers designated with an * indicate the best match was below the threshold). (biomedcentral.com)
  • However, there are two Ralstonia solanacearum genes, RSc1052 ( fabG1 ) and RSp0359 ( fabG2 ), annotated as encoding putative 3-ketoacyl-ACP reductases. (beds.ac.uk)
  • Sequence of a 28.6 kb region of yeast chromosome XI includes the FBA1 and TOA2 genes, an open reading frame (ORF) similar to a translationally controlled tumour protein, one ORF containing motifs also found in plant storage proteins and 13 ORFs with weak or no homology to known proteins. (ymdb.ca)
  • Proteins whose genes are observed to be correlated in expression, across a large number of experiments. (string-db.org)
  • Sequence related families of genes and proteins are common in bacterial genomes. (beds.ac.uk)
  • Nobile CJ, Mitchell AP: Regulation 3-oxoacyl-(acyl-carrier-protein) reductase of cell-surface genes and biofilm formation by the C-albicans transcription factor Bcr1p. (pparsignaling.com)
  • These proteins vary both in length and repeat structure, and the rearrangement in the encoding genes Compound C might be as frequent as in hctB of C. trachomatis. (jak1inhibitor.com)
  • Johnson DR, Knoll LJ, Levin DE, Gordon JI: Saccharomyces cerevisiae contains four fatty acid activation (FAA) genes: an assessment of their role in regulating protein N-myristoylation and cellular lipid metabolism. (smpdb.ca)
  • Johnson DR, Knoll LJ, Rowley N, Gordon JI: Genetic analysis of the role of Saccharomyces cerevisiae acyl-CoA synthetase genes in regulating protein N-myristoylation. (smpdb.ca)
  • Kal AJ, Hettema EH, van den Berg M, Koerkamp MG, van Ijlst L, Distel B, Tabak HF: In silicio search for genes encoding peroxisomal proteins in Saccharomyces cerevisiae. (smpdb.ca)
  • Another example is the enzyme enoyl-ACP reductase, which catalyzes the NAD (P) H-dependent reduction of the enoyl-ACP double bond in the last step of the elongation cycle [ 7 ]. (beds.ac.uk)
  • The information on proteins involved in different metabolic pathways, particularly the regulation of the enzymes in cells' responses to different organic acids, is invaluable to biosynthesis of PHA biopolymers. (ijbs.com)
  • A number of proteins indicate interactions with an as yet unknown host, as indicated by the presence of predicted cell host remodeling enzymes, effector enzymes, hemolysin-like proteins, adhesins, NO reductase, and both type III and type VI secretory complexes. (biomedcentral.com)
  • Annotation described in this paper also reveals evidence for several metabolic pathways that have yet to be observed experimentally, including a sulphur oxidation ( sox FCDYZAXB) gene cluster, Calvin cycle enzymes, and proteins involved in nitrogen fixation in other species (including RubisCo, ribulose-phosphate 3-epimerase, and nif gene families, respectively). (biomedcentral.com)
  • In addition, the identification of novel proteins associated with P i uptake could be exploited in the removal of P i for water quality improvement, whilst enzymes involved in the catabolism of organophosphorus molecules are of interest in the pharmaceutical and agribiotech industrial sectors. (biomedcentral.com)
  • 4) enzymes for degradation of misfolded proteins, i.e. (bvsalud.org)
  • We supply the first evidence that, like other enzymes in the bacterial fatty acid biosynthetic pathway, one bacterium may simultaneously possess two or more 3-oxoacyl-ACP reductase isozymes. (beds.ac.uk)
  • Global analysis of protein localization in budding yeast. (ymdb.ca)
  • Granger Kinase Inhibitor Library cell assay BL, Flenniken ML, Davis DA, Mitchell AP, Cutler JE: Yeast wall protein 1 of Candida albicans. (pparsignaling.com)
  • Bagnat M, Simons K: Lipid rafts in protein sorting and cell polarity in budding yeast Saccharomyces cerevisiae. (smpdb.ca)
  • Jones JM, Nau K, Geraghty MT, Erdmann R, Gould SJ: Identification of peroxisomal acyl-CoA thioesterases in yeast and humans. (smpdb.ca)
  • Ethylmalonyl-CoA mutase from Rhodobacter sphaeroides defines a new subclade of coenzyme B12-dependent acyl-CoA mutases. (genome.jp)
  • The biosynthesis of unsaturated fatty acids begins with palmitic acid interacting with ATP and Coenzyme A through an acyl-CoA synthetase resulting in the release of AMP, diphosphate and palmitoyl-CoA. (smpdb.ca)
  • p>When browsing through different UniProt proteins, you can use the 'basket' to save them, so that you can back to find or analyse them later. (uniprot.org)
  • Increased Expression of miR-23a Mediates a Loss of Expression in the RAF Kinase Inhibitor Protein RKIP. (nih.gov)
  • In addition, our study reports the expression of several parasite proteins in clinical ring stages that have never been reported in the ring stages of the laboratory-cultivated parasite strain. (micrornasynthesis.com)
  • We report that expression of either of the two proteins (RsFabG1 and RsFabG2) restores growth of the E. coli fabG temperature-sensitive mutant CL104 under non-permissive conditions. (beds.ac.uk)
  • Similarly, probiotic mixture VSL#3 is able to prevent the increased intestinal permeability induced by a DSS treatment, phenomena associated with a prevention of decreased expression and redistribution of the tight junction proteins occludin, zonula occludens-1, and claudin-1, -3, -4, and -5 normally observed in DSS-treated mice. (biotiny.com)
  • One possible explanation of this thermoprotection effect in mRNA processing machinery is that during heat shock cells could be inducing the expression of proteins that are important to the response to temperature stress but that are also important in the response to cadmium treatment. (jak1inhibitor.com)
  • Destruction of the insect gut tissue occurs during infection.Analysis of the proteins encoded by the genome indicated a number of potential virulence factors, although a type III secretion system was not found. (up.ac.za)
  • Genome encoded protein families, their size and functional composition, reflect metabolic potentials of the organisms they are found in. (beds.ac.uk)
  • Analyses of the 3.4 Mbp genome revealed that a suite of cold and osmotic-specific adaptive mechanisms are present as well as an amino acid distribution favouring increased flexibility of proteins. (nature.com)
  • Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure. (supfam.org)
  • A number of proteins were found to be induced in R. eutropha by using 1D-PAGE and nano-liquid chromatography tandem MS/MS. With the proteins being up-regulated, a dramatic change occurred in the induction of PHA metabolism, including fatty acid biosynthesis for acetate, β-oxidation for propionate and both for levulinic acid. (ijbs.com)
  • The organic acids induced several proteins involved in amino acid biosynthesis, purine and pyrimidine biosynthesis, and cofactor biosynthesis in R. eutropha , but the regulations had a great variation. (ijbs.com)
  • During acetate metabolism proteins involved in the lipid metabolism and hexosamine biosynthesis were over-expressed in the acetate medium, while proteins involved in TCA cycle, pentose phosphate cycle and purine metabolism were down-regulated. (ijbs.com)
  • Loss of RAF kinase inhibitor protein is involved in myelomonocytic differentiation and aggravates RAS-driven myeloid leukemogenesis. (nih.gov)
  • Insulin, glucose and AICAR (an activator of AMP-activated protein kinase) affected changes in hypothalamic FAS mRNA, which may be regulated via the SREBP1c dependent or independent pathway. (pku.edu.cn)
  • After incubation, colonies were counted and the total number of colonies observed on the control Cyclin-dependent kinase 3 plate (untreated cells) was defined as 100% cell survival. (hspsignaling.com)
  • The responses of the cells to the organic acids, such as regulation of proteins, can reveal the metabolic activities and mechanisms in detoxification and utilization of different organic acids by the microbial cells [ 10 ]. (ijbs.com)
  • However, it also demonstrates some characteristics of desiccation stress, such as the regulation of fatty acids and increased abundance of rehydrin in the 3% P i culture. (biomedcentral.com)
  • Viriditoxin (Compound 1 , Fig. 1 ) is a naphtho-α-pyrone produced by the Eurotiales fungi Aspergillus viridinutans and Paecilomyces variotii, and in limited amounts by Aspergillus brevipes [ 1 , 2 , 3 ]. (biomedcentral.com)
  • The resulting compound then reacts with a trans-2-enoyl-CoA hydratase 2 resulting in the release of water and trans-2,3-dehydroacyl-CoA. (smpdb.ca)
  • These calculations will be used to predict the affinity/potency of the compound, the location where it binds on the protein molecule, and the "binding mode" it uses to potentially disable the target. (scripps.edu)
  • Docking is a way of trying to figure out how well a small chemical compound can bind to and block the activity of a target protein. (scripps.edu)
  • These calculations predict how potent the small chemical compound might be at blocking the activity of the target molecule, the location where it binds on the protein target, and the detailed binding mode it uses to potentially disable that target. (scripps.edu)
  • p>An evidence describes the source of an annotation, e.g. an experiment that has been published in the scientific literature, an orthologous protein, a record from another database, etc. (uniprot.org)
  • be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein. (uniprot.org)
  • 3-Hydroxy-2-amino acids are components of many bioactive molecules, such as antibiotics and immunosuppressants [ 1 - 9 ] and a drug for Parkinson's disease therapy [ 10 ]. (hindawi.com)
  • Therefore, enzymatic synthesis of 3-hydroxy-2-amino acids with D - and L -threonine aldolases has been performed extensively [ 1 , 2 , 4 - 9 ]. (hindawi.com)
  • Phenylserine (2-amino-3-hydroxy-3-phenylpropanoic acid), which exists as four stereoisomers, is one of the physiologically important 3-hydroxy-2-amino acids [ 11 - 13 ]. (hindawi.com)
  • Column 2 gives the 3-letter amino acid code, coloured according to physico-chemical type. (ligasite.org)
  • These proteins have a similar amino acid composition and similar pentamers, resulting in a distribution of positively charged residues almost identical to Hc2 (Figure 2). (jak1inhibitor.com)
  • Bacterial cells were disrupted in a lysis buffer containing 30 mM Tris, 2 M thiourea, 7 M urea, 4% CHAPS, 2% IPG buffer pH 3-10 and protease inhibitors and then subjected to sonication in order to solubilize as much as possible the bacterial proteins. (bvsalud.org)
  • This multifunctional protein has 7 catalytic activities and an acyl carrier protein. (abcam.com)
  • To assemble the minicellulosome via scaffolding protein CbpA from C. cellulovorans, we constructed a chimeric endoglucanase CelE containing the catalytic domain of CelE fused with a tandem-aligned dockerin domain of C. cellulovorans Acetophenone EngB (Fig. 1a). (mi-rna.com)