An NAD-dependent enzyme that catalyzes the oxidation of acyl-[acyl-carrier protein] to trans-2,3-dehydroacyl-[acyl-carrier protein]. It has a preference for acyl groups with a carbon chain length between 4 to 16.
A diphenyl ether derivative used in cosmetics and toilet soaps as an antiseptic. It has some bacteriostatic and fungistatic action.
Consists of a polypeptide chain and 4'-phosphopantetheine linked to a serine residue by a phosphodiester bond. Acyl groups are bound as thiol esters to the pantothenyl group. Acyl carrier protein is involved in every step of fatty acid synthesis by the cytoplasmic system.
A 3-oxoacyl reductase that has specificity for ACYL CARRIER PROTEIN-derived FATTY ACIDS.
An enzyme that catalyzes the oxidation of acyl-[acyl-carrier protein] to trans-2,3-dehydroacyl-[acyl-carrier protein] in the fatty acid biosynthesis pathway. It has a preference for acyl derivatives with carbon chain length from 4 to 16.
An intermediate in the pathway of coenzyme A formation in mammalian liver and some microorganisms.
The class of all enzymes catalyzing oxidoreduction reactions. The substrate that is oxidized is regarded as a hydrogen donor. The systematic name is based on donor:acceptor oxidoreductase. The recommended name will be dehydrogenase, wherever this is possible; as an alternative, reductase can be used. Oxidase is only used in cases where O2 is the acceptor. (Enzyme Nomenclature, 1992, p9)
Enzymes that catalyze the synthesis of FATTY ACIDS from acetyl-CoA and malonyl-CoA derivatives.
A subclass of enzymes which includes all dehydrogenases acting on primary and secondary alcohols as well as hemiacetals. They are further classified according to the acceptor which can be NAD+ or NADP+ (subclass 1.1.1), cytochrome (1.1.2), oxygen (1.1.3), quinone (1.1.5), or another acceptor (1.1.99).
Organic, monobasic acids derived from hydrocarbons by the equivalent of oxidation of a methyl group to an alcohol, aldehyde, and then acid. Fatty acids are saturated and unsaturated (FATTY ACIDS, UNSATURATED). (Grant & Hackh's Chemical Dictionary, 5th ed)
The form of fatty acid synthase complex found in BACTERIA; FUNGI; and PLANTS. Catalytic steps are like the animal form but the protein structure is different with dissociated enzymes encoded by separate genes. It is a target of some ANTI-INFECTIVE AGENTS which result in disruption of the CELL MEMBRANE and CELL WALL.
An enzyme of long-chain fatty acid synthesis, that adds a two-carbon unit from malonyl-(acyl carrier protein) to another molecule of fatty acyl-(acyl carrier protein), giving a beta-ketoacyl-(acyl carrier protein) with the release of carbon dioxide. EC 2.3.1.41.
Proteins found in any species of bacterium.
The study of crystal structure using X-RAY DIFFRACTION techniques. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
Large enzyme complexes composed of a number of component enzymes that are found in STREPTOMYCES which biosynthesize MACROLIDES and other polyketides.
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
This enzyme catalyzes the transacylation of malonate from MALONYL CoA to activated holo-ACP, to generate malonyl-(acyl-carrier protein), which is an elongation substrate in FATTY ACIDS biosynthesis. It is an essential enzyme in the biosynthesis of FATTY ACIDS in all BACTERIA.
A class of enzymes that transfers substituted phosphate groups. EC 2.7.8.
Enzymes from the transferase class that catalyze the transfer of acyl groups from donor to acceptor, forming either esters or amides. (From Enzyme Nomenclature 1992) EC 2.3.
Models used experimentally or theoretically to study molecular shape, electronic properties, or interactions; includes analogous molecules, computer-generated graphics, and mechanical structures.
Drugs used in the treatment of tuberculosis. They are divided into two main classes: "first-line" agents, those with the greatest efficacy and acceptable degrees of toxicity used successfully in the great majority of cases; and "second-line" drugs used in drug-resistant cases or those in which some other patient-related condition has compromised the effectiveness of primary therapy.
A coenzyme composed of ribosylnicotinamide 5'-diphosphate coupled to adenosine 5'-phosphate by pyrophosphate linkage. It is found widely in nature and is involved in numerous enzymatic reactions in which it serves as an electron carrier by being alternately oxidized (NAD+) and reduced (NADH). (Dorland, 27th ed)
A butyryl-beta-alanine that can also be viewed as pantoic acid complexed with BETA ALANINE. It is incorporated into COENZYME A and protects cells against peroxidative damage by increasing the level of GLUTATHIONE.
A species of gram-negative, facultatively anaerobic, rod-shaped bacteria (GRAM-NEGATIVE FACULTATIVELY ANAEROBIC RODS) commonly found in the lower part of the intestine of warm-blooded animals. It is usually nonpathogenic, but some strains are known to produce DIARRHEA and pyogenic infections. Pathogenic strains (virotypes) are classified by their specific pathogenic mechanisms such as toxins (ENTEROTOXIGENIC ESCHERICHIA COLI), etc.
Enzymes that catalyze the joining of two molecules by the formation of a carbon-sulfur bond. EC 6.2.
Transport proteins that carry specific substances in the blood or across cell membranes.
The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.
The addition of an organic acid radical into a molecule.
A coenzyme A derivative which plays a key role in the fatty acid synthesis in the cytoplasmic and microsomal systems.
A characteristic feature of enzyme activity in relation to the kind of substrate on which the enzyme or catalytic molecule reacts.
A genus of bacteria that form a nonfragmented aerial mycelium. Many species have been identified with some being pathogenic. This genus is responsible for producing a majority of the ANTI-BACTERIAL AGENTS of practical value.
An epoxydodecadienamide isolated from several species, including ACREMONIUM, Acrocylindrum, and Helicoceras. It inhibits the biosynthesis of several lipids by interfering with enzyme function.
The degree of similarity between sequences of amino acids. This information is useful for the analyzing genetic relatedness of proteins and species.
A genus of gram-positive bacteria whose spores are round to oval and covered by a sheath.
S-Acyl coenzyme A. Fatty acid coenzyme A derivatives that are involved in the biosynthesis and oxidation of fatty acids as well as in ceramide formation.
The protein components of a number of complexes, such as enzymes (APOENZYMES), ferritin (APOFERRITINS), or lipoproteins (APOLIPOPROTEINS).
A species of gram-positive, aerobic bacteria that produces TUBERCULOSIS in humans, other primates, CATTLE; DOGS; and some other animals which have contact with humans. Growth tends to be in serpentine, cordlike masses in which the bacilli show a parallel orientation.
The insertion of recombinant DNA molecules from prokaryotic and/or eukaryotic sources into a replicating vehicle, such as a plasmid or virus vector, and the introduction of the resultant hybrid molecules into recipient cells without altering the viability of those cells.
Oxidoreductases that are specific for the reduction of NITRATES.
Systems of enzymes which function sequentially by catalyzing consecutive reactions linked by common metabolic intermediates. They may involve simply a transfer of water molecules or hydrogen atoms and may be associated with large supramolecular structures such as MITOCHONDRIA or RIBOSOMES.
The rate dynamics in chemical or physical systems.
Enzymes that catalyze the reversible reduction of alpha-carboxyl group of 3-hydroxy-3-methylglutaryl-coenzyme A to yield MEVALONIC ACID.
Compounds based on ANTHRACENES which contain two KETONES in any position. Substitutions can be in any position except on the ketone groups.
A plant genus of the family APIACEAE. The leaves are the source of cilantro and the seeds are the source of coriander, both of which are used in SPICES.
The sequence of PURINES and PYRIMIDINES in nucleic acids and polynucleotides. It is also called nucleotide sequence.
A enzyme that catalyzes the transfer of acetyl groups from ACETYL CoA to acyl-carrier protein to form COENZYME A and acetyl-acyl-carrier protein.
The dynamic collection of metabolites which represent a cell's or organism's net metabolic response to current conditions.
A sequence of successive nucleotide triplets that are read as CODONS specifying AMINO ACIDS and begin with an INITIATOR CODON and end with a stop codon (CODON, TERMINATOR).
The systematic identification and quantitation of all the metabolic products of a cell, tissue, organ, or organism under varying conditions. The METABOLOME of a cell or organism is a dynamic collection of metabolites which represent its net response to current conditions.
enoyl-(acyl-carrier-protein) reductase (NADPH, B-specific) Ja 1.3.1.20 trans-1,2-dihydrobenzene-1,2-diol dehydrogenase Ja ... L-xylulose reductase Ja 1.1.1.11 D-arabitol + NAD+ ⇌. {\displaystyle \rightleftharpoons }. D-xylulose + NADH + H+ D-arabitol 4- ... D-xylulose reductase 1.1.1.10 Xylitol + NADP+ ⇌. {\displaystyle \rightleftharpoons }. L-xylulose + NADPH + H+ ... Glycerol-3-fosfaatdehydrogenase (NAD+) Ja 1.1.1.9 Xylitol + NAD+ ⇌. {\displaystyle \rightleftharpoons }. D-xylulose + NADH + H+ ...
... acyl-carrier-protein) reductase Witkowski, Andrzej; Joshi, Anil K.; Smith, Stuart (2002). "Mechanism of the β-Ketoacyl Synthase ... acyl-carrier-protein) synthase III (FabH)". Biotechnology and Bioengineering. 112 (8): 1613-1622. doi:10.1002/bit.25583. ISSN ... acyl-carrier-protein) synthase III (FabH)". Biotechnology and Bioengineering. 112 (8): 1613-22. doi:10.1002/bit.25583. PMID ... and genetic studies of beta-ketoacyl-acyl carrier protein synthases I and II of Escherichia coli". Journal of Biological ...
... acyl-carrier-protein] reductase, beta-hydroxyacyl-[acylcarrier-protein] dehydrase, and enoyl-[acyl-carrier-protein] reductase ... acyl-carrier protein](ACP) reductase, beta-ketoacyl acyl carrier protein (ACP) reductase, beta-ketoacyl reductase, beta- ... ketoacyl thioester reductase, beta-ketoacyl-ACP reductase, beta-ketoacyl-acyl carrier protein reductase, 3-ketoacyl acyl ... Preparation and general properties of beta-ketoacyl acyl carrier protein reductase from Escherichia coli". Biochim. Biophys. ...
... acyl-carrier-protein] reductase (NADH) (EC 1.1.1.212) is an enzyme that catalyzes the chemical reaction (3R)-3-hydroxyacyl-[ ... acyl-carrier-protein] reductase (NADH). Caughey I, Kekwick RG (1982). "The characteristics of some components of the fatty acid ... acyl carrier protein] (reduced nicotinamide adenine, dinucleotide) reductase, and 3-oxoacyl-[ ... acyl-carrier-protein] + NADH + H+ Thus, the two substrates of this enzyme are [[(3R)-3-hydroxyacyl-[acyl-carrier-protein]]] and ...
... acyl-carrier-protein hydrolase activity]. • enoyl-[acyl-carrier-protein reductase (NADPH, B-specific) activity]. • protein ... acyl-[acyl-carrier-protein hydrolase activity]. • hydrolase activity. • palmitoyl-[acyl-carrier-protein hydrolase activity]. • ... acyl-carrier-protein dehydratase activity]. • protein homodimerization activity. • catalytic activity. • [acyl-carrier-protein ... acyl-carrier-protein reductase (NADPH) activity]. • drug binding. • NADPH binding. • lyase activity. • identical protein ...
... acyl-carrier-protein hydrolase activity]. • enoyl-[acyl-carrier-protein reductase (NADPH, B-specific) activity]. • protein ... acyl-[acyl-carrier-protein hydrolase activity]. • hydrolase activity. • palmitoyl-[acyl-carrier-protein hydrolase activity]. • ... acyl-carrier-protein dehydratase activity]. • protein homodimerization activity. • catalytic activity. • [acyl-carrier-protein ... acyl-carrier-protein reductase (NADPH) activity]. • drug binding. • NADPH binding. • lyase activity. • identical protein ...
... acyl-carrier-protein) reductase (nadh) MeSH D08.811.682.660.390 - enoyl-(acyl-carrier protein) reductase (nadph, b-specific) ... acyl-carrier protein s-acetyltransferase MeSH D08.811.913.050.134.060 - acetyl-CoA C-acetyltransferase MeSH D08.811.913.050. ... acyl-carrier protein s-malonyltransferase MeSH D08.811.913.050.173 - 1-acylglycerol-3-phosphate O-acyltransferase MeSH D08.811. ... acyl-carrier-protein) synthase MeSH D08.811.913.050.625 - phosphatidylcholine-sterol O-acyltransferase MeSH D08.811.913.050.646 ...
The reaction proceeds as such: acyl-[acyl-carrier protein] + a malonyl-[acyl-carrier protein] → a 3-oxoacyl-[acyl-carrier ... and enoyl reductase to create a fully saturated acyl backbone. Unlike FASs, however, PKSs typically use a larger number of ... The reaction proceeds as such: (Z)-hexadec-11-enoyl-[acyl-carrier protein] + malonyl-[acyl-carrier protein] → (Z)-3-oxooctadec- ... 13-enoyl-[acyl-carrier protein] + CO2 + [acyl-carrier protein In Streptococcus pneumoniae, for example, synthase II is used as ...
... acyl-carrier-protein) S-acetyltransferase EC 2.3.1.39: (acyl-carrier-protein) S-malonyltransferase EC 2.3.1.40: acyl-(acyl- ... receptor protein serine/threonine kinase EC 2.7.11.31: (hydroxymethylglutaryl-CoA reductase (NADPH)) kinase EC 2.7.11.32: ( ... acyl-carrier-protein) synthase II EC 2.3.1.180: beta-ketoacyl-(acyl-carrier-protein) synthase III EC 2.3.1.181: lipoyl(octanoyl ... ribosomal-protein-alanine N-acetyltransferase EC 2.3.1.129: acyl-(acyl-carrier-protein)-UDP-N-acetylglucosamine O- ...
... acyl-carrier protein](ACP) reductase, beta-ketoacyl acyl carrier protein (ACP) reductase, beta-ketoacyl reductase, beta- ... acyl-carrier-protein] reductase, beta-hydroxyacyl-[acylcarrier-protein] dehydrase, and enoyl-[acyl-carrier-protein] reductase ... ketoacyl thioester reductase, beta-ketoacyl-ACP reductase, beta-ketoacyl-acyl carrier protein reductase, 3-ketoacyl acyl ... Preparation and general properties of beta-ketoacyl acyl carrier protein reductase from Escherichia coli". Biochim. Biophys. ...
... acyl-carrier-protein] reductase, beta-hydroxyacyl-[acylcarrier-protein] dehydrase, and enoyl-[acyl-carrier-protein] reductase ... acyl-carrier protein](ACP) reductase, beta-ketoacyl acyl carrier protein (ACP) reductase, beta-ketoacyl reductase, beta- ... ketoacyl thioester reductase, beta-ketoacyl-ACP reductase, beta-ketoacyl-acyl carrier protein reductase, 3-ketoacyl acyl ... Preparation and general properties of beta-ketoacyl acyl carrier protein reductase from Escherichia coli". Biochim. Biophys. ...
... acyl-carrier-protein] reductase (NADH) (EC 1.1.1.212) is an enzyme that catalyzes the chemical reaction (3R)-3-hydroxyacyl-[ ... acyl-carrier-protein] reductase (NADH). Caughey I, Kekwick RG (1982). "The characteristics of some components of the fatty acid ... acyl carrier protein] (reduced nicotinamide adenine, dinucleotide) reductase, and 3-oxoacyl-[ ... acyl-carrier-protein] + NADH + H+ Thus, the two substrates of this enzyme are [[(3R)-3-hydroxyacyl-[acyl-carrier-protein]]] and ...
The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex ... This protein in other organisms (by gene name): A9MA73 - Brucella canis (strain ATCC 23365 / NCTC 10854) 1 * P73574 - ... Protein disorder predictions are based on JRONN (Troshin, P. and Barton, G. J. unpublished), a Java implementation of RONN * ... The Protein Feature View requires a browser that supports SVG (Scalable Vector Graphics). Mouse over tracks and labels for more ...
... acyl-carrier-protein] reductase. A, B, C, D. 267. Sinorhizobium meliloti. Mutation(s): 0 Gene Names: RB0475, SM_b20493. EC: 1.1 ... acyl-carrier-protein] reductase from Sinorhizobium meliloti. Zhang, Z., Almo, S.C., Swaminathan, S.. To be published. ... acyl-carrier-protein] reductase from Sinorhizobium meliloti. *DOI: 10.2210/pdb3U5T/pdb ...
... acyl-carrier-protein] reductase FabG1 (EC:1.1.1.100*Search proteins in UniProtKB for this EC number. ... acyl-carrier-protein] reductase (NADPH) activity Source: UniProtKB-EC. *3-oxo-glutaryl-[acp] methyl ester reductase activity ... acyl-carrier-protein] reductase FabG1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=fabG1 PE=3 SV=1 ... to allow unambiguous identification of a protein.,p>,a href=/help/protein_names target=_top>More...,/a>,/p>Protein namesi. ...
Exhibits a marked preference for [acyl-carrier-protein] derivatives over CoA derivatives as substrates. ...
... acyl carrier protein] reductaseImported. ,p>Information which has been imported from another database using automatic ... acyl carrier protein] reductase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) OX=300852 GN=TTHB020 PE=4 SV=1 ... Protein predictedi ,p>This indicates the type of evidence that supports the existence of the protein. Note that the protein ... to allow unambiguous identification of a protein.,p>,a href=/help/protein_names target=_top>More...,/a>,/p>Protein namesi. ...
... acyl-carrier-protein] reductase and Organism(s) Rickettsia prowazekii and UniProt Accession P50941 ... acyl-carrier protein]:NADP+ oxidoreductase Exhibits a marked preference for acyl-carrier-protein derivatives over CoA ... acyl-carrier-protein] reductase and Organism(s) Rickettsia prowazekii and UniProt Accession P50941. for references in articles ... beta-ketoacyl-acyl carrier protein reductase, 3-ketoacyl-acp reductase, 3-oxoacyl-(acyl-carrier-protein) reductase, oar1p, 3- ...
... acyl-carrier-protein] reductase,Estradiol 17-beta-dehydrogenase 8,Hsd17b8,Rat,Rattus norvegicus,Testosterone 17-beta- ... acyl-carrier-protein] reductase,Estradiol 17-beta-dehydrogenase 8,Hsd17b8,Rat,Rattus norvegicus,Testosterone 17-beta- ... acyl-carrier-protein] reductase,Estradiol 17-beta-dehydrogenase 8,Hsd17b8,Rat,Rattus norvegicus,Testosterone 17-beta- ... acyl-carrier-protein] reductase,Estradiol 17-beta-dehydrogenase 8,Hsd17b8,Rat,Rattus norvegicus,Testosterone 17-beta- ...
... one ORF containing motifs also found in plant storage proteins and 13 ORFs with weak or no homology to known proteins." Yeast ... Protein Sequence. ,3-oxoacyl-[acyl-carrier-protein] reductase MHYLPVAIVTGATRGIGKAICQKLFQKGLSCIILGSTKESIERTAIDRGQLQSGLSYQRQ ... "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095 ... "Global analysis of protein expression in yeast." Nature 425:737-741.14562106 ...
... acyl carrier protein) reductase (TM1169) from Thermotoga maritima at 2.50 A resolution ... acyl carrier protein) reductase (TM1169) from Thermotoga maritima at 2.50 A resolution. Coordinates. PDB Format Method. X-RAY ... acyl carrier protein) reductase (TM1169) from Thermotoga maritima at 2.50 A resolution. To be published Release Date. 2003-09- ... Joint Center for Structural Genomics (JCSG), Crystal structure of 3-oxoacyl-( ...
ACYL-CARRIER-PROTEIN) REDUCTASE (FABG) FROM PSEUDOMONAS AERUGINOSA IN COMPLEX WITH AN UNKNOWN LIGAND AT 1.6A RESOLUTION. ... Genes and Proteins , Diseases , Protein Families , 3D Structures , Cell Lines , Compounds , Tools , Browse. ...
ACYL-CARRIER-PROTEIN) REDUCTASE (FABG) FROM PSEUDOMONAS AERUGINOSA IN COMPLEX WITH 1-(2-AMINO-4-PHENYLIMIDAZOL-1-YL)-3-(2- ... Genes and Proteins , Diseases , Protein Families , 3D Structures , Cell Lines , Compounds , Tools , Browse. ... 1-(2-AMINO-4-PHENYLIMIDAZOL-1-YL)-3-(2-FLUOROPHENY.... C16 H14 F N5 O. ...
... acyl-carrier-protein] reductase FabG. Rickettsia conorii (strain ATCC VR-613 / Malish 7) ... acyl-carrier-protein] reductase FabG UniProtKBInterProInteractive Modelling. 241 aa; Sequence (Fasta) ...
... acyl-carrier-protein] reductase. DROME. 2409. UniRef90_Q9VQL6. 3-oxoacyl-[acyl-carrier-protein] reductase. DROBP ... myristoyl-[acyl-carrier-protein] hydrolase activity Source: UniProtKB-EC. *oleoyl-[acyl-carrier-protein] hydrolase activity ... Oleoyl-[acyl-carrier-protein] hydrolaseARBA annotation. Automatic assertion according to rulesi ... tr,Q8MR70,Q8MR70_DROME Oleoyl-[acyl-carrier-protein] hydrolase (Fragment) OS=Drosophila melanogaster OX=7227 GN=FASN2 PE=2 SV=1 ...
enoyl-(acyl-carrier-protein) reductase (NADPH, B-specific) Ja 1.3.1.20 trans-1,2-dihydrobenzene-1,2-diol dehydrogenase Ja ... L-xylulose reductase Ja 1.1.1.11 D-arabitol + NAD+ ⇌. {\displaystyle \rightleftharpoons }. D-xylulose + NADH + H+ D-arabitol 4- ... D-xylulose reductase 1.1.1.10 Xylitol + NADP+ ⇌. {\displaystyle \rightleftharpoons }. L-xylulose + NADPH + H+ ... Glycerol-3-fosfaatdehydrogenase (NAD+) Ja 1.1.1.9 Xylitol + NAD+ ⇌. {\displaystyle \rightleftharpoons }. D-xylulose + NADH + H+ ...
... acyl-carrier-protein] reductase [KO:K00023] [EC:1.1.1.36]. Daro_1610 ... 4Fe-4S ferredoxin, iron-sulfur binding:Protein of unknown function DUF224, cysteine-rich region [KO:K11473] ... Ethylmalonyl-CoA mutase from Rhodobacter sphaeroides defines a new subclade of coenzyme B12-dependent acyl-CoA mutases. ... NAD-binding protein [KO:K00018] [EC:1.1.1.29] ...
... acyl-carrier-protein] reductase antibody. *3-oxoacyl-acyl-carrier protein reductase, E. coli, homolog of antibody ... Lysates/proteins at 10 µg per lane.. Secondary. All lanes : HRP labeled goat anti-rabbit at 1/2000 dilution. Predicted band ... Proteins and Peptides. Proteomics tools. Agonists, activators, antagonists and inhibitors. Lysates. Multiplex Assays. By ... The Universal Protein Resource (UniProt) in 2010. Nucleic Acids Res. 38:D142-D148 (2010) . ...
... acyl-carrier-protein] reductase [KO:K00023] [EC:1.1.1.36]. Bpro_2141 ... D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding protein [KO:K00090] [EC:1.1.1.215 1.1.1.81 1.1.1.79] ... D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding protein [KO:K00090] [EC:1.1.1.215 1.1.1.81 1.1.1.79] ... D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding protein [KO:K12972] [EC:1.1.1.81 1.1.1.79] ...
... acyl-carrier protein]reductase (FabG)from Listeria monocytogenes in complex with NADP+. (tree view) ...
... acyl-carrier protein] reductase FT activity; GO_function: GO:0018454 - acetoacetyl-CoA FT reductase activity; GO_process: GO: ... acyl-carrier FT protein] reductase activity; GO_function: GO:0018454 - FT acetoacetyl-CoA reductase activity; GO_process: GO: ... "possible acyl carrier protein" FT /note="GO_function: GO:0000036 - acyl carrier activity; FT GO_function: GO:0048037 - cofactor ... acyl-carrier-protein] reductase" FT /EC_number="1.1.1.100" FT /note="GO_component: GO:0005737 - cytoplasm; GO_function: FT GO: ...
Rhizobial acyl carrier proteins and their roles in the formation of bacterial cell-surface components that are required for the ... SMb20651 is another acyl carrier protein from Sinorhizobium meliloti.. Ramos-Vega AL, Dávila-Martínez Y, Sohlenkamp C, ... SMc01553 is the sixth acyl carrier protein in Sinorhizobium meliloti 1021.. Dávila-Martínez Y, Ramos-Vega AL, Contreras- ... The nodulation protein NodG shows the enzymatic activity of an 3-oxoacyl-acyl carrier protein reductase. ...
... acyl-carrier-protein] reductase (NADPH) activity; IEA:UniProtKB-EC. DR InterPro; IPR036291; NAD(P)-bd_dom_sf. DR InterPro; ... acyl-carrier-protein] reductase {ECO:0000313,EMBL:CBJ79530.1}; DE EC=1.1.1.100 {ECO:0000313,EMBL:CBJ79530.1}; GN ... methyl ester reductase activity; IEA:UniProtKB-EC. DR GO; GO:0102132; F:3-oxo-pimeloyl-[acp] methyl ester reductase activity; ... DR GO; GO:0102131; F:3-oxo-glutaryl-[acp] ...
... acyl-carrier protein] reductase (FabG; [EC:1.1.1.100]), leading to the limit the proliferation of lactobacilli which ... acyl-carrier-protein] synthase II (FabF; [EC:2.3.1.179]) and 3-oxoacyl-[ ... Lactobacillus reuteri has been reported to be beneficial for the expression of intestinal tight junction (TJ) proteins in ... TJ protein expression was detected in the three groups using immunohistochemical staining. ZO-1 expression was significantly ...
Protein Coding), Carbonyl Reductase 4, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards ... Acyl-Carrier-Protein] Reductase Beta Subunit 3 4 * Short Chain Dehydrogenase/Reductase Family 45C Member 1 3 4 ... Protein Symbol:. Q8N4T8-CBR4_HUMAN. Recommended name:. Carbonyl reductase family member 4. Protein Accession:. Q8N4T8. ... CBR4 (Carbonyl Reductase 4) is a Protein Coding gene. Diseases associated with CBR4 include Pancreatic Cancer 1 and Myopathy, ...
protein_id. CAB15280.1. Genomic View of Gene/Segment yusS Show/Hide (Legend) ... putative 3-oxoacyl-acyl-carrier protein reductase. transl_table. 11. note. Evidence 3: Function proposed based on presence of ...
protein_id. CAB15279.1. Genomic View of Gene/Segment yusR Show/Hide (Legend) ... Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product ...
... acyl-carrier-protein) reductase Geoth_2381 Glycerol dehydrogenase Geoth_3237 Alcohol dehydrogenase GroES domain protein Geoth_ ... 1.1.1.303 diacetyl reductase [(R)-acetoin forming] Geoth_3827 L-iditol 2-dehydrogenase K00004 BDH; (R,R)-butanediol ... 1.1.1.304 diacetyl reductase [(S)-acetoin forming] 1.1.1.305 UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid ... K00004 BDH; (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303] ...
... acyl-carrier-protein] reductase 1.1.1.101 acylglycerone-phosphate reductase ... CH59_3096 aldo/keto reductase family protein CH59_39 zinc-binding dehydrogenase family protein CH59_2697 zinc-binding ... CH59_283 iron-containing alcohol dehydrogenase family protein CH59_251 short chain dehydrogenase family protein ... 1.1.1.304 diacetyl reductase [(S)-acetoin forming] 1.1.1.305 UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid ...
... a copy of the fixL oxygen sensor protein, a copy of the fixK nitrogen fixation regulation protein, and the gene for ferredoxin ... sullae proteins were mapped and normalized on the ribosomal proteins counts in its pathway database. KAAS (KEGG Automatic ... In addition, the R. sullae IS123T proteins were mapped against the KEGG pathways database, and the result normalized by the ... An integral membrane protein, YggT, involved in response to extracytoplasmic stress (osmotic shock) is present, but this gene ...
  • Thus, the two substrates of this enzyme are (3R)-3-hydroxyacyl-[acyl-carrier-protein] and NADP + , whereas its 3 products are 3-oxoacyl-[acyl-carrier-protein] , NADPH , and H + . (wikipedia.org)
  • The homotetramer has NADPH-dependent quinone reductase activity (PubMed:19000905). (genecards.org)
  • The homotetramer may act as NADPH-dependent quinone reductase. (creative-biogene.com)
  • It serves as an electron carrier in a number of reactions, being alternately oxidized (NADP+) and reduced (NADPH). (drugbank.ca)
  • 3R)-3-hydroxyacyl-[acyl-carrier-protein] + NADP(+) = 3-oxoacyl-[acyl-carrier-protein] + NADPH. (cbrc.jp)
  • Putative proteins were identified by 2D SDS-PAGE and LC MS/MS. The most significant match is shown for each protein spot scoring above the MASCOT score significance threshold of 47 (spot numbers designated with an * indicate the best match was below the threshold). (biomedcentral.com)
  • However, there are two Ralstonia solanacearum genes, RSc1052 ( fabG1 ) and RSp0359 ( fabG2 ), annotated as encoding putative 3-ketoacyl-ACP reductases. (biomedcentral.com)
  • Here we report on the identification and structural characterization of the first NADP-dependent short-chain dehydrogenase/reductase (SDR) involved in inactivation of N-(3-oxo-dodecanoyl)-L-homoserine lactone (3-oxo-C(12)-HSL) and derived from a metagenome library. (proteopedia.org)
  • A novel metagenomic short-chain dehydrogenase/reductase attenuates Pseudomonas aeruginosa biofilm formation and virulence on Caenorhabditis elegans. (proteopedia.org)
  • CBR4 is a member of the short-chain dehydrogenase/reductase family. (prospecbio.com)
  • Both FabG homologues possess the conserved catalytic triad and the N-terminal cofactor binding sequence of the short chain dehydrogenase/reductase (SDR) family. (biomedcentral.com)
  • GO:0004315 (F) 3-oxoacyl- [acyl-carrier-protein] synthase a. (pku.edu.cn)
  • 3-ketosteroid-Δ 1 -dehydrogenase. (biomedcentral.com)
  • The primary function of hepatic glycerol 3-phosphate dehydrogenase appears to be in gluconeogenesis from glycerol. (biochemj.org)
  • PCR products were quantified in Opticon Software® and normalized to endogenous glyceraldehyde 3-phosphate dehydrogenase (GAPDH). (her2signaling.com)
  • The crystal structure of 3-hydroxydecanoyl-(acyl carrier protein) dehydratase from Vibrio cholerae O1 biovar El Tor str. (csgid.org)
  • Another example is the enzyme enoyl-ACP reductase, which catalyzes the NAD (P) H-dependent reduction of the enoyl-ACP double bond in the last step of the elongation cycle [ 7 ]. (biomedcentral.com)
  • GO:0004319 (F) enoyl- [acyl-carrier-protein] reductase (NAD. (pku.edu.cn)
  • The information on proteins involved in different metabolic pathways, particularly the regulation of the enzymes in cells' responses to different organic acids, is invaluable to biosynthesis of PHA biopolymers. (ijbs.com)
  • A number of proteins indicate interactions with an as yet unknown host, as indicated by the presence of predicted cell host remodeling enzymes, effector enzymes, hemolysin-like proteins, adhesins, NO reductase, and both type III and type VI secretory complexes. (biomedcentral.com)
  • Annotation described in this paper also reveals evidence for several metabolic pathways that have yet to be observed experimentally, including a sulphur oxidation ( sox FCDYZAXB) gene cluster, Calvin cycle enzymes, and proteins involved in nitrogen fixation in other species (including RubisCo, ribulose-phosphate 3-epimerase, and nif gene families, respectively). (biomedcentral.com)
  • In addition, the identification of novel proteins associated with P i uptake could be exploited in the removal of P i for water quality improvement, whilst enzymes involved in the catabolism of organophosphorus molecules are of interest in the pharmaceutical and agribiotech industrial sectors. (biomedcentral.com)
  • We supply the first evidence that, like other enzymes in the bacterial fatty acid biosynthetic pathway, one bacterium may simultaneously possess two or more 3-oxoacyl-ACP reductase isozymes. (biomedcentral.com)
  • 4) enzymes for degradation of misfolded proteins, i.e. (bvsalud.org)
  • Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed. (uniprot.org)
  • p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence. (uniprot.org)
  • section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. (uniprot.org)
  • Sequence of a 28.6 kb region of yeast chromosome XI includes the FBA1 and TOA2 genes, an open reading frame (ORF) similar to a translationally controlled tumour protein, one ORF containing motifs also found in plant storage proteins and 13 ORFs with weak or no homology to known proteins. (ymdb.ca)
  • 119, Last updated, Version 3) XX DE Rhodococcus jostii RHA1 plasmid pRHL3, complete sequence. (univ-lyon1.fr)
  • Sequence related families of genes and proteins are common in bacterial genomes. (beds.ac.uk)
  • HQ584991 Polytomella parva strain SAG 63-3 18S ribosomal RNA gene, partial sequence. (uni-goettingen.de)
  • Proteins whose genes are observed to be correlated in expression, across a large number of experiments. (string-db.org)
  • Nobile CJ, Mitchell AP: Regulation 3-oxoacyl-(acyl-carrier-protein) reductase of cell-surface genes and biofilm formation by the C-albicans transcription factor Bcr1p. (pparsignaling.com)
  • Other names in common use include 3-oxoacyl-[acyl carrier protein] (reduced nicotinamide adenine, dinucleotide) reductase, and 3-oxoacyl-[acyl-carrier-protein] reductase (NADH). (wikipedia.org)
  • The heteroteramer with CBR4 has NADH-dependent 3-ketoacyl-acyl carrier protein reductase activity. (abcam.com)
  • The heterotetramer with HSD17B8 has NADH-dependent 3-ketoacyl-acyl carrier protein reductase activity, and thereby plays a role in mitochondrial fatty acid biosynthesis (PubMed:19571038, PubMed:25203508). (genecards.org)
  • CBR4 formation of a heteroteramer with HSD17B8 has NADH-dependent 3-ketoacyl-acyl carrier protein reductase activity for o- and p-quinones. (prospecbio.com)
  • GO:0004320 (F) oleoyl- [acyl-carrier-protein] hydrolase act. (pku.edu.cn)
  • Alkyl hydroperoxide reductase, encoded by ahpC, is a member of the peroxiredoxin enzyme family. (bcl2-receptor.com)
  • section indicates if the gene coding for the protein originates from the hydrogenosome, the mitochondrion, the nucleomorph, different plastids or a plasmid. (uniprot.org)
  • p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors. (uniprot.org)
  • CBR4 (Carbonyl Reductase 4) is a Protein Coding gene. (genecards.org)
  • The presence of families and superfamilies of proteins suggest a history of gene duplication and divergence during evolution. (beds.ac.uk)
  • Protein families seem likely to have arisen during evolution by gene duplication and divergence where the gene copies that have been retained are the variants that have led to distinct bacterial physiologies and taxa. (beds.ac.uk)
  • However in 1970, Ohno [ 3 ] introduced the idea of gene duplication as an important form of genetic variation, a process that would go beyond gradualism and would permit quantum changes. (beds.ac.uk)
  • Global analysis of protein localization in budding yeast. (ymdb.ca)
  • No yeast two-hybrid interactions found for this protein. (yeastrc.org)
  • NAD + , NADP + , yeast extract, and molecular-weight marker-proteins for gel filtration were from Oriental Yeast (Tokyo, Japan). (hindawi.com)
  • Granger Kinase Inhibitor Library cell assay BL, Flenniken ML, Davis DA, Mitchell AP, Cutler JE: Yeast wall protein 1 of Candida albicans. (pparsignaling.com)
  • p>When browsing through different UniProt proteins, you can use the 'basket' to save them, so that you can back to find or analyse them later. (uniprot.org)
  • Ethylmalonyl-CoA mutase from Rhodobacter sphaeroides defines a new subclade of coenzyme B12-dependent acyl-CoA mutases. (genome.jp)
  • This, along with its ability to reduce perchlorate (a teratogenic contaminant introduced into the environment by man) and inquiry into its use in biocells [ 3 ] has led to interest in using this organism for bioremediation and energy production. (biomedcentral.com)
  • The systematic name of this enzyme class is (3R)-3-hydroxyacyl-[acyl-carrier-protein]:NADP + oxidoreductase . (wikipedia.org)
  • A number of proteins were found to be induced in R. eutropha by using 1D-PAGE and nano-liquid chromatography tandem MS/MS. With the proteins being up-regulated, a dramatic change occurred in the induction of PHA metabolism, including fatty acid biosynthesis for acetate, β-oxidation for propionate and both for levulinic acid. (ijbs.com)
  • The organic acids induced several proteins involved in amino acid biosynthesis, purine and pyrimidine biosynthesis, and cofactor biosynthesis in R. eutropha , but the regulations had a great variation. (ijbs.com)
  • During acetate metabolism proteins involved in the lipid metabolism and hexosamine biosynthesis were over-expressed in the acetate medium, while proteins involved in TCA cycle, pentose phosphate cycle and purine metabolism were down-regulated. (ijbs.com)
  • A 3-oxoacyl reductase that has specificity for ACYL CARRIER PROTEIN-derived FATTY ACIDS. (bvsalud.org)
  • Sera of groups 2 and 3 did not react to the components at the seven locations implying 100% diagnostic specificity of the IgG Western blot assay. (bvsalud.org)
  • The AHL signaling molecules are subject to inactivation mainly by hydrolases (Enzyme Commission class number EC 3) (i.e. (proteopedia.org)
  • FabG is the only known enzyme that catalyzes reduction of the 3-ketoacyl-ACP intermediates of bacterial fatty acid synthetic pathways. (biomedcentral.com)
  • Destruction of the insect gut tissue occurs during infection.Analysis of the proteins encoded by the genome indicated a number of potential virulence factors, although a type III secretion system was not found. (up.ac.za)
  • Genome encoded protein families, their size and functional composition, reflect metabolic potentials of the organisms they are found in. (beds.ac.uk)
  • To investigate further the contribution of the adenovirus type 5 (Ad5) E1B 55-kDa protein to genome replication, viral DNA accumulation was examined in primary human fibroblasts and epithelial cells infected with Ad5 or the E1B 55-kDa-null mutant Hr6. (gp120inhibitor.com)
  • Exhibits a marked preference for [acyl-carrier-protein] derivatives over CoA derivatives as substrates. (termsciences.fr)
  • X-ray diffraction data for the 2.35 Angstrom Crystal Structure of Conserved Hypothetical Protein from Toxoplasma gondii ME49. (proteindiffraction.org)
  • This multifunctional protein has 7 catalytic activities and an acyl carrier protein. (abcam.com)
  • In addition, our study reports the expression of several parasite proteins in clinical ring stages that have never been reported in the ring stages of the laboratory-cultivated parasite strain. (micrornasynthesis.com)
  • In vitro assays demonstrate that both proteins restore fatty acid synthetic ability to extracts of the E. coli strain. (biomedcentral.com)
  • The responses of the cells to the organic acids, such as regulation of proteins, can reveal the metabolic activities and mechanisms in detoxification and utilization of different organic acids by the microbial cells [ 10 ]. (ijbs.com)
  • However, it also demonstrates some characteristics of desiccation stress, such as the regulation of fatty acids and increased abundance of rehydrin in the 3% P i culture. (biomedcentral.com)
  • Search proteins in UniProtKB for this molecule. (uniprot.org)
  • The imidazole in the eluent was removed using a Centrifuge Biomax-5 column (Millipore, Billerica, MA, USA), and the AirR protein solution was supplemented with 30% glycerol and stored at −80°C until use. (hivprotease-signal.com)
  • p>An evidence describes the source of an annotation, e.g. an experiment that has been published in the scientific literature, an orthologous protein, a record from another database, etc. (uniprot.org)
  • be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein. (uniprot.org)
  • Deletion of the 2-acyl-glycerophosphoethanolamine cycle improve glucose metabolism in Escherichia coli strains employed for overproduction of aromatic compounds. (nih.gov)
  • The research compared and examined the proteins that might participate in PHA metabolism, primary metabolism, and cell's defense systems. (ijbs.com)
  • Digital subtraction analysis of preoperative [F-18]2-fluoro-2deoxy-D-glucose positron emission tomographic scan: and positron emission tomographic scans obtained after 3 months of stimulation;showed Geneticin decreased frontal metabolism during stimulation. (gp120inhibitor.com)
  • Using acetyl-CoA and malonyl-CoA as the initiating substrate and building block, respectively, these organisms share a common set of biochemical reactions to extend fatty acyl chains by two carbon atoms per cycle [ 1 - 3 ]. (biomedcentral.com)
  • Belongs to the short-chain dehydrogenases/reductases (SDR) family. (abcam.com)
  • 2003. Cancer prevention by tea polyphenols is linked to their direct inhibition of antiapoptotic Bcl-2-family proteins. (scbt.com)
  • Both similarities and differences were detected in the protein family memberships, with more similarities being detected among the more closely related organisms. (beds.ac.uk)
  • Protein family memberships reflected known metabolic characteristics of the organisms. (beds.ac.uk)
  • This HMM represents a small, very well conserved family of proteins closely related to the FabG family, TIGR01830, and possibly equal in function. (jcvi.org)