Enzymes of the oxidoreductase class that catalyze the dehydrogenation of hydroxysteroids. (From Enzyme Nomenclature, 1992) EC 1.1.-.
Catalyze the oxidation of 3-hydroxysteroids to 3-ketosteroids.
A class of enzymes that catalyzes the oxidation of 17-hydroxysteroids to 17-ketosteroids. EC 1.1.-.
A group of enzymes that catalyze the reversible reduction-oxidation reaction of 20-hydroxysteroids, such as from a 20-ketosteroid to a 20-alpha-hydroxysteroid (EC 1.1.1.149) or to a 20-beta-hydroxysteroid (EC 1.1.1.53).
A 3-hydroxysteroid dehydrogenase which catalyzes the reversible reduction of the active androgen, DIHYDROTESTOSTERONE to 5 ALPHA-ANDROSTANE-3 ALPHA,17 BETA-DIOL. It also has activity towards other 3-alpha-hydroxysteroids and on 9-, 11- and 15- hydroxyprostaglandins. The enzyme is B-specific in reference to the orientation of reduced NAD or NADPH.
An high-affinity, NAD-dependent 11-beta-hydroxysteroid dehydrogenase that acts unidirectionally to catalyze the dehydrogenation of CORTISOL to CORTISONE. It is found predominantly in mineralocorticoid target tissues such as the KIDNEY; COLON; SWEAT GLANDS; and the PLACENTA. Absence of the enzyme leads to a fatal form of childhood hypertension termed, APPARENT MINERALOCORTICOID EXCESS SYNDROME.
A low-affinity 11 beta-hydroxysteroid dehydrogenase found in a variety of tissues, most notably in LIVER; LUNG; ADIPOSE TISSUE; vascular tissue; OVARY; and the CENTRAL NERVOUS SYSTEM. The enzyme acts reversibly and can use either NAD or NADP as cofactors.
Hydroxysteroid dehydrogenases that catalyzes the reversible conversion of CORTISOL to the inactive metabolite CORTISONE. Enzymes in this class can utilize either NAD or NADP as cofactors.
Enzymes that catalyze the oxidation of estradiol at the 17-hydroxyl group in the presence of NAD+ or NADP+ to yield estrone and NADH or NADPH. The 17-hydroxyl group can be in the alpha- or beta-configuration. EC 1.1.1.62
Enzymes which transfer sulfate groups to various acceptor molecules. They are involved in posttranslational sulfation of proteins and sulfate conjugation of exogenous chemicals and bile acids. EC 2.8.2.
A naturally occurring glucocorticoid. It has been used in replacement therapy for adrenal insufficiency and as an anti-inflammatory agent. Cortisone itself is inactive. It is converted in the liver to the active metabolite HYDROCORTISONE. (From Martindale, The Extra Pharmacopoeia, 30th ed, p726)
A microsomal cytochrome P450 enzyme that catalyzes the 17-alpha-hydroxylation of progesterone or pregnenolone and subsequent cleavage of the residual two carbons at C17 in the presence of molecular oxygen and NADPH-FERRIHEMOPROTEIN REDUCTASE. This enzyme, encoded by CYP17 gene, generates precursors for glucocorticoid, androgen, and estrogen synthesis. Defects in CYP17 gene cause congenital adrenal hyperplasia (ADRENAL HYPERPLASIA, CONGENITAL) and abnormal sexual differentiation.
A subclass of enzymes which includes all dehydrogenases acting on primary and secondary alcohols as well as hemiacetals. They are further classified according to the acceptor which can be NAD+ or NADP+ (subclass 1.1.1), cytochrome (1.1.2), oxygen (1.1.3), quinone (1.1.5), or another acceptor (1.1.99).
A group of polycyclic compounds closely related biochemically to TERPENES. They include cholesterol, numerous hormones, precursors of certain vitamins, bile acids, alcohols (STEROLS), and certain natural drugs and poisons. Steroids have a common nucleus, a fused, reduced 17-carbon atom ring system, cyclopentanoperhydrophenanthrene. Most steroids also have two methyl groups and an aliphatic side-chain attached to the nucleus. (From Hawley's Condensed Chemical Dictionary, 11th ed)
A coenzyme composed of ribosylnicotinamide 5'-diphosphate coupled to adenosine 5'-phosphate by pyrophosphate linkage. It is found widely in nature and is involved in numerous enzymatic reactions in which it serves as an electron carrier by being alternately oxidized (NAD+) and reduced (NADH). (Dorland, 27th ed)
The main glucocorticoid secreted by the ADRENAL CORTEX. Its synthetic counterpart is used, either as an injection or topically, in the treatment of inflammation, allergy, collagen diseases, asthma, adrenocortical deficiency, shock, and some neoplastic conditions.
A tetrameric enzyme that, along with the coenzyme NAD+, catalyzes the interconversion of LACTATE and PYRUVATE. In vertebrates, genes for three different subunits (LDH-A, LDH-B and LDH-C) exist.
A potent androgenic steroid and major product secreted by the LEYDIG CELLS of the TESTIS. Its production is stimulated by LUTEINIZING HORMONE from the PITUITARY GLAND. In turn, testosterone exerts feedback control of the pituitary LH and FSH secretion. Depending on the tissues, testosterone can be further converted to DIHYDROTESTOSTERONE or ESTRADIOL.
The rate dynamics in chemical or physical systems.
A metabolite of TESTOSTERONE or ANDROSTENEDIONE with a 3-alpha-hydroxyl group and without the double bond. The 3-beta hydroxyl isomer is epiandrosterone.
A large lobed glandular organ in the abdomen of vertebrates that is responsible for detoxification, metabolism, synthesis and storage of various substances.
A zinc-containing enzyme which oxidizes primary and secondary alcohols or hemiacetals in the presence of NAD. In alcoholic fermentation, it catalyzes the final step of reducing an aldehyde to an alcohol in the presence of NADH and hydrogen.
Enzymes that catalyze the dehydrogenation of GLYCERALDEHYDE 3-PHOSPHATE. Several types of glyceraldehyde-3-phosphate-dehydrogenase exist including phosphorylating and non-phosphorylating varieties and ones that transfer hydrogen to NADP and ones that transfer hydrogen to NAD.
An enzymes that catalyzes the reversible reduction-oxidation reaction of 20-alpha-hydroxysteroids, such as from PROGESTERONE to 20-ALPHA-DIHYDROPROGESTERONE.
An enzyme that oxidizes an aldehyde in the presence of NAD+ and water to an acid and NADH. This enzyme was formerly classified as EC 1.1.1.70.
An enzyme that catalyzes the conversion of L-glutamate and water to 2-oxoglutarate and NH3 in the presence of NAD+. (From Enzyme Nomenclature, 1992) EC 1.4.1.2.
An enzyme that catalyzes the conversion of (S)-malate and NAD+ to oxaloacetate and NADH. EC 1.1.1.37.
An enzyme of the oxidoreductase class that catalyzes the conversion of isocitrate and NAD+ to yield 2-ketoglutarate, carbon dioxide, and NADH. It occurs in cell mitochondria. The enzyme requires Mg2+, Mn2+; it is activated by ADP, citrate, and Ca2+, and inhibited by NADH, NADPH, and ATP. The reaction is the key rate-limiting step of the citric acid (tricarboxylic) cycle. (From Dorland, 27th ed) (The NADP+ enzyme is EC 1.1.1.42.) EC 1.1.1.41.
3'-Phosphoadenosine-5'-phosphosulfate. Key intermediate in the formation by living cells of sulfate esters of phenols, alcohols, steroids, sulfated polysaccharides, and simple esters, such as choline sulfate. It is formed from sulfate ion and ATP in a two-step process. This compound also is an important step in the process of sulfur fixation in plants and microorganisms.
A sulfotransferase that catalyzes the sulfation of a phenol in the presence of 3'-phosphoadenylylsulfate as sulfate donor to yield an aryl sulfate and adenosine 3',5'-bisphosphate. A number of aromatic compounds can act as acceptors; however, organic hydroxylamines are not substrates. Sulfate conjugation by this enzyme is a major pathway for the biotransformation of phenolic and catechol drugs as well as neurotransmitters. EC 2.8.2.1.
Steroid derivatives formed by oxidation of a methyl group on the side chain or a methylene group in the ring skeleton to form a ketone.
A flavoprotein containing oxidoreductase that catalyzes the reduction of lipoamide by NADH to yield dihydrolipoamide and NAD+. The enzyme is a component of several MULTIENZYME COMPLEXES.
Nicotinamide adenine dinucleotide phosphate. A coenzyme composed of ribosylnicotinamide 5'-phosphate (NMN) coupled by pyrophosphate linkage to the 5'-phosphate adenosine 2',5'-bisphosphate. It serves as an electron carrier in a number of reactions, being alternately oxidized (NADP+) and reduced (NADPH). (Dorland, 27th ed)
Reversibly catalyze the oxidation of a hydroxyl group of carbohydrates to form a keto sugar, aldehyde or lactone. Any acceptor except molecular oxygen is permitted. Includes EC 1.1.1.; EC 1.1.2.; and 1.1.99.
A flavoprotein containing oxidoreductase that catalyzes the dehydrogenation of SUCCINATE to fumarate. In most eukaryotic organisms this enzyme is a component of mitochondrial electron transport complex II.
An alcohol oxidoreductase which catalyzes the oxidation of L-iditol to L-sorbose in the presence of NAD. It also acts on D-glucitol to form D-fructose. It also acts on other closely related sugar alcohols to form the corresponding sugar. EC 1.1.1.14
A major C19 steroid produced by the ADRENAL CORTEX. It is also produced in small quantities in the TESTIS and the OVARY. Dehydroepiandrosterone (DHEA) can be converted to TESTOSTERONE; ANDROSTENEDIONE; ESTRADIOL; and ESTRONE. Most of DHEA is sulfated (DEHYDROEPIANDROSTERONE SULFATE) before secretion.
A characteristic feature of enzyme activity in relation to the kind of substrate on which the enzyme or catalytic molecule reacts.
A glucose dehydrogenase that catalyzes the oxidation of beta-D-glucose to form D-glucono-1,5-lactone, using NAD as well as NADP as a coenzyme.
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
Oxidoreductases that are specific for ALDEHYDES.
D-Glucose:1-oxidoreductases. Catalyzes the oxidation of D-glucose to D-glucono-gamma-lactone and reduced acceptor. Any acceptor except molecular oxygen is permitted. Includes EC 1.1.1.47; EC 1.1.1.118; EC 1.1.1.119 and EC 1.1.99.10.
An enzyme of the oxidoreductase class that catalyzes the reaction 6-phospho-D-gluconate and NADP+ to yield D-ribulose 5-phosphate, carbon dioxide, and NADPH. The reaction is a step in the pentose phosphate pathway of glucose metabolism. (From Dorland, 27th ed) EC 1.1.1.43.
Reversibly catalyzes the oxidation of a hydroxyl group of sugar alcohols to form a keto sugar, aldehyde or lactone. Any acceptor except molecular oxygen is permitted. Includes EC 1.1.1.; EC 1.1.2. and EC 1.1.99.
The phenomenon whereby compounds whose molecules have the same number and kind of atoms and the same atomic arrangement, but differ in their spatial relationships. (From McGraw-Hill Dictionary of Scientific and Technical Terms, 5th ed)
Enzymes that catalyze the first step in the beta-oxidation of FATTY ACIDS.
A flavoprotein and iron sulfur-containing oxidoreductase that catalyzes the oxidation of NADH to NAD. In eukaryotes the enzyme can be found as a component of mitochondrial electron transport complex I. Under experimental conditions the enzyme can use CYTOCHROME C GROUP as the reducing cofactor. The enzyme was formerly listed as EC 1.6.2.1.
An enzyme that catalyzes the dehydrogenation of inosine 5'-phosphate to xanthosine 5'-phosphate in the presence of NAD. EC 1.1.1.205.
The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.
Alcohol oxidoreductases with substrate specificity for LACTIC ACID.
Any of the processes by which nuclear, cytoplasmic, or intercellular factors influence the differential control of gene action in enzyme synthesis.
Structurally related forms of an enzyme. Each isoenzyme has the same mechanism and classification, but differs in its chemical, physical, or immunological characteristics.
Flavoproteins that catalyze reversibly the reduction of carbon dioxide to formate. Many compounds can act as acceptors, but the only physiologically active acceptor is NAD. The enzymes are active in the fermentation of sugars and other compounds to carbon dioxide and are the key enzymes in obtaining energy when bacteria are grown on formate as the main carbon source. They have been purified from bovine blood. EC 1.2.1.2.
A flavoprotein oxidoreductase that has specificity for medium-chain fatty acids. It forms a complex with ELECTRON TRANSFERRING FLAVOPROTEINS and conveys reducing equivalents to UBIQUINONE.
An enzyme that catalyzes the oxidation of XANTHINE in the presence of NAD+ to form URIC ACID and NADH. It acts also on a variety of other purines and aldehydes.
A ketone oxidoreductase that catalyzes the overall conversion of alpha-keto acids to ACYL-CoA and CO2. The enzyme requires THIAMINE DIPHOSPHATE as a cofactor. Defects in genes that code for subunits of the enzyme are a cause of MAPLE SYRUP URINE DISEASE. The enzyme was formerly classified as EC 1.2.4.3.
The sequence of PURINES and PYRIMIDINES in nucleic acids and polynucleotides. It is also called nucleotide sequence.
The E1 component of the multienzyme PYRUVATE DEHYDROGENASE COMPLEX. It is composed of 2 alpha subunits (pyruvate dehydrogenase E1 alpha subunit) and 2 beta subunits (pyruvate dehydrogenase E1 beta subunit).
Enzymes that reversibly catalyze the oxidation of a 3-hydroxyacyl CoA to 3-ketoacyl CoA in the presence of NAD. They are key enzymes in the oxidation of fatty acids and in mitochondrial fatty acid synthesis.
Oxidoreductases that are specific for KETONES.
The class of all enzymes catalyzing oxidoreduction reactions. The substrate that is oxidized is regarded as a hydrogen donor. The systematic name is based on donor:acceptor oxidoreductase. The recommended name will be dehydrogenase, wherever this is possible; as an alternative, reductase can be used. Oxidase is only used in cases where O2 is the acceptor. (Enzyme Nomenclature, 1992, p9)
Inorganic salts of sulfuric acid.
An oxidoreductase involved in pyrimidine base degradation. It catalyzes the catabolism of THYMINE; URACIL and the chemotherapeutic drug, 5-FLUOROURACIL.
An enzyme that catalyzes the oxidation of UDPglucose to UDPglucuronate in the presence of NAD+. EC 1.1.1.22.
The facilitation of a chemical reaction by material (catalyst) that is not consumed by the reaction.
A disease-producing enzyme deficiency subject to many variants, some of which cause a deficiency of GLUCOSE-6-PHOSPHATE DEHYDROGENASE activity in erythrocytes, leading to hemolytic anemia.

Luteinizing hormone inhibits conversion of pregnenolone to progesterone in luteal cells from rats on day 19 of pregnancy. (1/633)

We have previously reported that intrabursal ovarian administration of LH at the end of pregnancy in rats induces a decrease in luteal progesterone (P4) synthesis and an increase in P4 metabolism. However, whether this local luteolytic effect of LH is exerted directly on luteal cells or on other structures, such as follicular or stromal cells, to modify luteal function is unknown. The aim of the present study was to determine the effect of LH on isolated luteal cells obtained on Day 19 of pregnancy. Incubation of luteal cells with 1, 10, 100, or 1000 ng/ml of ovine LH (oLH) for 6 h did not modify basal P4 production. The addition to the culture medium of 22(R)-hydroxycholesterol (22R-HC, 10 microgram/ml), a membrane-permeable P4 precursor, or pregnenolone (10(-2) microM) induced a significant increase in P4 accumulation in the medium in relation to the control value. When luteal cells were preincubated for 2 h with oLH, a significant (p < 0.01) reduction in the 22R-HC- or pregnenolone-stimulated P4 accumulation was observed. Incubation of luteal cells with dibutyryl cAMP (1 mM, a cAMP analogue) plus isobutylmethylxanthine (1 mM, a phosphodiesterase inhibitor) also inhibited pregnenolone-stimulated P4 accumulation. Incubation with an inositol triphosphate synthesis inhibitor, neomycin (1 mM), or an inhibitor of intracellular Ca2+ mobilization, (8,9-N, N-diethylamino)octyl-3,4,5-trimethoxybenzoate (1 mM), did not prevent the decrease in pregnenolone-stimulated P4 secretion induced by oLH. It was concluded that the luteolytic action of LH in late pregnancy is due, at least in part, to a direct action on the luteal cells and that an increase in intracellular cAMP level might mediate this effect.  (+info)

Luteinization and proteolysis in ovarian follicles of Meishan and Large White gilts during the preovulatory period. (2/633)

This experiment was conducted to determine why follicles luteinize faster in the Meishan breed than in the Large White breed of pig. Follicles were recovered during the late follicular phase from ovaries of both breeds before and after administration of hCG given to mimic the LH surge. First, the patterns of cholesterol transporters (high and low density lipoproteins: HDL and LDL) were compared. Cholesterol transporters detected in follicular fluid consisted of HDL only. Similar amounts of Apolipoprotein A-I were found in all samples. There was no obvious breed effect on minor lipoproteins found in the HDL-rich fraction, and this pattern was altered similarly by hCG in the two breeds. The LDL-rich samples of serum from both breeds contained similar amounts of protein. Second, three steroidogenic enzymes, adrenodoxin, 17 alpha-hydroxylase-lyase (P450(17) alpha) and 3 beta-hydroxysteroid-dehydrogenase (3 beta-HSD) were detected by immunohistochemistry and quantified by image analysis on sections of the two largest follicles. Before hCG treatment, theca interna cells demonstrated immunoreactivities for adrenodoxin (strong), P450(17) alpha and 3 beta-HSD (very strong), whereas granulosa cells displayed immunoreactivities for adrenodoxin only. After hCG treatment, the localization of the enzymes was unchanged but the staining intensity of adrenodoxin on granulosa cells and 3 beta-HSD on theca cells increased (P < 0.01 and P < 0.05, respectively). Breed effects were detected for the amounts of adrenodoxin in theca cells (Meishan > Large White; P < 0.05) and of 17 alpha-hydroxylase (Large White > Meishan, P < 0.01). Breed x treatment interactions were never detected. Finally, gelatinases, plasminogen activator, plasminogen activator inhibitor, tissue inhibitors of metalloproteases (TIMP-1 and TIMP-2) were visualized by direct or reverse zymography or western blotting. Whatever the stage relative to LH administration, follicular fluid from Large White gilts contained more TIMP-1, and TIMP-2 (P < 0.02 and P < 0.01, respectively). No breed effect was detected for the amounts of gelatinases and plasminogen activator inhibitor 1. However, for these parameters, a significant breed x time interaction was obvious, as the Meishan follicles had a greater response to hCG (P < 0.01). Since proteolysis plays a key role in the bioavailability of growth factors such as insulin-like growth factor 1, fibroblast growth factor and transforming growth factor beta, which have the ability to alter gonadotrophin-induced progesterone production in pigs, the differences observed in its control in the present study may explain, at least in part, the different patterns of luteinization observed in Meishan and Large White follicles.  (+info)

Opposing changes in 3alpha-hydroxysteroid dehydrogenase oxidative and reductive activities in rat leydig cells during pubertal development. (3/633)

The enzyme 3alpha-hydroxysteroid dehydrogenase (3alpha-HSD) has an important role in androgen metabolism, catalyzing the interconversion of dihydrotestosterone (DHT) and 5alpha-androstane-3alpha,17beta-diol (3alpha-DIOL). The net direction of this interconversion will affect the amount of biologically active ligand available for androgen receptor binding. We hypothesize that in Leydig cells, differential expression of 3alpha-HSD enzymes favoring one of the two directions is a mechanism by which DHT levels are controlled. In order to characterize 3alpha-HSD in rat Leydig cells, the following properties were analyzed: rates of oxidation (3alpha-DIOL to DHT) and reduction (DHT to 3alpha-DIOL) and preference for the cofactors NADP(H) and NAD(H) (i.e., the oxidized and reduced forms of both pyridine nucleotides) in Leydig cells isolated on Days 21, 35, and 90 postpartum. Levels of 3alpha-HSD protein were measured by immunoblotting using an antibody directed against the liver type of the enzyme. Levels of 3alpha-HSD protein and rates of reduction were highest on Day 21 and lowest on Day 90. The opposite was true for the rate of 3alpha-HSD oxidation, which was barely detectable on Day 21 and highest on Day 90 (59.08 +/- 6.35 pmol/min per 10(6) cells, mean +/- SE). Therefore, the level of 3alpha-HSD protein detectable by liver enzyme was consistent with reduction but not with oxidation. There was a clear partitioning of NADP(H)-dependent activity into the cytosolic fraction of Leydig cells, whereas on Days 35 and 90, Leydig cells also contained a microsomal NAD(H)-activated 3alpha-HSD. We conclude that 1) the cytosolic 3alpha-HSD in Leydig cells on Day 21 behaves as a unidirectional NADPH-dependent reductase; 2) by Day 35, a microsomal NAD(H)-dependent enzyme activity is present and may account for predominance of 3alpha-HSD oxidation over reduction and the resultant high capacity of Leydig cells on Day 90 to synthesize DHT from 3alpha-DIOL.  (+info)

Expression of 3beta-hydroxysteroid dehydrogenase type I and type VI isoforms in the mouse testis during development. (4/633)

Six isoforms of the enzyme 3beta-hydroxysteroid dehydrogenase (3betaHSD) have been identified in the mouse, each the product of a distinct gene. Two of these isoforms (type I and type VI) are detectable in the adult testis but changes in their expression during development are unknown. In this study we have examined changes in testicular expression and localization of mRNA encoding the type I and type VI isoforms of 3betaHSD. Total 3betaHSD (type I plus type VI) mRNA was measured by reverse transcription-polymerase chain reaction and showed a peak of expression at day 5 after birth followed by a decline and then a further rise after day 10 that continued up to adulthood. When each isoform was measured individually it was clear that the type I isoform was expressed at all ages from embryonic day 13 to adulthood. In contrast, the type VI isoform was only expressed at significant levels during fetal life on embryonic day 13 and then not again until after day 10 postnatally. Expression of the type VI isoform mRNA increased markedly after day 10 so that by adulthood it was the predominant 3betaHSD isoform present in the testis. Closer examination of the timing of type VI expression showed that the isoform mRNA was first detectable at a significant level on day 11. In-situ hybridization confirmed that the type I isoform is the only one expressed in the fetal/neonatal animal and showed that expression was limited to the interstitial tissue. In the adult, both type I and type VI expression was within the interstitial tissue. The timing of 3betaHSD type VI mRNA expression suggests, strongly, that this isoform is expressed only by adult-type Leydig cells in the mouse testis and that this development starts shortly before day 11. The limited expression of the type VI isoform means that it will be a useful marker in studies of adult Leydig cell development.  (+info)

Molecular cloning and characterization of hemolymph 3-dehydroecdysone 3beta-reductase from the cotton leafworm, Spodoptera littoralis. A new member of the third superfamily of oxidoreductases. (5/633)

The primary product of the prothoracic glands of last instar larvae of Spodoptera littoralis is 3-dehydroecdysone (3DE). After secretion, 3DE is reduced to ecdysone by 3DE 3beta-reductase in the hemolymph. We have previously purified and characterized 3DE 3beta-reductase from the hemolymph of S. littoralis. In this study, cDNA clones encoding the enzyme were obtained by reverse transcription-polymerase chain reaction, employing primers based on the amino acid sequences, in conjunction with 5'- and 3'-rapid amplification of cDNA ends. Multiple polyadenylation signals and AT-rich elements were found in the 3'-untranslated region, suggesting that this region may have a role in regulation of expression of the gene. Conceptual translation and amino acid sequence analysis suggest that 3DE 3beta-reductase from S. littoralis is a new member of the third superfamily of oxidoreductases. Northern analysis shows that 3DE 3beta-reductase mRNA transcripts are widely distributed, but are differentially expressed, in some tissues. The developmental profile of the mRNA revealed that the gene encoding 3DE 3beta-reductase is only transcribed in the second half of the last larval instar and that this fluctuation in expression accounts for the change in the enzyme activity during the instar. Southern analysis indicates that the 3DE 3beta-reductase is encoded by a single gene, which probably contains at least one intron.  (+info)

An inborn error of bile acid synthesis (3beta-hydroxy-delta5-C27-steroid dehydrogenase deficiency) presenting as malabsorption leading to rickets. (6/633)

Deficiency of 3beta-hydroxy-delta5-C27-steroid dehydrogenase (3beta-HSDH), the enzyme that catalyses the second reaction in the principal pathway for the synthesis of bile acids, has been reported to present with prolonged neonatal jaundice with the biopsy features of neonatal hepatitis. It has also been shown to present between the ages of 4 and 46 months with jaundice, hepatosplenomegaly, and steatorrhoea (a clinical picture resembling progressive familial intrahepatic cholestasis). This paper reports two children with 3beta-HSDH deficiency who developed rickets during infancy and did not develop clinically evident liver disease until the age of 3 years. Bile acid replacement resulted in considerable clinical and biochemical improvement. The importance of thorough investigation of fat soluble vitamin deficiencies in infancy is emphasised.  (+info)

Dynamics of periovulatory steroidogenesis in the rhesus monkey follicle after ovarian stimulation. (7/633)

The temporal relationships and regulation of events in the primate follicle during the periovulatory interval are poorly understood. This study was designed to elucidate the dynamics of steroid synthesis in the macaque follicle during ovarian stimulation cycles in which serum/follicular fluid aspirates were collected at precise intervals before (0 h) and after (up to 36 h) administration of the ovulatory human chorionic gonadotrophin (HCG) bolus. Serum concentrations of progesterone increased (P < 0.05) within 30 min, and follicular fluid progesterone concentrations were elevated 180-fold within 12 h, of HCG injection, and remained elevated until the time of ovulation. In contrast, 17beta-oestradiol concentrations increased initially, but then declined (P < 0.05) by 36 h post-HCG. Acute incubation of granulosa cells with and without steroidogenic substrates demonstrated that: (i) 3beta-hydroxysteroid dehydrogenase and aromatase activities were present in equivalent amounts before and after HCG; whereas (ii) P450 side-chain cleavage activity increased (P < 0.05) within 12 h of HCG; and (iii) exogenous low-density lipoprotein and cholesterol were not utilized for steroidogenesis. This model should be useful for further studies on ovulation and luteinization in primates, and enable elucidation of the local actions of progesterone and other steroids at specific time points during the periovulatory interval.  (+info)

Paracrine glucocorticoid activity produced by mouse thymic epithelial cells. (8/633)

Previous data have suggested that glucocorticoids (GCs) are involved in the differentiation of thymocytes into mature T cells. In this report we demonstrate that the mouse thymic epithelial cells (TEC) express the cytochrome P450 hydroxylases Cyp11A1, Cyp21, and Cyp11B1. These enzymes, in combination with 3beta-hydroxysteroid dehydrogenase (3betaHSD), convert cholesterol into corticosterone, the major GC in rodents. In addition, when TEC were cocultured with 'reporter cells' containing the glucocorticoid receptor (GR) and a GR-dependent reporter gene, a specific induction of reporter gene activity was observed. Induction of reporter gene activity was blocked when the TEC and reporter cells were incubated in the presence of the Cyp11B1 inhibitor metyrapone or the 3betaHSD inhibitor trilostane, as well as by the GR antagonist RU486. Coculturing of TEC with thymocytes induced apoptosis in the latter, which was partially blocked by the enzyme inhibitors and RU486. We conclude that TEC secrete a GC hormone activity and suggest a paracrine role for this in thymocyte development.  (+info)

Mouse polyclonal antibody raised against a partial recombinant NSDHL. NSDHL (NP_057006, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. (H00050814-A01) - Products - Abnova
Buy our Recombinant Human NSDHL protein. Ab162360 is a full length protein produced in Wheat germ and has been validated in WB, ELISA. Abcam provides free…
TY - JOUR. T1 - The orphan nuclear receptor, liver receptor homolog-1, regulates cholesterol side-chain cleavage cytochrome P450 enzyme in human granulosa cells. AU - Kim, Joung W.. AU - Havelock, Jon C.. AU - Carr, Bruce R.. AU - Attia, George R.. PY - 2005/3/1. Y1 - 2005/3/1. N2 - After ovulation, there is a shift in ovarian steroidogenesis from an estrogen-producing ovarian follicle to a progesterone-producing corpus luteum. The first step in human ovarian steroidogenesis is catalyzed by cholesterol side-chain cleavage cytochrome P450 (CYP11A1) enzyme. Steroidogenic factor-1 is an orphan nuclear receptor that regulates several steroidogenic enzymes, including CYP11A1. Liver receptor homolog-1 (LRH-1) is another orphan nuclear receptor that is expressed in the human ovary. After ovulation there is a down-regulation in steroidogenic factor-1, which is associated with an up-regulation of LRH-1 expression. These changes coincide with increased level of CYP11A1 expression in human corpus luteum. ...
TY - JOUR. T1 - Preparation of highly purified 3α- and 3β-hydroxysteroid dehydrogenases from Pseudomonas sp. AU - Shikita, Mikio. AU - Talalay, Paul. PY - 1979/5. Y1 - 1979/5. N2 - A method is described for preparing highly purified 3α- and 3β-hydroxysteroid dehydrogenases (EC 1.1.1.50 and EC 1.1.1.145, respectively), essentially uncontaminated with one another, from extracts of a steroid-induced Pseudomonas species. These enzymes are suitable for the microanalysis of 3α-hydroxy-, 3β-hydroxy-, and 3-ketosteroids.. AB - A method is described for preparing highly purified 3α- and 3β-hydroxysteroid dehydrogenases (EC 1.1.1.50 and EC 1.1.1.145, respectively), essentially uncontaminated with one another, from extracts of a steroid-induced Pseudomonas species. These enzymes are suitable for the microanalysis of 3α-hydroxy-, 3β-hydroxy-, and 3-ketosteroids.. UR - http://www.scopus.com/inward/record.url?scp=0018474352&partnerID=8YFLogxK. UR - ...
K00498 CYP11A; cholesterol monooxygenase (side-chain-cleaving) [EC:1.14.15.6] K00512 CYP17A; steroid 17alpha-monooxygenase / 17alpha-hydroxyprogesterone deacetylase [EC:1.14.14.19 1.14.14.32] K01131 STS; steryl-sulfatase [EC:3.1.6.2] K01015 SULT2B1; alcohol sulfotransferase [EC:2.8.2.2] K00513 CYP21A; steroid 21-monooxygenase [EC:1.14.14.16] K00070 HSD3B; 3beta-hydroxy-Delta5-steroid dehydrogenase / steroid Delta-isomerase [EC:1.1.1.145 5.3.3.1] K00070 HSD3B; 3beta-hydroxy-Delta5-steroid dehydrogenase / steroid Delta-isomerase [EC:1.1.1.145 5.3.3.1] K00070 HSD3B; 3beta-hydroxy-Delta5-steroid dehydrogenase / steroid Delta-isomerase [EC:1.1.1.145 5.3.3.1] K00070 HSD3B; 3beta-hydroxy-Delta5-steroid dehydrogenase / steroid Delta-isomerase [EC:1.1.1.145 5.3.3.1] K00070 HSD3B; 3beta-hydroxy-Delta5-steroid dehydrogenase / steroid Delta-isomerase [EC:1.1.1.145 5.3.3.1] K00070 HSD3B; 3beta-hydroxy-Delta5-steroid dehydrogenase / steroid Delta-isomerase [EC:1.1.1.145 5.3.3.1] K12343 SRD5A1; ...
20α-Hydroxysteroid dehydrogenase (20α-HSD), which metabolizes progesterone to an inactive steroid in the corpus luteum of mice and rats but not of humans, is thought to play a crucial role in shortening the oestrous cycles in these rodent species. We determined the nucleotide sequence of the 5′-flanking region of the mouse 20α-HSD gene, and examined its promoter activity using a rat luteinized granulosa cell culture. A reporter assay, using reporter constructs of various lengths of the 5′-flanking region, revealed that the region between −83 and 60 bp upstream of the transcription start site was essential for transcriptional activity. Furthermore, mutational analysis demonstrated that a putative Sp1 site in this region was critical to the expression of the reporter gene. Electrophoretic mobility-shift assays showed that the interaction of proteins in a nuclear extract from rat luteinized granulosa cells with this region was inhibited by a competitor having the wild-type Sp1 sequence in ...
Hydroxysteroid Dehydrogenase - Instruments Consumables Reagents Advanced BioMatrix,RANDOX,RANDOX ELISA,Biomedical, biochemical reagents, laboratory supplies, equipment, antibodies, ELISA kits, diagnostic reagents, methods of experimental techniques, general analytical instruments, material testing instruments and equipment, used laboratory equipment, instruments and equipment, life sciences, environmental monitoring equipment , measurement, measuring instruments, rotating wall bioreactor, three-dimensional tissue / stem cell culture system; microcapsule
1I5R: A concerted, rational design of type 1 17beta-hydroxysteroid dehydrogenase inhibitors: estradiol-adenosine hybrids with high affinity
17β-Hydroxysteroid dehydrogenases (HSD17Bs) comprise a large family of 15 members that are mainly involved in sex hormone metabolism. Some HSD17Bs enzymes also play key roles in cholesterol and fatty acid metabolism. Recent study showed that hydroxysteroid 17β-dehydrogenase 13 (HSD17B13), an enzyme …
The NSDHL gene provides instructions for making an enzyme that is involved in the production (synthesis) of cholesterol. Learn about this gene and related health conditions.
Trilostane is the chemical name for a medication that effectively treats Canine Cushings Disease. Worldwide, the only licensed veterinary version of trilostane is manufactured in the U.K. by the Dechra Group under the brand name of Vetoryl. Vetoryl is marketed in four dosage strengths: 10 mg., 30 mg., 60 mg., and 120 mg. capsules. Vetoryl is commonly used in the U.K. and Europe, and it is becoming more widely prescribed in the U.S. subsequent to FDA approval beginning in 2009. All dosage
Trilostane is the chemical name for a medication that effectively treats Canine Cushings Disease. Worldwide, the only licensed veterinary version of trilostane is manufactured in the U.K. by the Dechra Group under the brand name of Vetoryl. Vetoryl received FDA approval for sale in the U.S. beginning in 2009. Vetoryl is generally marketed in four dosage strengths: 10 mg., 30 mg., 60 mg., and 120 mg. capsules. In the U.S., 5 mg. capsules are also available. All dosage strengths of brand
The enzyme 20α-hydroxysteroid dehydrogenase (20α-HSD) catalyzes the conversion of progesterone to its inactive form, 20α-hydroxyprogesterone. This enzyme has been shown to play a critical role in the regulation of luteal function in experimental animals. In this study, we cloned and expressed the gene encoding elk deer 20α-HSD from reproductive placental ...
Complete information for HSDL1 gene (Protein Coding), Hydroxysteroid Dehydrogenase Like 1, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
Downloading a figure as powerpoint requires a browser with javascript support. Enable javascript and try again For help please contact [email protected] ...
The research in the Schlinger lab focuses on two questions: 1) How are steroids made available in active forms to distinct neural circuits at appropriate periods of the animals life? 2) How have some neural circuits, but not others, become sensitive to control by steroidal signalling molecules? Experimental Approaches: We study birds in the lab and in the field to explore these questions, examining species that have evolved unique behavioral strategies to optimize their reproductive potential. Techniques regularly used by members of the laboratory include: biochemical assays of steroidogenic enzyme activity, steroidogenic enzyme mRNA expression via Northern blots, rtPCR/Southern blots, in situ hybridization, protein expression via immunocytochemistry, Western blots, neuroanatomical measures via light and fluorescence microscopy and image analysis, and steroid-autoradiography. Please click on the links to learn more about our lab! ...
TY - JOUR. T1 - Structural and functional aspects of placental lactogens (PLs) and ovarian 20α-hydroxysteroid dehydrogenase (20α-HSD) in the rat. AU - Shiota, K.. AU - Hirosawa, M.. AU - Hattori, N.. AU - Itonori, S.. AU - Miura, R.. AU - Noda, K.. AU - Takahashi, M.. AU - Ogawa, T.. PY - 1994. Y1 - 1994. N2 - The placenta plays an essential role in fetal growth and the maintenance of pregnancy. Successful development and maturation of the embryo is totally dependent on placental function. The main endocrine participation of the placenta is attributed to placental lactogens (PLs). Progesterone is essential for pregnancy in all mammals and is secreted by the ovary and placenta, depending on the animal species. In the rat, the main source of progesterone throughout pregnancy is the ovary, and 20α-hydroxysteroid dehydrogenase (20α-HSD) is a key enzyme for ovarian progesterone secretion. The primary action of prolactin (PRL) in the maintenance of ovarian progesterone secretion is suppression of ...
Title: Effect of Free and in Poly(η-caprolactone) Nanoparticles Incorporated New Type 1 17β -Hydroxysteroid Dehydrogenase Inhibitors on Cancer Cells. VOLUME: 6 ISSUE: 1. Author(s):Petra Kocbek, Karmen Teskac, Petra Brozic, Tea Lanisnik Rizner, Stanislav Gobec and Julijana Kristl. Affiliation:Askerceva 7, 1000 Ljubljana, Slovenia.. Keywords:Nanoparticles, enzyme inhibitors, T-47D cells, cellular uptake, drug delivery, breast cancer. Abstract: Development and progression of breast cancer can be caused by increased estradiol activity, which stimulates cell proliferation. Inhibitors of type 1 17β-hydroxysteroid dehydrogenase (17β-HSD) enzyme inhibit estradiol biosynthesis and therefore have potential anticancer activity. In this study two new trans-cinnamic acid esters were established as inhibitors of the human recombinant type 1 17β-HSD enzyme. Studied compounds are poorly water soluble and have low stability in aqueous medium. Free inhibitors were tested on T-47D cells, which express ...
Abstract Interference with the pregnancy-maintaining influence of progesterone is the basis of most methods for termination of unwanted pregnancy in dogs. The currently available methods are based on induction of luteolysis or blocking of the progesterone receptor. Inhibition of progesterone synthesis using a competitive inhibitor of 3 -hydroxysteroid dehydrogenase (3 ... read more -HSD) could be another strategy to terminate unwanted pregnancies. In this study we investigated the effects of the 3 -HSD inhibitor trilostane on corpus luteum function in non-pregnant bitches. Trilostane was administered orally for seven consecutive days in either the pituitary-independent part of the luteal phase (PIP, start of treatment on D11 after ovulation, n 6) or the pituitary-dependent part (PDP, start of treatment on D31 after ovulation, n 6), in an oral dose of about 4.5 mg/kg bw, twice daily. Results were compared with those obtained in control bitches (n 6). ACTH stimulation tests were performed to ...
Musto, N; Hafiez, A A.; and Bartke, A, Prolactin increases 17beta-hydroxysteroid dehydrogenase activity in the testis. (1972). Subject Strain Bibliography 1972. 2710 ...
Regulation of 3β‐Hydroxysteroid Dehydrogenase Activity by Human Chorionic Gonadotropin, Androgens, and Antiandrogens in Cultured Testicular ...
The primary source of oestrogen in premenopausal women is the ovary but, after menopause, oestrogen biosynthesis in peripheral tissue is the exclusive site of formation. An enzyme group that affects the availability of active oestrogens is the 17β-hydroxysteroid dehydrogenase (17HSD) family. In breast cancer, 17HSD type 1 and type 2 have been mostly investigated and seem to be the principal 17HSD enzymes involved thus far. The question whether 17HSD type 1 or type 2 is of greatest importance in breast tumour development is still not clear. The aim of this study was to investigate how the loss of 17HSD type 2 expression, using siRNA in the non-tumour breast epithelial cells HMEC (human mammal epithelial cells) and MCF10A, and gain of 17HSD type 2 expression, using transient transfection in the breast cancer derived cell lines MCF7 and T47D, affect oestradiol conversion and proliferation rate measured as S-phase fraction. We further investigated how this was related to the endogenous expression ...
3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids.
The biosynthesis of steroid hormones in the gonads and adrenal glands requires the activities of the enzyme 3 beta-hydroxysteroid dehydrogenase/isomerase (3 beta HSD) which catalyzes the NAD(+)-dependent dehydrogenation and subsequent delta 5--|delta 4 isomerization of delta 5-3 beta-hydroxysteroids to delta 4-3-ketosteroids. The mouse expresses four isoforms of 3 beta HSD. 3 beta HSD I is expressed in gonads and adrenal glands and appears to be the major steroidogenic form, 3 beta HSDs II and III are expressed in both liver and kidneys, and 3 beta HSD IV has been detected only in kidneys. To determine the genetic relationship between the 3 beta HSD isoforms, we have mapped the chromosomal locations of the four genes by linkage analysis using gene-specific probes derived from the 3 untranslated regions of 3 beta HSD cDNA clones. The four 3 beta HSD structural genes (Hsd3b) are closely linked within a segment of chromosome 3 that is conserved on human chromosome 1. The order of markers on
Accepted name: 17β-estradiol 17-dehydrogenase. Reaction: 17β-estradiol + NAD(P)+ = estrone + NAD(P)H + H+. Other name(s): 20α-hydroxysteroid dehydrogenase; 17β,20α-hydroxysteroid dehydrogenase; 17β-estradiol dehydrogenase; estradiol dehydrogenase; estrogen 17-oxidoreductase; 17β-HSD; HSD17B7. Systematic name: 17β-estradiol:NAD(P)+ 17-oxidoreductase. Comments: The enzyme oxidizes or reduces the hydroxy/keto group on C17 of estrogens and androgens in mammals and regulates the biological potency of these steroids. The mammalian enzyme is bifunctional and also catalyses EC 1.1.1.270, 3β-hydroxysteroid 3-dehydrogenase [3]. The enzyme also acts on (S)-20-hydroxypregn-4-en-3-one and related compounds, oxidizing the (S)-20-group, but unlike EC 1.1.1.149, 20α-hydroxysteroid dehydrogenase, it is Si-specific with respect to NAD(P)+.. Links to other databases: BRENDA, EXPASY, GTD, KEGG, Metacyc, PDB, CAS registry number: 9028-61-9. References:. 1. Kautsky, M.P. and Hagerman, D.D. 17β-Estradiol ...
Accepted name: 17β-estradiol 17-dehydrogenase. Reaction: 17β-estradiol + NAD(P)+ = estrone + NAD(P)H + H+. Other name(s): 20α-hydroxysteroid dehydrogenase; 17β,20α-hydroxysteroid dehydrogenase; 17β-estradiol dehydrogenase; estradiol dehydrogenase; estrogen 17-oxidoreductase; 17β-HSD; HSD17B7. Systematic name: 17β-estradiol:NAD(P)+ 17-oxidoreductase. Comments: The enzyme oxidizes or reduces the hydroxy/keto group on C17 of estrogens and androgens in mammals and regulates the biological potency of these steroids. The mammalian enzyme is bifunctional and also catalyses EC 1.1.1.270, 3β-hydroxysteroid 3-dehydrogenase [3]. The enzyme also acts on (S)-20-hydroxypregn-4-en-3-one and related compounds, oxidizing the (S)-20-group, but unlike EC 1.1.1.149, 20α-hydroxysteroid dehydrogenase, it is Si-specific with respect to NAD(P)+.. Links to other databases: BRENDA, EXPASY, GTD, KEGG, Metacyc, PDB, CAS registry number: 9028-61-9. References:. 1. Kautsky, M.P. and Hagerman, D.D. 17β-Estradiol ...
Aldo-keto reductase family 1 member C1 also known as 20α-hydroxysteroid dehydrogenase, 3α-hydroxysteroid dehydrogenase, and dihydrodiol dehydrogenase 1/2 is an enzyme that in humans is encoded by the AKR1C1 gene.[1][2] This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reduction of progesterone to the inactive form 20-alpha-hydroxy-progesterone. This gene shares high sequence identity with three other gene members, and is clustered with those three genes at chromosome 10p15-p14.[2] ...
Circulating levels of the steroid hormone, progesterone (P), increase during development of the primate corpus luteum (CL) and then decline during luteal regres...
USP Grape Seed Oil. If you prefer, you also could replace grape seed oil into ethyl oleate or MCT.. Drostanolone Enanthate Introduction and Usage:. Masteron is a modified form of Dihydrotestosterone, with a methyl group at the 2nd carbon (carbon alpha) atom. This modification is responsible for the anabolic strength increase. This methyl group makes it harder for the enzyme 3-hydroxysteroid dehydrogenase to metabolize Masteron. This enzyme is abundantly present in muscle tissue, and is responsible for degrading any DHT into two inactive metabolites: 3-Alpha Androstanediol and 3-Beta Androstanediol. Because of this enzyme DHT is not anabolic in muscle tissue at all. It is believed that if the enzyme 3-hydroxysteroid dehydrogenase was neutralized, DHT would actually be a very powerful anabolic steroid. Drostanolones methyl group addition makes it imune to this enzyme.. Drostanolone is injected into the body as an ester (bonded to either Propionate or Enanthate). Enzymes cleave off the ester from ...
Inderbinen SG, Zogg M, Kley M, Smieško M, Odermatt A Endocrine Disruption and Steroid Hormone Action Toxicology and Applied Pharmacology, 1 Feb 2021 ...
Androgens and estrogens increase the number of cell division and the opportunity for random genetic errors and are thus involved in carcinogenesis of hormone related cancers. [...]
Homo sapiens aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase) (AKR1C1), mRNA. (H00001645-R01) - Products - Abnova
aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III ...
To this day, a significant proportion of the human genome remains devoid of functional characterization. In this study, we present evidence that the previously functionally uncharacterized product of the human DHRS10 gene is endowed with 17beta-HSD (17beta-hydroxysteroid dehydrogenase) activity. 17beta-HSD enzymes are primarily involved in the metabolism of steroids at the C-17 position and also of other substrates such as fatty acids, prostaglandins and xenobiotics. In vitro, DHRS10 converts NAD+ into NADH in the presence of oestradiol, testosterone and 5-androstene-3beta,17beta-diol. Furthermore, the product of oestradiol oxidation, oestrone, was identified in intact cells transfected with a construct plasmid encoding the DHRS10 protein. In situ fluorescence hybridization studies have revealed the cytoplasmic localization of DHRS10. Along with tissue expression data, this suggests a role for DHRS10 in the local inactivation of steroids in the central nervous system and placenta. The crystal structure
CP001022.PE374 Location/Qualifiers FT CDS_pept 400861..401859 FT /codon_start=1 FT /transl_table=11 FT /locus_tag=Exig_0378 FT /product=UDP-glucose 4-epimerase FT /note=TIGRFAM: UDP-glucose 4-epimerase; PFAM: FT NAD-dependent epimerase/dehydratase; short-chain FT dehydrogenase/reductase SDR; 3-beta hydroxysteroid FT dehydrogenase/isomerase; polysaccharide biosynthesis FT protein CapD; dTDP-4-dehydrorhamnose reductase; Male FT sterility domain; KEGG: bld:BLi04283 hypothetical protein FT /db_xref=EnsemblGenomes-Gn:Exig_0378 FT /db_xref=EnsemblGenomes-Tr:ACB59862 FT /db_xref=GOA:B1YIH9 FT /db_xref=InterPro:IPR001509 FT /db_xref=InterPro:IPR005886 FT /db_xref=InterPro:IPR036291 FT /db_xref=UniProtKB/TrEMBL:B1YIH9 FT /protein_id=ACB59862.1 FT /translation=MAVLVVGGAGYIGSHAVYQLVDAGQDVVVIDHLKSGHREAVHPKA FT RFYEGDIRDRAFLDTVFEKETIDQVVHFAAFSLVGESMEHPLAYFDNNVYGTQVLLEAM FT MAHDVKQIVFSSTAATYGEQEQMPILETATTNPTNAYGETKLMMEKMMRWCETAYGLNY FT ...
Life Sci. 2001 Jan 5;68(7):751-61. Links Chalcones are potent inhibitors of aromatase and 17beta-hydroxysteroid dehydrogenase activities.Le Bail JC,
Shop Inactive hydroxysteroid dehydrogenase-like protein ELISA Kit, Recombinant Protein and Inactive hydroxysteroid dehydrogenase-like protein Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
We use cookies to ensure that we give you the best experience on our website. If you click Continue well assume that you are happy to receive all cookies and you wont see this message again. Click Find out more for information on how to change your cookie settings ...
Skull, Skull Base, Ethanol, Sodium, Surgery, Literature, Patients, Plant, Cells, Report, Patient, Future, Cultures, Diterpenoids, Dehydrogenases, Hydroxysteroid Dehydrogenases, Skeleton, Carbon, Hiv, Hiv-1
The IUPHAR/BPS Guide to Pharmacology. hydroxysteroid 11-beta dehydrogenase 1 - 1.-.-.- Oxidoreductases. Detailed annotation on the structure, function, physiology, pharmacology and clinical relevance of drug targets.
The IUPHAR/BPS Guide to Pharmacology. trilostane ligand page. Quantitative data and detailed annnotation of the targets of licensed and experimental drugs.
Kit Component:- KN307977G1, Hsd3b2 gRNA vector 1 in pCas-Guide vector- KN307977G2, Hsd3b2 gRNA vector 2 in pCas-Guide vector- KN307977D, donor vector…
Hydroxysteroid (17-beta) Dehydrogenase 4兔多克隆抗体(ab97971)可与人样本反应并经WB实验严格验证。所有产品均提供质保服务,中国75%以上现货。
Harris Brake is the third largest lake owned by the AGFC. Located adjacent Harris Brake Wildlife Management Area, this multi-use recreation site is one of the states most popular outdoor destinations thanks to its close proximity to Little Rock, Conway and Russellville. Here visitors can enjoy a relaxing day fishing, hunting or just taking in the beauty of the Ouachita Mountain foothills.. Harris Brake Lake has cover and structure galore - shoreline brush, sunken timber, cypress trees, underwater points and islands, creek channel drop-offs, old docks and artificial fish structures. Visiting anglers land plenty of big bluegills, redear sunfish, crappies, channel catfish and largemouth bass. Sportsmen may want to plan their fishing trip to coincide with hunting season. The bottomlands of Harris Brake WMA, just north of Arkansas Highway 300, offer good hunting for ducks, squirrels, rabbits, raccoons and other game animals. Additional hunting opportunities are available on nearby Winona Wildlife ...
Looking for information on 3 beta hydroxysteroid dehydrogenase deficiency? Medigest has all you need to know about 3 beta hydroxysteroid dehydrogenase deficiency - Symptoms and Signs, Causes, Treatments and definition
Girls with idiopathic premature adrenarche, characterized by the early appearance of pubic hair and adrenal hyperandrogenism, may be at an increased risk for polycystic ovarian syndrome and its associated complications. Alterations of peripheral metabolism of adrenal steroids, specifically increased 5 alpha-reductase and 11 beta-hydroxysteroid dehydrogenase activities, have been documented in patients with polycystic ovarian syndrome and proposed as an underlying mechanism for the adrenal hyperandrogenism in this syndrome. We sought to investigate whether alterations in 5 alpha-reductase and 11 beta-hydroxysteroid dehydrogenase activities are present in girls with premature adrenarche, suggesting a possible role in the pathogenesis of the hyperandrogenism of this condition. We studied C19 and C21 urinary steroid metabolites, 5 alpha/5 beta and 11 oxo/11 hydroxy metabolite pairs as well as the ratios of the total 5 alpha/total 5 beta and total 11 oxo/total 11 hydroxy metabolites in 24-h urine samples
Enzymatic interconversion of active and inactive glucocorticoid hormone is important, and is carried out physiologically by 11β-hydroxysteroid dehydrogenase (11β-HSD) isoforms, explaining their role in cellular and toxicological processes. Two forms of the enzyme, 11β-HSD-1 and 11β-HSD-2, belonging to the protein superfamily of short-chain dehydrogenases/reductases, have been structurally and functionally characterised. Although displaying dehydrogenase and reductase activities in vitro, the dominant in vivo function of the type-1 enzyme might be to work as a reductase, thus generating active cortisol from inactive cortisone precursors. On the other hand, for adrenal glucocorticoids the type-2 enzyme seems to be exclusively a dehydrogenase and, by inactivating glucocorticoids, confers specificity to peripheral mineralocorticoid receptors.
Trilostane. Currently the most common method for treating pituitary-dependent hyperadrenocorticism (PDH) in Europe is oral administration of trilostane on a daily basis. Trilostane is a synthetic, orally active steroid analogue that competitively inhibits 3β hydroxysteroid dehydrogenase and hence synthesis of several steroids, including cortisol and aldosterone. This competitive inhibition is reversible and seems to be dose-related. There is also increasing evidence to suggest that trilostane may modify peripheral conversion of cortisol to cortisone and cause some degree of adrenocortical destruction in dogs with PDH.. In dogs peak trilostane concentrations are seen within 1.5 hours of dosing and decrease to baseline values in about 18 hours. Trilostane is variably absorbed after oral administration, at least partly due to its poor water solubility. Absorption may be enhanced by administering the drug with food although this phenomenon has not been investigated in dogs with ...
Testosterone is metabolized in various tissues by 5α-reductase into DHT, which is 3- to 10-fold more potent as an AR agonist, and by aromatase into estradiol, which is an estrogen and lacks significant AR affinity.[1] In addition, DHT is metabolized by 3α-hydroxysteroid dehydrogenase (3α-HSD) and 3β-hydroxysteroid dehydrogenase (3β-HSD) into 3α-androstanediol and 3β-androstanediol, respectively, which are metabolites with little or no AR affinity.[1] 5α-Reductase is widely distributed throughout the body, and is concentrated to various extents in skin (particularly the scalp, beard-area of the face, pubic area, and genital area (penis and scrotum)), prostate, seminal vesicles, liver, and the brain.[1] In contrast, expression of 5α-reductase in skeletal muscle is undetectable.[1] Aromatase is highly expressed in adipose tissue and the brain, and is also expressed significantly in skeletal muscle.[1] 3α-HSD is also highly expressed in skeletal muscle.[56]. Natural AAS like testosterone ...
AKR1C3 - AKR1C3 (untagged)-Human aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) (AKR1C3) available for purchase from OriGene - Your Gene Company.
DISCUSSION. Our baseline CON values for the E:F ratio were similar to those previously reported by others (6). The short term GFJ treatment in the present study lowered enzyme activity by 44% (Figure 3), which compares favorably to the ~40% inhibition estimated from the urinary-E/F ratio obtained in a pilot study (10) and to the ~60% obtained in a patient presenting with edema and hypokalemia associated with the habitual oral intake of 1 liter/day of GFJ (5). Taken together, our findings suggest that Sal effluents are a cost-effective and convenient matrix (compared to plasma/urine) for probing alterations in 11β-HSD2 activity induced by GFJ ingestion. In our study, the decrease in enzyme activity induced by GFJ at baseline was mainly driven by a significant decrease (~30%) in Sal-E concentration. This is in line with a decrease in F oxidation to E, a reaction that is mediated by 11β-HSD2 (1,9,10) and likely inhibited by one or more flavonoids found in GFJ (naringenin, quercetin, hesperetin, ...
trans-1,2-dihydrobenzene-1,2-diol dehydrogenase: rat liver cytosol enzyme also catalyzes 3alpha-hydroxysteroid dehydrogenase activity (EC 1.1.1.50); GenBank AH009074 (rat); RefSeq NM_001818 (human)
1. Actions of CRH on the Fetal Adrenal Gland As discussed in Chapter 3 (see Fetal Adrenal Glands), the human fetal adrenal glands are morphologically, functionally, and physiologically remarkable organs. At term, the fetal adrenal glands weigh the same as those in the adult and are similar in size to the adjacent fetal kidney. The…
Macdonald, I.A., Mahony, D.E., Jellett, J.F. and Meier, C.E. (1977). NAD-dependent 3α- and 12α-hydroxysteroid dehydrogenase activities from Eubacterium lentum ATCC no. 25559. Biochim. Biophys. Acta 489: 466-476. PMID 201289. ...
1J96: Structure of the human 3alpha-hydroxysteroid dehydrogenase type 3 in complex with testosterone and NADP at 1.25-A resolution.
Achim Recktenwald, PhD (achim at ibex.ca) wrote: : Robert S. Strauss wrote: : , : , Maxy Mariasegaram ,mariaseg at HERCULES.CS.UREGINA.CA, wrote: : , : , ,Hello everyone, : , : , ,I have to write a paper on the above enzyme as part of the course : , ,requirements for a fourth year biochemistry class. : , : , ,I would appreciate any leads to literature that cover the structure, : , ,function, kinetics and recent development on 3-beta HSD, preferably some : , ,review articles. Failing which, what would be a good way to start this : , ,search? I tried looking up the Bio Abstracts, but that didnt help much. : , : , ,I look forward to hearing from people out there, and thank you very much : , ,for reading this message. : , : , ,cheers, : , ,Max Youll find a lot of information if you search medline with the words : short-chain dehydrogenases. In 1995 Jornvall et al. published a review in Biochemistry, it is pretty informative, although incomplete. Lluis ...
Hydroxysteroid Dehydrogenase (3.BETA.-HSD), 17.ALPHA.-Hydroxylase and 17, 20 Lyase by Progestins and Danazol". Endocrinologia ... 141-. ISBN 978-3-319-14385-9.CS1 maint: multiple names: authors list (link) Bromham, D. R.; Booker, M. W.; Rose, Gillian; ... 141-. ISBN 978-3-319-14385-9. Side effects [of gestrinone] are due to the androgenic and anti-estrogenic effects including, ... 36 (3): 387-394. doi:10.1507/endocrj1954.36.387. ISSN 0013-7219. PMID 2583058. Tamaya T, Fujimoto J, Watanabe Y, Arahori K, ...
17β-Hydroxysteroid dehydrogenase 3 (17β-HSD3) is an enzyme that in humans is encoded by the HSD17B3 gene and is involved in ... 17β-Hydroxysteroid dehydrogenase GRCh38: Ensembl release 89: ENSG00000130948 - Ensembl, May 2017 GRCm38: Ensembl release 89: ... Rösler A, Silverstein S, Abeliovich D (May 1996). "A (R80Q) mutation in 17 beta-hydroxysteroid dehydrogenase type 3 gene among ... "Entrez Gene: HSD17B3 hydroxysteroid (17-beta) dehydrogenase 3". "Testosterone 17-beta-dehydrogenase deficiency - Conditions - ...
... hydroxysteroid dehydrogenase)". National Center for Biotechnology Information, U.S. National Library of Medicine. CS1 maint: ... "Entrez Gene: AKR1C2 aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)- ... and dihydrodiol dehydrogenase type 2, is an enzyme that in humans is encoded by the AKR1C2 gene. This gene encodes a member of ... Aldo-keto reductase family 1 member C2, also known as bile acid binding protein, 3α-hydroxysteroid dehydrogenase type 3, ...
17β-hydroxysteroid dehydrogenase, 21-hydroxylase, and 11β-hydroxylase.[6] It has also been found to be a weak inhibitor of ... ISBN 978-3-540-78355-8.. *^ a b c d e f g h i j k l m n o p q r s t u v w x y z Eric J. Thomas; John Rock (6 December 2012). ... 345-. ISBN 978-1-4757-2085-3.. *^ a b c d e f Index Nominum 2000: International Drug Directory. Taylor & Francis. January 2000 ... 293-. ISBN 978-3-88763-075-1.. *^ a b c d I.K. Morton; Judith M. Hall (6 December 2012). Concise Dictionary of Pharmacological ...
137 (3-4): 326-341. doi:10.1016/j.anifeedsci.2007.06.008. Richardson, Kurt E.; Hagler, Winston M.; Mirocha, Chester J. ( ... 3 (11-12): 777-83. doi:10.1002/dta.352. PMID 22095651. Ding X, Lichti K, Staudinger JL (June 2006). "The mycoestrogen ... 6 (3): 1080-95. doi:10.3390/toxins6031080. PMC 3968378. PMID 24632555. Mukherjee D, Royce SG, Alexander JA, Buckley B, ... This process is catalyzed by 3 α- and 3 β-hydroxy steroid dehydrogenase (HSD). CYP450 enzymes will then catalyze aromatic ...
Couture JF, Legrand P, Cantin L, Luu-The V, Labrie F, Breton R (Aug 2003). "Human 20alpha-hydroxysteroid dehydrogenase: ... Zhang Y, Dufort I, Rheault P, Luu-The V (Oct 2000). "Characterization of a human 20alpha-hydroxysteroid dehydrogenase". Journal ... Aldo-keto reductase family 1 member C1 also known as 20α-hydroxysteroid dehydrogenase, 3α-hydroxysteroid dehydrogenase, and ... hydroxysteroid dehydrogenase)". Human AKR1C1 genome location and AKR1C1 gene details page in the UCSC Genome Browser. Human C9 ...
The 20 to 70 mm seed pods are gray-green, four-sided with rounded corners, and have 3 to 5 mm stems. The species has a 2n = 14 ... 30 (3): 275-289. doi:10.1007/bf00629957. ISSN 0009-3130. Fahey, Jed W.; Zalcmann, Amy T.; Talalay, Paul (2001). "ChemInform ... 3β-Hydroxysteroid dehydrogenases represent another enzyme class that is predicted to be involved in cardenolide biosynthesis. ... ISBN 3-8001-3131-5 Polatschek, Adolf (1974). "Systematisch-nomenklatorische Vorarbeit zur Gattung Erysimum in Italien". Annalen ...
Aldo-keto reductase family 1 member C3 (AKR1C3), also known as 17β-hydroxysteroid dehydrogenase type 5 (17β-HSD5, HSD17B5) is a ... Rheault P, Dufort I, Soucy P, Luu-The V (1999). "Assignment of HSD17B5 encoding type 5 17 beta-hydroxysteroid dehydrogenase to ... "Human 3alpha-hydroxysteroid dehydrogenase isoforms (AKR1C1-AKR1C4) of the aldo-keto reductase superfamily: functional ... "Close kinship of human 20alpha-hydroxysteroid dehydrogenase gene with three aldo-keto reductase genes". Genes to Cells. 5 (2): ...
24 (3): 562-569. doi:10.1111/j.1570-7458.1978.tb02817.x. ISSN 0013-8703. S2CID 85648914. Zhu, YC (1989). Plantae Medicinales ... 30 (3): 275-289. doi:10.1007/bf00629957. ISSN 0009-3130. S2CID 13763922. Evoflor, a web page on Erysimum floral evolution ... 17 (3): 525-533. doi:10.1007/bf00982123. ISSN 0098-0331. PMID 24258803. S2CID 32639023. Sachdev-Gupta, K.; Radke, Cd.; Renwick ... Most species have stems erect, somewhat winged, canescent with an indumentum of bifid hairs, usually 25 ± 53 cm × 2-3 mm in ...
Subsequently, 20α-hydroxysteroid dehydrogenase and 20β-hydroxysteroid dehydrogenase reduce these metabolites to form the ... Progesterone is highly susceptible to enzymatic reduction via reductases and hydroxysteroid dehydrogenases due to its double ... First, the 3β-hydroxyl group is oxidized to a keto group and second, the double bond is moved to C4, from C5 through a keto/ ... 27 (3): 229-39. doi:10.1055/s-0029-1216276. PMC 2675922. PMID 19401954. Li Z, Wang B, Kan Z, Zhang B, Yang Z, Chen J, Wang D, ...
Rosler, A (August 2006). "17 beta-hydroxysteroid dehydrogenase 3 deficiency in the Mediterranean population". Pediatric ... glucose-6-phosphate dehydrogenase deficiency, and fragile X syndrome (FXS), which is an inherited genetic condition with ... glucose-6-phosphate dehydrogenase deficiency, alpha-thalassemia, molecular characterization, recessive osteoperosis, ... 16 (3): 374-86. doi:10.1038/sj.ejhg.5201934. PMID 17928816. Abu-Amero, KK; Hellani, A; González, AM; Larruga, JM; Cabrera, VM; ...
However, the initial 5α-reduced metabolite of D4A, 3-keto-5α-abiraterone, is an agonist of the AR, and has been found to ... D4A is specifically an inhibitor of CYP17A1 (17α-hydroxylase/17,20-lyase), 3β-HSD, and 5α-reductase. In addition, it has also ... Δ4-Abiraterone (D4A; code name CB-7627), also known as 17-(3-pyridyl)androsta-4,16-dien-3-one, is a steroidogenesis inhibitor ... 3β-HSD). It is said to be a more potent inhibitor of steroidogenesis than abiraterone, and is partially responsible for the ...
200 (1): 3-22. doi:10.1677/JOE-08-0415. PMID 18971218. Koch CE, Leinweber B, Drengberg BC, Blaum C, Oster H (February 2017). " ... The activity of 3β-hydroxysteroid dehydrogenase can be determined by observing the basal 17α-hydroxypregnenolone level. A level ... ISBN 978-3-318-02238-4. PMID 24002412. Livadas S, Bothou C (2019). "Management of the Female With Non-classical Congenital ... 3 Suppl 3: 451-4. PMID 17551465. NCAH is not characterized by cortisol insufficiency and these patients do not need ...
... or 17-beta-hydroxysteroid dehydrogenase deficiency (17beta-HSD-3). Genetic females (with two X chromosomes) with congenital ... "17β-Hydroxysteroid dehydrogenase-3 deficiency: A rare endocrine cause of male-to-female sex reversal". Gynecological ... XY Persons with 5α-Reductase-2 Deficiency and 17β-Hydroxysteroid Dehydrogenase-3 Deficiency". Archives of Sexual Behavior. 34 ( ... 3 (4): 245-252. doi:10.14737/JOURNAL.AAVS/2015/3.4.245.252. S2CID 10764239. Retrieved 26 February 2020. "'Sex-change' chicken ...
Retrieved 3 April 2011. (PDF) "Cushing's Disease in Dogs". NASC LIVE. Retrieved 2021-01-04. de Gier J; Wolthers CH; Galac S; ... 3 (11): 3417-3434. doi:10.3390/ph3113417. ISSN 1424-8247. Takizawa I, Nishiyama T, Hara N, Hoshii T, Ishizaki F, Miyashiro Y, ... Trilostane, also known as 4α,5-epoxy-3,17β-dihydroxy-5α-androst-2-ene-2-carbonitrile, is a synthetic androstane steroid and a ... Retrieved 3 April 2011. "Vetoryl-Contraindications". NOAH Compendium of Animal Health-National Office of Animal Health UK. ...
... is a human gene that encodes for 3beta-hydroxysteroid dehydrogenase/delta(5)-delta(4)isomerase type II or hydroxy-delta- ... "Entrez Gene: HSD3B2 Hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2". Pelletier G, Dupont E, ... 5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2. It is expressed principally in steroidogenic tissues and is ... 78 (3): 561-7. doi:10.1210/jc.78.3.561. PMID 8126127. Mendonça BB, Russell AJ, Vasconcelos-Leite M, et al. (1994). "Mutation in ...
... alpha-hydroxysteroid dehydrogenase for neurosteroids and its inhibition by benzodiazepines" (pdf). Biological & Pharmaceutical ... 4,16-Androstadien-3β-ol (PH94B, Aloradine) is a synthetic pheromone, or pherine, neurosteroid which is under investigation for ... 37 (1-3): 116-32. doi:10.1016/s0165-0173(01)00112-6. PMID 11744080. S2CID 44931783. Su TP, London ED, Jaffe JH (1988). "Steroid ... 186 (3): 362-72. doi:10.1007/s00213-005-0213-2. PMID 16432684. S2CID 7799814. Dhir A, Rogawski MA (April 2012). "Role of ...
... which regulates the expression of 17β-hydroxysteroid dehydrogenase. The amount of testosterone synthesized is regulated by the ... In the final and rate limiting step, the C17 keto group androstenedione is reduced by 17β-hydroxysteroid hydrogenase to yield ... 3β-Androstanediol and 3β-etiocholanediol can also be formed in this pathway when 5α-DHT and 5β-DHT are acted upon by 3β-HSD ... 37 (3): 304-12. doi:10.1016/j.ijlp.2013.11.016. PMID 24367977. Nguyen TV, McCracken JT, Albaugh MD, Botteron KN, Hudziak JJ, ...
5α-DHF can be further metabolized into 3α,5α-tetrahydrocortisol by 3α-hydroxysteroid dehydrogenase. https://pubchem.ncbi.nlm. ...
3β-Dihydroprogesterone (pregn-4-en-3β-ol-20-one) is an isomer of pregnenolone in which the C5 double bond has been replaced ... 59 (3): 422-6. doi:10.1210/jcem-59-3-422. PMID 6086697. Faure N, Labrie F, Lemay A, Bélanger A, Gourdeau Y, Laroche B, Robert G ... 37 (3): 416-24. doi:10.1016/S0015-0282(16)46107-8. PMID 6800852. Dupont A, Dupont P, Belanger A, Mailoux J, Cusan L, Labrie F ( ... 40 (3): 333-6. PMID 1654510. Irwin RP, Maragakis NJ, Rogawski MA, Purdy RH, Farb DH, Paul SM (July 1992). "Pregnenolone sulfate ...
In addition, it is categorized as C3 (AKR1C3) because it is an isoform of 3α-hydroxysteroid dehydrogenase. The function of PGFS ... doi:10.1016/0005-2744(81)90281-3. PMID 7248317. Wong PY (1982). "Purification of PGD2 11-ketoreductase from rabbit liver". ...
"Localization of type 5 17beta-hydroxysteroid dehydrogenase, 3beta-hydroxysteroid dehydrogenase, and androgen receptor in the ... "Immunoelectron microscopic localization of 3beta-hydroxysteroid dehydrogenase and type 5 17beta-hydroxysteroid dehydrogenase in ... HSD3B1 is a human gene that encodes for a 3beta-hydroxysteroid dehydrogenase/delta(5)-delta(4)isomerase type I or hydroxy-delta ... Bonenfant M, Provost PR, Drolet R, Tremblay Y (May 2000). "Localization of type 1 17beta-hydroxysteroid dehydrogenase mRNA and ...
... via 17β-hydroxysteroid dehydrogenase). Epietiocholanolone can also be formed directly from 5β-androstanedione (via 3β- ... hydroxysteroid dehydrogenase). It is glucuronidated and sulfated in the liver and excreted in urine. Androsterone ... Epietiocholanolone, also known as 3β-hydroxy-5β-androstan-17-one or as etiocholan-3β-ol-17-one, is an etiocholane (5β- ... The metabolic pathway is testosterone to 5β-dihydrotestosterone (via 5β-reductase), 5β-dihydrotestosterone to 3β,5β- ...
"The biological activity of 3alpha-hydroxysteroid oxido-reductase in the spinal cord regulates thermal and mechanical pain ... doi:10.1093/annonc/3.suppl_3.S15. PMID 1390312. Pannuti F, Martoni A, Lenaz GR, Piana E, Nanni P (April 1978). "A possible new ... MPA has been described as very potent in its inhibition of rat 3α-HSD, with an IC50 of 0.2 μM and a Ki (in rat testicular ... However, inhibition of 3α-HSD by MPA does not appear to have been confirmed using human proteins yet, and the concentrations ...
ISBN 978-0-323-29738-7. Jin Y, Penning TM (2001). "Steroid 5alpha-reductases and 3alpha-hydroxysteroid dehydrogenases: key ... It has an affinity (Kd) of 0.25 to 0.5 nM for the human AR, which is about 2- to 3-fold higher than that of testosterone (Kd = ... ISBN 978-3-318-02774-7. PMID 26370642. Check JH, Cohen R (2015). "An update on the treatment of female alopecia and the ... 63-. ISBN 978-3-88763-075-1. List PH, Hörhammer L (2013). Chemikalien und Drogen: Teil B: R, S. Springer-Verlag. pp. 523-. ISBN ...
... and 3α-hydroxysteroid dehydrogenase (3α-HSD). Leung-Gurung, Lucie; Escalante Cobb, Priscilla; Mourad, Faraj; Zambrano, Cristina ... "Methoxychlor and its metabolite HPTE inhibit rat neurosteroidogenic 3α-hydroxysteroid dehydrogenase and retinol dehydrogenase 2 ...
... hydroxysteroid dehydrogenase (3[beta]-HSD) plays a vital role in the metabolism of androstenone. When looking at the adipose ... Volume 83, Issue 3: Pages 527-540 - via Oxford Academic, Hunter College Library. ,volume= has extra text (help) v t e v t e. ...
11 (3): 101-110. doi:10.1002/(SICI)1522-7146(1996)11:3. 3.0.CO;2-O. ISSN 0887-2082. PMID 9029268. v t e v t e v t e. ... 154 (3): 1060-1064. doi:10.1016/S0022-5347(01)66976-3. ISSN 0022-5347. Roberts, Alan E.; Ritz, Martha A.; Hoekstra, Susan; ... ISBN 978-0-8155-1856-3. Dr. Ian Morton; I.K. Morton; Judith M. Hall (31 October 1999). Concise Dictionary of Pharmacological ... Zanoterone does not inhibit 5α-reductase, aromatase, or 3α- or 3β-hydroxysteroid dehydrogenase in vitro. The drug significantly ...
17β-Hydroxysteroid dehydrogenase 2 (17β-HSD2) is an enzyme of the 17β-hydroxysteroid dehydrogenase (17β-HSD) family that in ... dehydrogenase 2". Moeller G, Adamski J (2006). "Multifunctionality of human 17beta-hydroxysteroid dehydrogenases". Mol. Cell. ... Soubhye J, Alard IC, van Antwerpen P, Dufrasne F (2015). "Type 2 17-β hydroxysteroid dehydrogenase as a novel target for the ... In addition to 17β-HSD activity, this enzyme also shows high 20α-hydroxysteroid dehydrogenase activity and can activate the ...
17β-hydroxysteroid dehydrogenase deficiency. *aromatase excess syndrome. *Androgen receptor (Androgen insensitivity syndrome) ... 65 (3): 385-411. doi:10.2165/00003495-200565030-00005. PMID 15669880.. *^ a b c d e f g h i j k l m n o p q r s Melmed, Shlomo ... 3 (4): 722-6. doi:10.1177/193229680900300417. PMC 2769984. PMID 20144319.. *^ a b Selph S, Dana T, Blazina I, Bougatsos C, ... 3-16. ISBN 978-0-387-09840-1. . OCLC 663097550.. *^ a b Koutroumpakis, E; Jozwik, B; Aguilar, D; Taegtmeyer, H (2020). " ...
Mutations in the genes encoding 11β-hydroxysteroid dehydrogenase type 1 and hexose-6-phosphate dehydrogenase interact to cause ... 原始内容存档于3 March 2015).. *^ 4.0 4.1 4.2 4.3 4.4 4.5 Polycystic Ovary Syndrome (PCOS): Condition Information. US Department of ... 2013, 19 (3): 268-88. PMID 23303572. doi:10.1093/humupd/dms059.. *^ Kelly CJ, Stenton SR, Lashen H. Insulin-like growth factor ... doi:10.1093/humupd/7.1.3.. *^ 25.0 25.1 25.2 Strauss JF. Some new thoughts on the pathophysiology and genetics of polycystic ...
Phosphogluconate dehydrogenase. *Sorbitol dehydrogenase. *Hydroxysteroid dehydrogenase: 3β *3β-HSD. *NSDHL ... Thus, the two substrates of this enzyme are xylitol and NADP+, whereas its 3 products are L-xylulose, NADPH, and H+. ... Over-expression and ectopic expression of the protein may be associated with prostate adenocarcinoma.[3] ...
Phosphogluconate dehydrogenase. *Sorbitol dehydrogenase. *Hydroxysteroid dehydrogenase: 3β *3β-HSD. *NSDHL ... In enzymology, a homoisocitrate dehydrogenase (EC 1.1.1.87) is an enzyme that catalyzes the chemical reaction ... Rowley B, Tucci AF (1970). "Homoisocitric dehydrogenase from yeast". Arch. Biochem. Biophys. 141 (2): 499-, 510. doi:10.1016/ ... homoisocitric dehydrogenase, (−)-1-hydroxy-1,2,4-butanetricarboxylate:NAD+ oxidoreductase, (decarboxylating), 3-carboxy-2- ...
17β-Hydroxysteroid dehydrogenase deficiency. *Aromatase excess syndrome. Androgen receptor. *Androgen insensitivity syndrome ... 20 (3): 358-417. doi:10.1210/edrv.20.3.0370. PMID 10368776.. *^ a b c Hill RA, Boon WC (2009). "Estrogens, brain, and behavior ... 978-0-08-058132-3. .. *^ Thomas L. Lemke; David A. Williams (24 January 2012). Foye's Principles of Medicinal Chemistry. ... 978-0-7295-8561-3. .. *^ William T. O'Donohue; Lorraine T. Benuto; Lauren Woodward Tolle (8 July 2014). Handbook of Adolescent ...
Phosphogluconate dehydrogenase. *Sorbitol dehydrogenase. *Hydroxysteroid dehydrogenase: 3β *3β-HSD. *NSDHL ... alcohol dehydrogenase (NADP+) activity. • retinal dehydrogenase activity. • allyl-alcohol dehydrogenase activity. • NADP- ... retinol dehydrogenase activity. Cellular component. • mast cell granule. • Schwann cell microvillus. • Schmidt-Lanterman ... 9 (3): 149-57. doi:10.1089/dna.1990.9.149. PMID 2111143.. *. Nishimura C, Matsuura Y, Kokai Y, Akera T, Carper D, Morjana N, ...
21 (3): 147-53. doi:10.1097/med.0000000000000067. PMID 24755997.. *^ a b c Brandão Neto, RA; de Carvalho, JF (2014). "Diagnosis ... 978-0-8493-6849-3. .. *^ Addison, Thomas (1855). On The Constitutional And Local Effects Of Disease Of The Supra-Renal Capsules ... 0.9-1.4 per 10,000 people (developed world)[1][3]. Addison's disease arises from problems with the adrenal gland such that not ... Addison's disease affects about 0.9 to 1.4 per 10,000 people in the developed world.[1][3] It occurs most frequently in middle- ...
... , also known as 17-(3-pyridyl)-5α-androst-16-en-3-one, is an active metabolite of abiraterone acetate that ... 5S,8R,9S,10S,13S,14S)-10,13-Dimethyl-17-pyridin-3-yl-1,2,4,5,6,7,8,9,11,12,14,15-dodecahydrocyclopenta[a]phenanthren-3-one ... C[[email protected]]12CCC(=O)C[[email protected]@H]1CC[[email protected]@H]3[[email protected]@H]2CC[[email protected]]4([[email protected]]3CC=C4C5=CN=CC=C5)C ... and Δ4-abiraterone to 3-keto-5α-abiraterone by 5α-reductase.[1][2] 3-Keto-5α-abiraterone may counteract the clinical ...
glucose 1-dehydrogenase Ja 1.1.1.49 glucose-6-phosphate dehydrogenase Ja 1.1.1.50 3alpha-hydroxysteroid dehydrogenase (B- ... L-iditol 2-dehydrogenase Ja 1.1.1.15 D-iditol + NAD+ ⇌. {\displaystyle \rightleftharpoons }. D-sorbose + NADH + H+ D-iditol 2- ... D-arabitol 4-dehydrogenase 1.1.1.12 L-arabitol + NAD+ ⇌. {\displaystyle \rightleftharpoons }. L-xylulose + NADH + H+ L-arabitol ... L-arabitol 2-dehydrogenase 1.1.1.14 L-iditol + NAD+ ⇌. {\displaystyle \rightleftharpoons }. L-sorbose + NADH + H+ ...
... involves a defect in the gene for 11β-hydroxysteroid dehydrogenase, an enzyme that normally inactivates circulating cortisol to ... by causing inhibition of the 11β-hydroxysteroid dehydrogenase enzyme and likewise leading to secondary apparent ... "Impaired protein stability of 11beta-hydroxysteroid dehydrogenase type 2: a novel mechanism of apparent mineralocorticoid ... Vantyghem MC, Marcelli-Tourvieille S, Defrance F, Wemeau JL (October 2007). "11beta-hydroxysteroide dehydrogenases. Recent ...
... alpha-hydroxysteroid dehydrogenase for neurosteroids and its inhibition by benzodiazepines" (pdf). Biol Pharm Bull. 25 (4): 441 ... 113 (1-3): 367-73. doi:10.1016/S0379-0738(00)00226-7. PMID 10978650. Brisse, B.; Tetsch, P.; Toye, A. (1980). "[Clinical study ... Usami N; Yamamoto T; Shintani S; Ishikura S; Higaki Y; Katagiri Y; Hara A. (Apr 2002). "Substrate specificity of human 3(20) ...
Phosphogluconate dehydrogenase. *Sorbitol dehydrogenase. *Hydroxysteroid dehydrogenase: 3β *3β-HSD. *NSDHL ... lactate dehydrogenase A. (subunit M). Human lactate dehydrogenase M4 (the isoenzyme found in skeletal muscle). From PDB: 1I10​. ... D-lactate dehydrogenase, membrane binding. crystal structure of d-lactate dehydrogenase, a peripheral membrane respiratory ... Lactate dehydrogenase-A deficiency is caused by a mutation to the LDHA gene, while lactate dehydrogenase-B deficiency is caused ...
17β-hydroxysteroid dehydrogenase deficiency. *aromatase excess syndrome. *Androgen receptor (Androgen insensitivity syndrome) ... 3 per 100,000 per year[4]. Diabetes insipidus (DI) is a condition characterized by large amounts of dilute urine and increased ... doi:10.1007/s11102-011-0294-3. PMID 21301966.. *^ Smith D, McKenna K, Moore K, Tormey W, Finucane J, Phillips J, Baylis P, ... Rubin, Alan L. (2011). Diabetes For Dummies (3 ed.). John Wiley & Sons. p. 19. ISBN 9781118052488. Archived from the original ...
... which regulates the expression of the enzyme 17β-hydroxysteroid dehydrogenase that is used to convert androstenedione, the ... 326 (3): 179-83. doi:10.1056/NEJM199201163260306. PMID 1727547.. *^ Valdes-Socin H, Salvi R, Daly AF, Gaillard RC, Quatresooz P ... The biologic half-life of LH is 20 minutes, shorter than that of FSH (3-4 hours) and hCG (24 hours).[citation needed] The ... doi:10.1016/S0015-0282(97)00501-3. PMID 9496327.. *^ Bowen R (13 May 2004). "Gonadotropins: Luteinizing and Follicle ...
Herbst EA, MacPherson RE, LeBlanc PJ, Roy BD, Jeoung NH, Harris RA, Peters SJ (Jan 2014). "Pyruvate dehydrogenase kinase-4 ... Due to this, alcohol sulfotransferase is also known by several other names including "hydroxysteroid sulfotransferase," " ... "Regulation of the human hydroxysteroid sulfotransferase (SULT2A1) by RORα and RORγ and its potential relevance to human liver ... and the regulation of pyruvate dehydrogenase (PDH), which converts pyruvate to acetyl CoA. Transferases are also utilized ...
978-1-4757-2085-3. .. *^ a b c d e Index Nominum 2000: International Drug Directory. Taylor & Francis. January 2000. pp. 749-. ... 8 Suppl 1: 3-63. doi:10.1080/13697130500148875. PMID 16112947.. *^ a b c d Taitel HF, Kafrissen ME (1995). "Norethindrone--a ... 978-3-642-99941-3. .. *^ a b Schoonen WG, Deckers GH, de Gooijer ME, de Ries R, Kloosterboer HJ (2000). "Hormonal properties of ... 3. 0. 0. ?. ? Notes: Values are percentages (%). Reference ligands (100%) were promegestone for the PR, metribolone for the AR ...
... in vitro induction of 20 alpha-hydroxysteroid dehydrogenase in splenic lymphocytes from athymic mice by a unique lymphokine, in ... 3-10, DOI:10.1016/0092-8674(86)90360-0, PMID 3489530.. * Le Beau MM, Epstein ND, O'Brien SJ, et al., The interleukin 3 gene is ... 3-10, DOI:10.1016/0092-8674(86)90360-0, PMID 3489530.. *^ Ihle JN, Pepersack L, Rebar L, Regulation of T cell differentiation: ... L'interleuchina 3, conosciuta anche come IL3, è una proteina codificata dal gene umano IL3[1][2]. ...
17β-hydroxysteroid dehydrogenase deficiency. *aromatase excess syndrome. *Androgen receptor (Androgen insensitivity syndrome) ... ACE inhibitors[3]. Diabetic nephropathy(DN), also known as diabetic kidney disease,[4] is the chronic loss of kidney function ... 11 (3): 105-7. PMC 2658722. PMID 19582202.. *^ Gross JL, de Azevedo MJ, Silveiro SP, Canani LH, Caramori ML, Zelmanovitz T ( ... January 2012). Chronic Kidney Disease Stages 1-3: Screening, Monitoring, and Treatment [Internet]. Agency for Healthcare ...
17β-hydroxysteroid dehydrogenase deficiency. *aromatase excess syndrome. *Androgen receptor (Androgen insensitivity syndrome) ... 27 (3): 257-68. doi:10.1055/s-2007-979681. PMID 17577867.. *^ a b c d e de Herder WW, van der Lely AJ (May 2003). "Addisonian ... ISBN 978-3-13-135052-7.. *^ a b Adams CB (2003). "The surgery of pituitary tumours". In Wass JA, Shalet SM. Oxford Textbook of ... 294-5. ISBN 978-0-7216-9514-3.. *^ Post KD, Shiau JS, Walsh J (2008). "Pituitary apoplexy". In Loftus CM. Neurosurgical ...
17β-hydroxysteroid dehydrogenase deficiency. *aromatase excess syndrome. *Androgen receptor (Androgen insensitivity syndrome) ... It is rare for individuals affected by primordial dwarfism to live past the age of 30.[3] In the case of microcephalic ... They will not reach the size of an average newborn until they are between the ages of 3 and 5.. ... Most individuals with primordial dwarfism are not diagnosed until they are about 3-5 years of age. ...
Formation of threohydrobupropion from bupropion is dependent on 11β-hydroxysteroid dehydrogenase 1. „Drug metabolism and ... ISBN 978-0-470-97969-3. *↑ NicoleN. White NicoleN., TobyT. Litovitz TobyT., CathleenC. Clancy CathleenC., Suicidal ... ISBN 978-0-9805790-9-3. *↑ a b c Joint Formulary Committee: British National Formulary (BNF). Wyd. 65. London, UK: ... Figure 3-4. Abuse potential of common psychiatric medications. W: Substance abuse treatment for persons with HIV/AIDS. ...
Phosphogluconate dehydrogenase. *Sorbitol dehydrogenase. *Hydroxysteroid dehydrogenase: 3β *3β-HSD. *NSDHL ... carnitine+dehydrogenase at the US National Library of Medicine Medical Subject Headings (MeSH) ... "Kinetic studies of the reaction mechanism of carnitine dehydrogenase of Pseudomonas aeruginosa]. Eur. J. Biochem. (in German). ... Purification and properties of carnitine dehydrogenase from Pseudomonas aeruginosa]. Eur. J. Biochem. (in German). 6 (2): 196- ...
17β-Hydroxysteroid dehydrogenase III deficiency. *DiGeorge syndrome. *22q11.2 distal deletion syndrome ...
... placental 17β-hydroxysteroid dehydrogenase interconverts estrone and estradiol and the two hormones are secreted into the ... 978-81-8147-844-3. .. *^ a b c d e f g h i j k l m Strauss JF, Barbieri RL (13 September 2013). Yen and Jaffe's Reproductive ... which is subsequently converted into estriol by 17β-hydroxysteroid dehydrogenase and then secreted predominantly into the ... 978-0-08-048836-3. .. *^ a b c d Roger Smith (Prof.) (1 January 2001). The Endocrinology of Parturition: Basic Science and ...
17β-hydroxysteroid dehydrogenase deficiency. *aromatase excess syndrome. *Androgen receptor (Androgen insensitivity syndrome) ... doi:10.1007/s11934-014-0440-3. PMID 25118849.. *^ a b c d "Sexual Dysfunction in Women". Diabetes.co.uk. Diabetes Digital Media ... 3 (2): 170-176. doi:10.1007/s40124-015-0083-y.. *^ "Stress". www.diabetes.org. American Diabetes Association. Archived from the ... and GlaxoSmithKline (GSK) Announce Phase 3 Defend-1 Study of Otelixizumab in Type 1 Diabetes Did Not Meet Its Primary Endpoint" ...
Zheng F (2010). "Methyltrienolone (R1881) is a Potent Inhibitor of 3B-Hydroxysteroid Dehydrogenase (3B-HSD) Activity". ... 8S,13S,14S,17S)-17-hydroxy-13,17-dimethyl-1,2,6,7,8,14,15,16-octahydrocyclopenta[a]phenanthren-3-one ... InChI=1S/C19H24O2/c1-18-9-7-15-14-6-4-13(20)11-12(14)3-5-16(15)17(18)8-10-19(18,2)21/h7,9,11,16-17,21H,3-6,8,10H2,1-2H3/t16-, ... 3β-HSD) 1 and 2 (IC50 = 0.02 and 0.16 μM, respectively).[8] On the basis of this finding, it has been said that metribolone ...
Phosphogluconate dehydrogenase. *Sorbitol dehydrogenase. *Hydroxysteroid dehydrogenase: 3β *3β-HSD. *NSDHL ... 3R)-3-hydroxyacyl-[acyl-carrier-protein] + NADP+ ⇌. {\displaystyle \rightleftharpoons }. 3-oxoacyl-[acyl-carrier-protein] + ... The systematic name of this enzyme class is (3R)-3-hydroxyacyl-[acyl-carrier-protein]:NADP+ oxidoreductase. Other names in ... In enzymology, a 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) is an enzyme that catalyzes the chemical reaction ...
Marcus, P.I. & Talalay, P. (1956). „Induction and purification of α- and β-hydroxysteroid dehydrogenases". J. Biol. Chem. 218: ... B enzm: 1.1/2/3/4/5/6/7/8/10/11/13/14/15-18, 2.1/2/3/4/5/6/7/8, 2.7.10, 2.7.11-12, 3.1/2/3/4/5/6/7, 3.1.3.48, 3.4.21/22/23/24, ... Talalay, P. & Dobson, M.M. (1953). „Purification and properties of a α-hydroxysteroid dehydrogenase". J. Biol. Chem. 205: 823- ... β-Hydroxysteroid dehydrogenase of Pseudomonas testosteroni. A convenient purification and demonstration of multiple molecular ...
... which is subsequently converted to estradiol via 17β-hydroxysteroid dehydrogenase (17β-HSD).[46] ... ISBN 978-3-8047-1763-3.. *^ a b c d Shlomo Melmed (1 January 2016). Williams Textbook of Endocrinology. Elsevier Health ... 8 Suppl 1: 3-63. doi:10.1080/13697130500148875. PMID 16112947.. *^ a b c Loriaux DL, Loriaux L (14 March 2016). A Biographical ... 1 (3): 6-12. ISSN 1727-0669.. *^ a b Kuhl H (August 2005). "Pharmacology of estrogens and progestogens: influence of different ...
3-Hydroxysteroid dehydrogenase (3-HSD) may refer to: 3α-Hydroxysteroid dehydrogenase (3α-HSD) 3β-Hydroxysteroid dehydrogenase ( ... 3β-HSD) This set index page lists enzyme articles associated with the same name. If an internal link led you here, you may wish ...
Neville AM, Orr JC, Engel LL (1968). "Delta5-3beta-Hydroxy steroid dehydrogenase activities of bovine adrenal cortex". Biochem ... "Molecular biology of the 3beta-hydroxysteroid dehydrogenase/delta5-delta4 isomerase gene family". Endocr. Rev. 26 (4): 525-82. ... ene steroid dehydrogenase 3β-hydroxy steroid dehydrogenase/isomerase 3β-hydroxy-Δ5-C27-steroid dehydrogenase/isomerase 3β- ... 3β-HSD is also known as delta Δ5-4-isomerase, which catalyzes the oxidative conversion of Δ5-3β-hydroxysteroids to the Δ4-3- ...
... hydroxysteroid dehydrogenase (HSD) deficiency is an inherited disorder that affects hormone-producing glands including the ... A novel nonstop mutation in the stop codon and a novel missense mutation in the type II 3beta-hydroxysteroid dehydrogenase ( ... Carriers for type II 3beta-hydroxysteroid dehydrogenase (HSD3B2) deficiency can only be identified by HSD3B2 genotype study and ... Simard J, Moisan AM, Morel Y. Congenital adrenal hyperplasia due to 3beta-hydroxysteroid dehydrogenase/Delta(5)-Delta(4) ...
cheers, : , ,Max Youll find a lot of information if you search medline with the words : short-chain dehydrogenases. In 1995 ... I would appreciate any leads to literature that cover the structure, : , ,function, kinetics and recent development on 3-beta ... Info required on 3-beta-hydroxy steroid dehydrogenase. Lluis Ribas lluis at aars.mit.edu Thu Sep 26 10:06:28 EST 1996 *Previous ...
The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids. HSD V can only ... Exhibits only 3-ketosteroid reductase activity in the presence of NADPH and does not function as an isomerase. ... steroid dehydrogenase activity Source: RGD ,p>Traceable Author Statement,/p> ,p>Used for information from review articles where ... 3 beta-hydroxysteroid dehydrogenase type 5Add BLAST. 373. Amino acid modifications. Feature key. Position(s). Description ...
"Newly proposed hormonal criteria via genotypic proof for type II 3beta-hydroxysteroid dehydrogenase deficiency". J. Clin. ... 21 (3): 245-91. doi:10.1210/edrv.21.3.0398. PMID 10857554.. *↑ Hohl A, Ronsoni MF, Oliveira M (2014). "Hirsutism: diagnosis and ... "3-beta-hydroxysteroid dehydrogenase deficiency - Genetics Home Reference".. *↑ Simard J, Rheaume E, Mebarki F, Sanchez R, New ... 3 beta-hydroxysteroid dehydrogenase deficiency must be differentiated from diseases that cause ambiguous genitalia:[2][3] ...
3β-HSD is often associated with steroidogenesis, but its function in the metabolism of both steroids and xenobiotics is more ... 3β-HSD is involved in the synthesis of a number of natural steroid hormones, including progesterone and testosterone, and the ... Much of the research conducted on porcine 3β-HSD is motivated by its importance for the occurrence of the boar taint phenomenon ... This review focuses on the expression and regulation of 3β-hydroxysteroid dehydrogenase/Δ5-Δ4 isomerase (3β-HSD), with emphasis ...
At the core of this process is the placental enzyme 11β-hydroxysteroid dehydrogenase type 2 (11β-HSD2), an enzyme that is ... P. He, Z. Chen, Q. Sun, Y. Li, H. Gu, and X. Ni, "Reduced expression of 11β-hydroxysteroid dehydrogenase type 2 in preeclamptic ... W. Hu, X. Weng, M. Dong, Y. Liu, W. Li, and H. Huang, "Alteration in methylation level at 11β-hydroxysteroid dehydrogenase type ... C. J. Peña, C. Monk, and F. A. Champagne, "Epigenetic effects of prenatal stress on 11β-hydroxysteroid dehydrogenase-2 in the ...
... and 17β-hydroxysteroid dehydrogenase-3 deficiency (17β-HSD-3) are often raised as girls. Over the past number of years, this ... Individuals with 5α-reductase-2 deficiency (5α-RD-2) and 17β-hydroxysteroid dehydrogenase-3 deficiency (17β-HSD-3) are often ... Rösler, A., Silverstein, S., & Abeliovich, D. (1996). A (R80Q) mutation in 17 β-hydroxysteroid dehydrogenase type 3 gene among ... Gender Change in 46,XY Persons with 5α-Reductase-2 Deficiency and 17β-Hydroxysteroid Dehydrogenase-3 Deficiency. ...
Oxidation and isomerization of 3β-hydroxysterols to 4-en-3-ones is requisite for sterol … ... Inhibition of the M. tuberculosis 3β-hydroxysteroid dehydrogenase by azasteroids Bioorg Med Chem Lett. 2011 Apr 15;21(8):2216-9 ... Oxidation and isomerization of 3β-hydroxysterols to 4-en-3-ones is requisite for sterol metabolism and the reaction is ... tb 3β-hydroxysteroid dehydrogenase. 6-Azasteroids with large, hydrophobic side chains at the C17 position are the most ...
3alpha-hydroxy steroid, type 2 3alpha-hydroxysteroid dehydrogenase/type 5 17beta-hydroxysteroid dehydrogenase, type 3 3alpha- ... 3alpha-hydroxysteroid dehydrogenase, 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase, 3alpha-hydroxysteroid oxido- ... hydroxyprostaglandin dehydrogenase, More, NAD(P)+-3alpha-hydroxysteroid dehydrogenase, NAD+-dependent 3alpha-HSD, NADP(H)- ... 3alpha/3beta-hydroxysteroid dehydrogenase, 3alphaHSD, 3HSD, 5alpha-dihydroprogesterone 3alpha-hydroxysteroid oxidoreductase, ...
... see under 17-HYDROXYSTEROID DEHYDROGENASES (85-90); on-line search 17-HYDROXYSTEROID DEHYDROGENASES (85-93), Index Medicus ... beta-hydroxysteroid dehydrogenase: acts on both 3 beta or 17 beta hydroxysteroids; 17 beta type 1 is probably ESTRADIOL ... DEHYDROGENASES; for 3 or 17 alpha-hydroxysteroids see EC 1.1.1.209; was mapped to TESTOSTERONE DEHYDRONGENASES (85-93) ( ... Hydroxysteroid Dehydrogenases: 6*17-Hydroxysteroid Dehydrogenases: 4*3 (or 17)-beta-hydroxysteroid dehydrogenase: 145 ...
Expected to use NAD(+) as preferred electron donor for the 3-beta-hydroxy-steroid dehydrogenase activity and NADPH for the 3- ... Additionally, catalyzes the interconversion between 3beta-hydroxy and 3-oxo-5alpha-androstane steroids controlling the ... steroid precursors to 3-oxo-Delta(4)-steroids, an essential step in steroid hormone biosynthesis. Specifically catalyzes the ... 5alpha-androstane-3beta,17beta-diol dehydrogenase activity Source: UniProtKB-EC. *cholesterol dehydrogenase activity Source: ...
3β-hydroxysteroid dehydrogenase type 2 deficiency (3βHSD2D) is a very rare variant of congenital adrenal hyperplasia (CAH) ... 3βHSD2D is caused by HSD3B2 gene mutations and characterized by impaired steroid synthesis in the gonads and the adrenal glands ... 3β-hydroxysteroid dehydrogenase type 2 deficiency (3βHSD2D) is a very rare variant of congenital adrenal hyperplasia (CAH) ... Clinical perspectives in congenital adrenal hyperplasia due to 3β-hydroxysteroid dehydrogenase type 2 deficiency. February 17, ...
Crystal structure of human type III 3alpha-hydroxysteroid dehydrogenase/bile acid binding protein complexed with NADP(+) and ... 3] Andreeva A., Howorth D., Chandonia J.-M., Brenner S.E., Hubbard T.J.P., Chothia C., Murzin A.G. (2008).. Data growth and its ... Description: 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE protein , Length: 323 No structure alignment results are available for 1IHI.A ... If available, the SCOP 1.75 domain assignment [3] is used. Otherwise algorithmic domain assignments are computed using the ...
... crystal structure of testosterone and NADP+ bound to 3 alpha-hydroxysteroid/dihydrodiol dehydrogenase. ... 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE protein, length: 323 (BLAST) Sequence Similarity Cutoff. Rank. Chains in Cluster. Cluster ... RECOMBINANT RAT LIVER 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE (3-ALPHA-HSD) COMPLEXED WITH NADP AND TESTOSTERONE. ...
... is identified with human liver dihydrodiol dehydrogenase isoform 1 that exhibits high 20α-hydroxysteroid dehydrogenase and very ... hydroxysteroid dehydrogenase from human prostatic cytosol. J Steroid Biochem Mol Biol 42:321-327. ... Lineweaver-Burk analysis of the dual effects of clofibric acid on the dehydrogenase activity of AKR 1C4. In A and B, the ... 1990) Purification and properties of multiple forms of dihydrodiol dehydrogenase from human liver. J Biochem (Tokyo) 108:250- ...
3-alpha hydroxysteroid dehydrogenase, type II)), Authors: Hsueh Kung Lin. Published in: Atlas Genet Cytogenet Oncol Haematol. ... Increased expression of type 2 3alpha-hydroxysteroid dehydrogenase/type 5 17beta-hydroxysteroid dehydrogenase (AKR1C3) and its ... Localization of type 5 17beta-hydroxysteroid dehydrogenase, 3beta-hydroxysteroid dehydrogenase, and androgen receptor in the ... Immunoelectron microscopic localization of 3beta-hydroxysteroid dehydrogenase and type 5 17beta-hydroxysteroid dehydrogenase in ...
Read about 3 beta hydroxysteroid dehydrogenase deficiency medical facts: what is the definition of 3 beta hydroxysteroid ... Read about 3 beta hydroxysteroid dehydrogenase deficiency medical facts: what is the definition of 3 beta hydroxysteroid ... dehydrogenase deficiency, pathophysiology, medical care, frequency, mortality or morbidity, and related 3 beta hydroxysteroid ... dehydrogenase deficiency, pathophysiology, medical care, frequency, mortality or morbidity, and related 3 beta hydroxysteroid ...
Human dihydrodiol dehydrogenase with 3α-hydroxysteroid dehydrogenase activity exists in four forms (AKR1C1Ő1C4) that belong to ... The two mutations decreased 3-fold the Km for NADP+ and differently influenced the Km and kcat for substrates depending on ... Tatuya OHTA, Syuhei ISHIKURA, Syunichi SHINTANI, Noriyuki USAMI, Akira HARA; Kinetic alteration of a human dihydrodiol/3α- ... hydroxysteroid dehydrogenase isoenzyme, AKR1C4, by replacement of histidine-216 with tyrosine or phenylalanine. Biochem J 15 ...
Whereas AKR1C2 acted as a 3α-HSD toward 5α-DHT, it functioned exclusively as a 3β-HSD on tibolone. Furthermore, strong ... The preference for AKR1C1 and AKR1C2 to form 3β-hydroxytibolone, and the preference of the liver-specific AKR1C4 to form 3α- ... Human aldo-keto reductase (AKR)1C isoforms have been shown to act as 3α/3β-hydroxysteroid dehydrogenases (HSDs) on 5α- ... However, because of potent inhibition of this activity by NADPH, AKR1Cs will probably act only as 3-ketosteroid reductases in ...
The enzyme 3beta/17beta-hydroxysteroid dehydrogenase (3beta/17beta-HSD) is a steroid-inducible component of the Gram-negative ... The active site contains a Ser-Tyr-Lys triad, typical for short-chain dehydrogenases/reductases (SDR). Despite their highly ... Structure of bacterial 3 beta/17 beta-hydroxysteroid dehydrogenase at 1.2 angstrom resolution: A model for multiple steroid ... It catalyzes the reversible reduction/ dehydrogenation of the oxo/beta-hydroxy groups at positions 3 and 17 of steroid ...
... Common Name(s). 17-Beta hydroxysteroid dehydrogenase 3 deficiency, 17-Beta ... 17-beta hydroxysteroid dehydrogenase 3 deficiency is caused by mutations in the HSD17B3 gene and is inherited in an autosomal ... 17-beta hydroxysteroid dehydrogenase 3 deficiencyis an inherited condition that affects male sexual development. People with ... Please click this link to visit the PubMed website for results on "17-Beta hydroxysteroid dehydrogenase 3 deficiency". ...
... the enzyme 3 beta-hydroxysteroid dehydrogenase (HSD) is distributed between microsomes and mitochondria. Throughout the ... Thomas JL, Mason JI, Blanco G, Veisaga ML: The engineered, cytosolic form of human type I β-hydroxysteroid dehydrogenase/ ... The enzymes that catalyze the latter reaction are NADP+-linked isocitrate dehydrogenase and NADP+-linked malate dehydrogenase. ... The role of nicotinamide-adenine dinucleotide phosphate-dependent malate dehydrogenase and isocitrate dehydrogenase in the ...
CONCURRENT 3-BETA-HYDROXYSTEROID DEHYDROGENASE DEFICIENCY IN ADRENAL AND SCLEROCYSTIC OVARY.. L R AXELROD, J W GOLDZIEHER, S D ... Steroid 3-beta hydroxysteroid dehydrogenase type II (3β-HSD2) deficiency is a rare autosomal recessive form of congenital ... 3 beta-hydroxysteroid dehydrogenase deficiency is a disorder of steroid biosynthesis resulting in decreased production of all 3 ... The structures of the highly homologous type I and II 3 beta-HSD genes have been analyzed in three male pseudohermaphrodite 3 ...
3 beta-hydroxysteroid dehydrogenase/Delta 54-isomerase type 2 (HSD3B2) Recombinant Protein-NP_000189.1 (MBS7016797) product ... hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2 ... steroid dehydrogenase (EC:1.1.1.145)Alternative name(s):3-beta-hydroxy-5-ene steroid dehydrogenase; Progesterone reductase. ... 3 beta-hydroxysteroid dehydrogenase/Delta 5--,4-isomerase type 2 UniProt Protein Name 3 beta-hydroxysteroid dehydrogenase/Delta ...
Zoller, L. C., & Weisz, J. (1979). A quantitative cytochemical study of glucose-6-phosphate dehydrogenase and Δ5-3 β- ... hydroxysteroid dehydrogenase activity in the Membrana granulosa of the ovulable type of follicle of the rat. Histochemistry, 62 ... Zoller, LC & Weisz, J 1979, A quantitative cytochemical study of glucose-6-phosphate dehydrogenase and Δ5-3 β-hydroxysteroid ... A quantitative cytochemical study of glucose-6-phosphate dehydrogenase and Δ5-3 β-hydroxysteroid dehydrogenase activity in the ...
About 30% of the total 3 beta HSD/I was found to remain tightly associated with highly purified mitochondrial preparations. The ... In the present study, the distribution of 3 beta HSD/I in bovine adrenocortical subcellular preparations has been reexamined, ... Examination of submitochondrial preparations revealed that 3 beta HSD/I was associated with both the inner membrane and a ... The enzymatic activity of 3 beta-hydroxysteroid dehydrogenase (3 beta HSD/I) constitutes an essential step in the biosynthesis ...
Devgan, S.A.,Reichardt, J.K.V.,Henderson, B.E.,Yu, M.C.,Pike, M.C.,Ross, R.K.,Shi, C.-Y. (1997). Genetic variation of 3β- ... hydroxysteroid dehydrogenase type II in three racial/ethnic groups: Implications for prostate cancer risk. Prostate 33 (1) : 9- ... Genetic variation of 3β-hydroxysteroid dehydrogenase type II in three racial/ethnic groups: Implications for prostate cancer ...
Paracrine interactions between adipose fibroblasts and malignant epithelial cells are essential for structural and hormonal support of breast tumors. Factors derived from malignant epithelial cells inhibit adipogenic ...
  • 3 beta-hydroxysteroid dehydrogenase deficiency is a rare disease due to congenital adrenal hyperplasia . (wikidoc.org)
  • Clinical perspectives in congenital adrenal hyperplasia due to 3β-hydroxysteroid dehydrogenase type 2 deficiency. (urotoday.com)
  • 3β-hydroxysteroid dehydrogenase type 2 deficiency (3βHSD2D) is a very rare variant of congenital adrenal hyperplasia (CAH) causing less than 0.5% of all CAH. (urotoday.com)
  • Uniparental Isodisomy of Chromosome 1 Unmasking an Autosomal Recessive 3-Beta Hydroxysteroid Dehydrogenase Type II-Related Congenital Adrenal Hyperplasia. (readbyqxmd.com)
  • Steroid 3-beta hydroxysteroid dehydrogenase type II (3β-HSD2) deficiency is a rare autosomal recessive form of congenital adrenal hyperplasia (CAH). (readbyqxmd.com)
  • 3-beta-hydroxysteroid dehydrogenase (3BHSD) deficiency is a form of congenital adrenal hyperplasia , a group of conditions that interfere with the body's ability to make hormones . (cdc.gov)
  • Background: 3-beta-hydroxysteroid dehydrogenase deficiency is a rare type of congenital adrenal hyperplasia that impairs steroidegenesia. (journalcra.com)
  • Results: Four Saudi patients, three from one family, were diagnosed with 3--hydroxysteroid dehydrogenase deficiency, among 95 (4.2%) patients with congenital adrenal hyperplasia. (journalcra.com)
  • Conclusion: Although rare, 3-beta-hydroxysteroid dehydrogenase deficiency congenital adrenal hyperplasia, should be considered in the 46XY individuals presenting with ambiguous genitalia, with or without salt-wasting, as well as a normal looking females with salt-wasting. (journalcra.com)
  • Testosterone metabolism in peripheral nerves: presence of the 5 alpha-reductase-3 alpha-hydroxysteroid-dehydrogenase enzymatic system in the sciatic nerve of adult and aged rats / R. C. Melcangi, F. Celotti, M. Ballabio, A. Poletti, L. Martini. (unimi.it)
  • This enzyme binds bile acid with high affinity, and shows minimal 3-alpha-hydroxysteroid dehydrogenase activity. (nih.gov)
  • Human 3-alpha hydroxysteroid dehydrogenase type 3 (3α-HSD3): the V54L mutation restricting the steroid alternative binding and enhancing the 20α-HSD activity. (nih.gov)
  • EC 1.1.1.209 3(or 17)alpha-hydroxysteroid dehydrogenase. (genome.jp)
  • Prostaglandin dehydrogenase activity of purified rat liver 3 alpha-hydroxysteroid dehydrogenase. (genome.jp)
  • 3β-Hydroxysteroid dehydrogenase/Δ5-4 isomerase (3β-HSD) (EC 1.1.1.145) is an enzyme that catalyzes the biosynthesis of the steroid progesterone from pregnenolone, 17α-hydroxyprogesterone from 17α-hydroxypregnenolone, and androstenedione from dehydroepiandrosterone (DHEA) in the adrenal gland. (wikipedia.org)
  • 3β-HSD is also known as delta Δ5-4-isomerase, which catalyzes the oxidative conversion of Δ5-3β-hydroxysteroids to the Δ4-3-keto configuration and is, therefore, essential for the biosynthesis of all classes of hormonal steroids, namely progesterone, glucocorticoids, mineralocorticoids, androgens, and estrogens. (wikipedia.org)
  • Exhibits only 3-ketosteroid reductase activity in the presence of NADPH and does not function as an isomerase. (uniprot.org)
  • The 3β-hydroxysteroid dehydrogenase/Δ 5 - Δ 4 isomerase (3β-HSD) and 17α-hydroxylase/17,20- lyase cytochrome P450 (P450c17) enzymes are important in determining the balance of the synthesis of different steroids such as progesterone (P4), glucocorticoids, androgens, and estrogens. (elsevier.com)
  • Therefore, in the present study, we examined the enzymatic activity and localization of 3β-hydroxysteroid dehydrogenase/Δ 5 -Δ 4 -isomerase (3βHSD), a key steroidogenic enzyme, in the CNS of adult male zebrafish to clarify central progesterone biosynthesis. (elsevier.com)
  • Sakamoto, H , Ukena, K & Tsutsui, K 2001, ' Activity and localization of 3β-hydroxysteroid dehydrogenase/δ 5 -δ 4 -isomerase in the zebrafish central nervous system ', Journal of Comparative Neurology , vol. 439, no. 3, pp. 291-305. (elsevier.com)
  • The type 1 isoform is a high-affinity dehydrogenase/isomerase expressed in adrenal and male kidney. (elsevier.com)
  • HSD3B1 (Hydroxy-Delta-5-Steroid Dehydrogenase, 3 Beta- And Steroid Delta-Isomerase 1) is a Protein Coding gene. (genecards.org)
  • Steroid degradation genes in Comamonas testosteroni TA441: Isolation of genes encoding a Delta4(5)-isomerase and 3alpha- and 3beta-dehydrogenases and evidence for a 100 kb steroid degradation gene hot spot. (genome.jp)
  • These findings have suggested that this enzyme also acts as prostaglandin oxidoreductase, carbonyl reductase, dihydrodiol dehydrogenase and bile acid-binding protein in the tissue. (aspetjournals.org)
  • Human dihydrodiol dehydrogenase with 3α-hydroxysteroid dehydrogenase activity exists in four forms (AKR1C1Ő1C4) that belong to the aldoŐketo reductase (AKR) family. (portlandpress.com)
  • Steroid recognition and regulation of hormone action: crystal structure of testosterone and NADP+ bound to 3 alpha-hydroxysteroid/dihydrodiol dehydrogenase. (expasy.org)
  • Proteomics-based identification of secreted protein dihydrodiol dehydrogenase 2 as a potential biomarker for predicting cisplatin efficacy in advanced NSCLC patients. (nih.gov)
  • Our structure-activity studies indicate that the 6-aza version of cholesterol is the best and tightest binding competitive inhibitor (K(i)=100 nM) of the steroid substrate and are consistent with cholesterol being the preferred substrate of M. tb 3β-hydroxysteroid dehydrogenase. (nih.gov)
  • The protein expressed in bacteria was highly active in androsterone reduction in the presence of NAD as cofactor, and this activity was inhibited by indomethacin, a potent inhibitor of 3αHSD. (elsevier.com)
  • This conversion was significantly reduced by trilostane, a specific inhibitor of 3βHSD. (elsevier.com)
  • [3] [12] Danazol has a complex mechanism of action , and is characterized as a weak androgen and anabolic steroid , a weak progestogen , a weak antigonadotropin , a weak steroidogenesis inhibitor , and a functional antiestrogen . (wikipedia.org)
  • Pretreatment of rats with the antiandrogen cyproterone acetate (5 mg/rat) or the protein synthesis inhibitor cycloheximide (10 mg/rat) did not affect the enzyme activity of testes injected with DMSO, but counteracted the inhibitory effect of DHT on 3-beta-HSD activity in the contralateral testis. (ulpgc.es)
  • In the present experiments, Strogen Forte proved to be a direct inhibitor with medium effectivity and it exerted similar IC 50 parameters of inhibition for both rat testicular Δ 5 -3β-HSD (400 ± 23 μ/ml) and human testicular Δ 5 -3β-HSD (212 ± 8.6 μ/ml), This study indicates a novel mechanism of antiandrogenic effect of Strogen Forte. (elsevier.com)
  • STX2171, a 17β-hydroxysteroid dehydrogenase type 3 inhibitor, is efficacious in vivo in a novel hormone-dependent prostate cancer model. (ox.ac.uk)
  • Trilostane is an inhibitor of 3β-hydroxysteroid dehydrogenase used in the treatment of Cushing's syndrome. (selleckchem.com)
  • The systematic name of this enzyme class is 3β-hydroxy-Δ5-steroid:NAD+ 3-oxidoreductase. (wikipedia.org)
  • GO annotations related to this gene include oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor and 3-beta-hydroxy-delta5-steroid dehydrogenase activity . (genecards.org)
  • The database was screened using pharmacophores of 17beta-hydroxysteroid dehydrogenase type 3 (17beta-HSD3), which catalyzes the last step of testosterone synthesis in testicular Leydig cells and plays an essential role during male sexual development. (unibas.ch)
  • Development of hormone-dependent prostate cancer models for the evaluation of inhibitors of 17beta-hydroxysteroid dehydrogenase type 3. (ox.ac.uk)
  • SDR42E1 (Short Chain Dehydrogenase/Reductase Family 42E, Member 1) is a Protein Coding gene. (genecards.org)
  • Max You'll find a lot of information if you search medline with the words : short-chain dehydrogenases. (bio.net)
  • The active site contains a Ser-Tyr-Lys triad, typical for short-chain dehydrogenases/reductases (SDR). (diva-portal.org)
  • Belongs to the short-chain dehydrogenases/reductases (SDR) family. (abcam.com)
  • The 3β-HSD complex is responsible for the conversion of: Pregnenolone to progesterone 17α-Hydroxypregnenolone to 17α-hydroxyprogesterone DHEA to androstenedione Androstenediol to testosterone Androstadienol to androstadienone 3β-HSD belongs to the family of oxidoreductases, to be specific, those acting on the CH-OH group with NAD+ or NADP+ as acceptor. (wikipedia.org)
  • The enzymatic activity of 3 beta-hydroxysteroid dehydrogenase (3 beta HSD/I) constitutes an essential step in the biosynthesis of active steroid hormones such as progesterone, mineralo- and gluco-corticoids, estrogens, and androgens. (semanticscholar.org)
  • To determine if these changes in P levels are related to steroidogenic enzyme expression, the enzymes converting cholesterol to pregnenolone (P450SCC) and then to progesterone (3 -HSD) were detected by immunohistochemistry in macaque luteal tissue throughout the menstrual cycle and simulated early pregnancy. (grantome.com)
  • In both normal glandular and carcinomatous breast tissue, the concentrations of androstenedione (A), dehydroepiandrosterone (DHEA), 5 androstene-3 beta, 17 beta-diol (5-Adiol), estrone (E1), estradiol (E2) and progesterone (P) were significantly higher than plasma concentrations. (nih.gov)
  • Biochemical studies together with HPLC analysis revealed that the zebrafish brain converted pregnenolone to progesterone, suggesting the enzymatic activity of 3βHSD. (elsevier.com)
  • These results suggest that the fish CNS possesses steroidogenic enzyme 3βHSD and produces progesterone. (elsevier.com)
  • Instead, the fetus synthesizes cortisol from placental progesterone, bypassing the need for 3βHSD. (aappublications.org)
  • After delivery, placental progesterone is no longer available, and limited 3βHSD may reduce the extremely premature infant's ability to produce cortisol when needed during illness. (aappublications.org)
  • Efficiently catalyzes the transformation of pregnenolone to progesterone, 17-alpha-hydroxypregnenolone to 17-alpha-hydroxyprogesterone, DHEA to 4-androstenedione, dihydrotestosterone to 5-alpha-androstane-3 beta,17 beta-diol, dehydroepiandrosterone to androstenedione and 5-alpha-androstan-3 beta,17 beta-diol to 5-alpha-dihydrotestosterone. (genecards.org)
  • Mutations in the HSD3B2 gene cause 3β-HSD deficiency. (medlineplus.gov)
  • The HSD3B2 gene provides instructions for making the 3β-HSD enzyme. (medlineplus.gov)
  • 3 beta-hydroxysteroid dehydrogenase deficiency is caused by a mutation in the HSD3B2 gene . (wikidoc.org)
  • 3βHSD2D is caused by HSD3B2 gene mutations and characterized by impaired steroid synthesis in the gonads and the adrenal glands and subsequent increased dehydroepiandrosterone (DHEA) concentrations. (urotoday.com)
  • 17-beta hydroxysteroid dehydrogenase 3 deficiency is caused by mutations in the HSD17B3 gene and is inherited in an autosomal recessive pattern. (diseaseinfosearch.org)
  • The protein encoded by this gene is a bifunctional enzyme that catalyzes the oxidative conversion of delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. (mybiosource.com)
  • Mutations in this gene are associated with 3-beta-hydroxysteroid dehydrogenase, type II, deficiency. (mybiosource.com)
  • The predicted amino acid sequence of 3αHSD was related to sequences of several other enzymes, including bovine prostaglandin F synthase, human chlordecone reductase, human aldose reductase, human aldehyde reductase, and frog lens ∈-crystalline, suggesting that these proteins belong to the same gene family. (elsevier.com)
  • T mutation , both located within the intron 3 splice donor site of the HSD17B3 gene , were identified in case 3. (bvsalud.org)
  • T, ambas localizadas no sítio doador de splicing do íntron 3 do gene HSD17B3, foi identificada no caso 3. (bvsalud.org)
  • 3 The CYP17 gene encodes an enzyme that catalyzes both 17α-hydroxylation and 17,20-lyase reactions. (questdiagnostics.com)
  • The protein encoded by this gene is an enzyme that catalyzes the oxidative conversion of delta-5-3-beta-hydroxysteroid precursors into delta-4-ketosteroids, which leads to the production of all classes of steroid hormones. (genecards.org)
  • On the other hand, a T12S substitution yields a protein with unaltered catalytic constants for both reactions, revealing that a specific hydrogen bond is critical for the dehydrogenase activity. (ox.ac.uk)
  • The encoded protein also catalyzes the interconversion of 3-beta-hydroxy- and 3-keto-5-alpha-androstane steroids. (genecards.org)
  • Medroxyprogesterone acetate and medrogestone are weak inhibitors of 3β-HSD which may substantially inhibit it at high dosages. (wikipedia.org)
  • The mutation also yielded different changes in sensitivity to competitive inhibitors such as hexoestrol analogues, 17β-oestradiol, phenolphthalein and flufenamic acid and 3,5,3´,5´-tetraiodothyropropionic acid analogues. (portlandpress.com)
  • The inhibitory effect of 3-beta-HSD was not due to a possible interference of DHT in the enzyme assay, since various concentrations of the androgen (0.1-100-mu-mol/l) were ineffective as inhibitors of 3-beta-HSD. (ulpgc.es)
  • In addition, analyses of several commonly used UV-filters on estrogen- and androgen-metabolizing 17beta-HSD enzymes revealed 3-benzylidene camphor (3-BC) and 4-methylbenzylidene camphor (4-MBC) as low micromolar 17beta-HSD2 inhibitors. (unibas.ch)
  • 17β-HSD type 3 (17β-HSD3) catalyses the reduction of the weakly androgenic androstenedione (adione) to testosterone, suggesting that specific inhibitors of 17β-HSD3 may have a role in the treatment of hormone-dependent prostate cancer and benign prostate hyperplasia. (ox.ac.uk)
  • The amounts of testosterone and 11-KT were measured in incubation media after 24 h of exposure of testis explants at stage I-II or III to 100 ng/ml of rFsh and rLh, in the presence or absence of 5 uM of inhibitors of the cAMP/PKA pathway (MDL and H-89 respectively) and Hsd-3β (TRIL). (selleckchem.com)
  • AKR1C3 metabolizes various androgen metabolites including 5a-dihydrotestosterone to 5a-androstane-3a,17b-diol, Delta 4 -androstene-3,17-dione to testosterone, androstanedione to 5a-dihydrotestosterone, androsterone to 5a-androstane-3a,17b-diol. (atlasgeneticsoncology.org)
  • The enzyme 17β-hydroxysteroid dehydrogenase type 3 (17-β-HSD3) catalyzes the conversion of androstenedione to testosterone in the testes, and its deficiency is a rare disorder of sex development in 46,XY individuals. (diseaseinfosearch.org)
  • The enzyme 17β-hydroxysteroid-dehydrogenase type 3 (17βHSD3) is present almost exclusively in the testicles and converts Delta 4-androstenodione (Δ4) to testosterone. (bioscientifica.com)
  • 17 beta-hydroxysteroid dehydrogenase 3 deficiency consists of a defect in the last phase of steroidogenesis, in which androstenedione is converted into testosterone and estrone into estradiol. (usp.br)
  • Elevated LH of 24 mIU/L and FSH of 36 mIU/mL with elevated testosterone of 3 ng/mL (normal range for male, 2.4 8.3) were found. (eurospe.org)
  • To investigate (1) whether type 3 17beta-hydroxysteroid dehydrogenase (17beta-HSD), the enzyme which catalyzes the conversion of androstenedione to testosterone in the testis, is co-expressed with P450aromatase in the preadipocytes of women, and (2) whether the relative expression of type 3 17beta-HSD and aromatase varies in subcutaneous abdominal vs intra-abdominal adipose tissue of women. (edu.au)
  • Previous reports from this laboratory indicate that the 5 alpha-reductase, the enzyme which converts testosterone into its 'active' metabolite 5 alpha-androstan-17 beta-ol-3-one (dihydrotestosterone, DHT) is highly concentrated in the white matter structures of the CNS, which are mainly composed of myelinated fibers. (unimi.it)
  • Δ 5 -3β-hydroxysteroid dehydrogenase (Δ 5 -3β-HSD) is a key enzyme in the biosynthesis of biologically active steroid hormones and a major determinant of androgens (especially of testosterone) produced mainly by the testicles. (elsevier.com)
  • 17beta-HSD Type 3 (17beta-HSD3) has been seen to be over-expressed in prostate cancer, and catalyses the reduction of androstenedione (Adione) to testosterone (T), which stimulates prostate tumour growth. (ox.ac.uk)
  • StAR, P450scc and 3β-HSD expression in the Leydig cells of the testis were also higher during this season, as was serum testosterone. (scielo.cl)
  • In the developed testis, Leydig cells (LCs) maintain high levels of P450scc and 3β-HSD and, in response to luteinizing hormone (LH), rapidly synthesize StAR and testosterone [ 15 , 16 ]. (scielo.cl)
  • At about 1 week of age, gonadotropin and testosterone levels begin to rise to pubertal levels, peaking at age 1-3 months, and then decreasing to prepubertal levels by age 6 months. (medscape.com)
  • In humans, there are two 3β-HSD isozymes encoded by the HSD3B1 and HSD3B2 genes. (wikipedia.org)
  • 3 beta hydroxysteroid dehydrogenase deficiency definition: 3-Beta-hydroxysteroid dehydrogenase deficiency (3B HSD) is a very rare disorder of the genes involving steroid biosynthesis. (signssymptoms.org)
  • Using cDNA subtraction and differential screening, we identified 25 genes that were differentially expressed by 17α, 20β-dihydroxy-4-pregnen-3- one (DHP) stimulation. (elsevier.com)
  • The START domain of STARD1 is utilized by a family of genes, which includes additional STARD (forms 3-6) and GRAMD1B proteins that transfer CHOL. (frontiersin.org)
  • Three series of 6-azasteroids and 4-azasteroids were employed to define the substrate preferences of M. tb 3β-hydroxysteroid dehydrogenase. (nih.gov)
  • The model helps to understand the interplay between fluxes through the Δ 4 and Δ 5 pathways in this network, and how this determines the response of steroid synthesis to the variation in 3β-HSD activity or in the supply of the precursor substrate, pregnenolone (P5). (elsevier.com)
  • After TMB substrate solution is added, only those wells that contain 11-Beta-Hydroxysteroid Dehydrogenase Type 3 (HSD11b3), biotin-conjugated antibody and enzyme-conjugated Avidin will exhibit a change in color. (sinoprot.com)
  • 17beta-Hydroxysteroid dehydrogenases (17beta-HSDs) are responsible for the pre-receptor reduction/oxidation of steroids at the 17-position into active/inactive hormones, and the 15 known enzymes vary in their substrate specificity, localisation, and directional activity. (ox.ac.uk)
  • Features being engineered into these enzymes include (1) self-assembly into hydrogels, (2) alternate cofactor use, and (3) broader substrate specificity. (proteopedia.org)
  • AKR1C1 catalyzed exclusively the formation of 3β-hydroxytibolone, AKR1C3 showed weak 3β/3α-HSD activity, and AKR1C4 acted predominantly as a 3α-HSD. (aspetjournals.org)
  • The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids. (uniprot.org)
  • The pathogenesis of 3 beta-hydroxysteroid dehydrogenase deficiency is characterized by impaired pathway of biosynthesis of progestins , mineralocorticoids , glucocorticoids , and androgens . (wikidoc.org)
  • A bifunctional enzyme responsible for the oxidation and isomerization of 3beta-hydroxy-Delta 5 -steroid precursors to 3-oxo-Delta 4 -steroids, an essential step in steroid hormone biosynthesis. (uniprot.org)
  • 3 beta-hydroxysteroid dehydrogenase deficiency is a disorder of steroid biosynthesis resulting in decreased production of all 3 groups of adrenal steroids. (readbyqxmd.com)
  • Humans express two 3β-HSD isozymes, HSD3B1 (type I) and HSD3B2 (type II). (wikipedia.org)
  • abstract = "During the last four days of follicular development prior to ovulation, the activities of Δ5-3 β-hydroxysteroid dehydrogenase (3βOHD) and glucose-6-phosphate dehydrogenase (G-6-PD) were quantified in cryostat sections of the rat ovary. (elsevier.com)
  • abstract = "A method is described for preparing highly purified 3α- and 3β-hydroxysteroid dehydrogenases (EC 1.1.1.50 and EC 1.1.1.145, respectively), essentially uncontaminated with one another, from extracts of a steroid-induced Pseudomonas species. (elsevier.com)
  • This is an abbreviated version, for detailed information about 3alpha-hydroxysteroid 3-dehydrogenase (Si-specific), go to the full flat file . (brenda-enzymes.org)
  • EC 1.1.1.213 , 3alpha-hydroxysteroid 3-dehydrogenase (Re-specific). (genome.jp)
  • Clinical and molecular spectrum of patients with 17β-hydroxysteroid dehydrogenase type 3 (17-β-HSD3) deficiency. (diseaseinfosearch.org)
  • Introduction: Deficiency of 17β-hydroxysteroid dehydrogenase 3 (17β-HSD3) enzyme encoded by HSD17B3 is a rare cause of disorders of sex development (DSD). (eurospe.org)
  • A enzima 17β- hidroxiesteroide desidrogenase tipo 3 (17-β-HSD3) catalisa a conversão de androstenediona a testosterona nos testículos , e sua deficiência é uma forma rara de distúrbio do desenvolvimento do sexo em indivíduos 46,XY. (bvsalud.org)
  • 1996). Molecular genetics and pathophysiology of 17 β-hydroxysteroid dehydrogenase 3 deficiency. (springer.com)
  • Read about 3 beta hydroxysteroid dehydrogenase deficiency medical facts: what is the definition of 3 beta hydroxysteroid dehydrogenase deficiency, pathophysiology, medical care, frequency, mortality or morbidity, and related 3 beta hydroxysteroid dehydrogenase deficiency diseases. (signssymptoms.org)
  • Oxidation and isomerization of 3β-hydroxysterols to 4-en-3-ones is requisite for sterol metabolism and the reaction is catalyzed by 3β-hydroxysteroid dehydrogenase (Rv1106c). (nih.gov)
  • A decrease in 3β-HSD activity to a certain point can increase A4 synthesis by favouring metabolism through the Δ 5 pathway, though further decrease in 3β-HSD activity beyond that point eventually limits A4 synthesis. (elsevier.com)
  • 17β-Hydroxysteroid dehydrogenases ( 17β-HSD , HSD17B ) ( EC 1.1.1.51 ), also 17-ketosteroid reductases ( 17-KSR ), are a group of alcohol oxidoreductases which catalyze the reduction of 17-ketosteroids and the dehydrogenation of 17β-hydroxysteroids in steroidogenesis and steroid metabolism . (wikipedia.org)
  • Characterization of the 3 beta-hydroxysteroid dehydrogenase activity associated with bovine adrenocortical mitochondria. (semanticscholar.org)
  • Mutation of 3β-hydroxysteroid dehydrogenase (3β-HSD) at the 3'-untranslated region is associated with adrenocortical insufficiency. (semanticscholar.org)
  • OBJECTIVE: Deficient adrenocortical 3β-hydroxysteroid dehydrogenase activity has been reported in 5% to 30% of hyperandrogenic women. (elsevier.com)
  • The main hormonal changes observed in patients with 3βHSD2D are elevated ratios of the Δ5-steroids over Δ4-steroids but molecular genetic testing is recommended to confirm the diagnosis. (urotoday.com)
  • Molecular docking simulations using crystal structures of AKR1C1 and AKR1C2 explained why AKR1C2 inverted its stereospecificity from a 3α-HSD with 5α-DHT to a 3β-HSD with tibolone. (aspetjournals.org)
  • 3-beta-hydroxy-Delta 5 -steroid + NADP + = 3-oxo-Delta 5 -steroid + NADPH. (uniprot.org)
  • The NADP + -dependent dehydrogenase activity of a predominant isoenzyme of human liver 3α-hydroxysteroid dehydrogenase was activated by antihyperlipidemic drugs, such as bezafibrate and clinofibrate, and by clofibric acid and fenofibric acid (active metabolites of clofibrate and fenofibrate, respectively). (aspetjournals.org)
  • The two mutations decreased 3-fold the K m for NADP + and differently influenced the K m and k cat for substrates depending on their structures. (portlandpress.com)
  • However, because of potent inhibition of this activity by NADPH, AKR1Cs will probably act only as 3-ketosteroid reductases in vivo. (aspetjournals.org)
  • The highest dose of DHT used in this study (200-mu-g/100 g body weight) resulted in a rapid (1-2 h) and transient (4-6 h) inhibition (approximately 80%) of 3-beta-HSD activity. (ulpgc.es)
  • The type I isoenzyme is expressed in placenta and peripheral tissues, whereas the type II 3β-HSD isoenzyme is expressed in the adrenal gland, ovary, and testis. (wikipedia.org)
  • Symptoms of 3 beta-hydroxysteroid dehydrogenase deficiency may include symptoms of both cortisol and aldosterone deficiency such as feeding difficulties , vomiting , volume depletion , undervirilization in newborn males , and mild virilization and clitoromegaly in newborn female . (wikidoc.org)
  • Diagnosis for 3 beta-hydroxysteroid dehydrogenase deficiency is based on delta-5-17-hydroxypregnenolone high levels in serum laboratory tests. (wikidoc.org)
  • 3 beta-hydroxysteroid dehydrogenase deficiency was first time described in 1962, in a patient with ambiguous genitalia and salt wasting. (wikidoc.org)
  • Normally, this is prevented by the expression of an enzyme in the placenta called 11-beta hydroxysteroid dehydrogenase type 2 (11 β -HSD2) which converts active cortisol to its inactive metabolite cortisone. (hindawi.com)
  • Expected to use NAD + as preferred electron donor for the 3-beta-hydroxy-steroid dehydrogenase activity and NADPH for the 3-ketosteroid reductase activity. (uniprot.org)
  • 3-Beta-hydroxysteroid dehydrogenase is required to be able to synthesize all the three groups of adrenal steroids. (signssymptoms.org)
  • Patients with 3-Beta-hydroxysteroid dehydrogenase deficiency need replacement of glucocorticoids, sex steroids & mineralocorticoids. (signssymptoms.org)
  • It catalyzes the reversible reduction/ dehydrogenation of the oxo/beta-hydroxy groups at positions 3 and 17 of steroid compounds, including hormones and isobile acids. (diva-portal.org)
  • 17-beta hydroxysteroid dehydrogenase 3 deficiency is an inherited condition that affects male sexual development. (diseaseinfosearch.org)
  • Following organizations serve the condition "17-Beta hydroxysteroid dehydrogenase 3 deficiency" for support, advocacy or research. (diseaseinfosearch.org)
  • Finding the right clinical trial for 17-Beta hydroxysteroid dehydrogenase 3 deficiency can be challenging. (diseaseinfosearch.org)
  • The terms "17-Beta hydroxysteroid dehydrogenase 3 deficiency" returned 2 free, full-text research articles on human participants. (diseaseinfosearch.org)
  • Male pseudohermaphroditism due to 17 beta-hydroxysteroid dehydrogenase 3 deficiency. (diseaseinfosearch.org)
  • In mouse ovaries, the enzyme 3 beta-hydroxysteroid dehydrogenase (HSD) is distributed between microsomes and mitochondria. (biomedcentral.com)
  • however, 3 beta HSD/I activity is also present in mitochondrial preparations. (semanticscholar.org)
  • Connect with other caregivers and patients with 17-beta hydroxysteroid dehydrogenase 3 deficiency and get the support you need. (rareguru.com)
  • Below you will find more information about 3 beta hydroxysteroid dehydrogenase deficiency from Medigest. (medigest.uk)
  • If you believe that you are suffering from any of the symptoms of 3 beta hydroxysteroid dehydrogenase deficiency it is important that you obtain an accurate diagnosis from a medical professional to ensure that you obtain the correct medication or treatment for your condition. (medigest.uk)
  • There are medical conditions that carry similar symptoms associated with 3 beta hydroxysteroid dehydrogenase deficiency and therefore the information provided by Medigest is offered as a guideline only and should never be used in preference to seeking professional medical advice. (medigest.uk)
  • The information relating to 3 beta hydroxysteroid dehydrogenase deficiency comes from a third party source and Medigest will not be held liable for any inaccuracies relating to the information shown. (medigest.uk)
  • No significant cross-reactivity or interference between 11-Beta-Hydroxysteroid Dehydrogenase Type 3 and analogues was observed. (biomatik.com)
  • In a study of the origin of estrogens in patients with breast cancer, the concentrations of estrogens and their androgen precursors, and aromatase and 17 beta-hydroxysteroid dehydrogenase (E2DH) activities were determined in normal glandular and cancerous breast tissue. (nih.gov)
  • Is there any delta 5-3 beta hydroxysteroid dehydrogenase activity in preimplantation embryo of rhesus monkey? (bvsalud.org)
  • This is the first report on the histochemical assessment of delta 5- 3 beta hydroxysteroid dehydrogenase activity in all the preimplantation embryonic stages in the rhesus monkey ( Macaca mulatta ). (bvsalud.org)
  • Such marked non- specificity in the histochemical enzyme reaction for delta 5- 3 beta hydroxysteroid dehydrogenase activity was not found in mouse blastocysts . (bvsalud.org)
  • Matrices listed below were spiked with certain level of recombinant 11-Beta-Hydroxysteroid Dehydrogenase Type 3 (HSD11b3) and the recovery rates were calculated by comparing the measured value to the expected amount of 11-Beta-Hydroxysteroid Dehydrogenase Type 3 (HSD11b3) in samples. (sinoprot.com)
  • Intra-assay Precision (Precision within an assay): 3 samples with low, middle and high level 11-Beta-Hydroxysteroid Dehydrogenase Type 3 (HSD11b3) were tested 24 times on one plate, respectively. (sinoprot.com)
  • Inter-assay Precision (Precision between assays): 3 samples with low, middle and high level 11-Beta-Hydroxysteroid Dehydrogenase Type 3 (HSD11b3) were tested on 3 different plates, 8 replicates in each plate. (sinoprot.com)
  • The linearity of the kit was assayed by testing samples spiked with appropriate concentration of 11-Beta-Hydroxysteroid Dehydrogenase Type 3 (HSD11b3) and their serial dilutions. (sinoprot.com)
  • The microtiter plate provided in this kit has been pre-coated with an antibody specific to 11-Beta-Hydroxysteroid Dehydrogenase Type 3 (HSD11b3). (sinoprot.com)
  • Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific to 11-Beta-Hydroxysteroid Dehydrogenase Type 3 (HSD11b3). (sinoprot.com)
  • only 4 (4.2%) patients were diagnosed with 3-beta-hydroxysteroid dehydrogenase deficiency and constituted the subjects for the study. (journalcra.com)
  • The results presented suggest that the inhibitory effect of the non-aromatizable androgen DHT is receptor-mediated and involves the synthesis of a factor(s) that modulates 3-beta-HSD activity. (ulpgc.es)
  • Active site directed mutagenesis of 3 beta/17 beta-hydroxysteroid dehydrogenase establishes differential effects on short-chain dehydrogenase/reductase reactions. (ox.ac.uk)
  • Mutagenetic replacements of conserved residues within the active site of the short-chain dehydrogenase/reductase (SDR) superfamily were studied using prokaryotic 3 beta/17 beta-hydroxysteroid dehydrogenase (3 beta/17 beta-HSD) from Comamonas testosteroni as a model system. (ox.ac.uk)
  • Thus, mutation of Thr12 to Ala results in a complete loss of the 3 beta-dehydrogenase activity, whereas the 3-oxoreductase activity remains unchanged. (ox.ac.uk)
  • Our interpretation of the available crystal structure of 3 alpha/20 beta-HSD from Streptomyces hydrogenans suggests a hydrogen bond in that enzyme between the Thr12 side chain and the backbone NH of Asn87 rather than the coenzyme, indicating that this hydrogen bond to the beta D strand might determine a crucial difference between the reductive and the oxidative reaction types. (ox.ac.uk)
  • Increased expression of 11 beta-hydroxysteroid dehydrogenase type 2 in the lungs of patients with acute respiratory distress syndrome. (curehunter.com)
  • Role of local 11 beta-hydroxysteroid dehydrogenase type 2 expression in determining the phenotype of adrenal adenomas. (curehunter.com)
  • Mild Adrenal 3.BETA. (nii.ac.jp)
  • Induction and purification of alpha- and beta-hydroxysteroid dehydrogenases. (genome.jp)
  • Predicted to have 3-beta-hydroxy-delta5-steroid dehydrogenase activity. (mcw.edu)
  • The overwhelming majority of natural sex changes are from a female appearance at birth to a male appearance after puberty, due to either 5-alpha-reductase deficiency (5alpha-RD-2) or 17-beta-hydroxysteroid dehydrogenase deficiency (17beta-HSD-3). (wikipedia.org)
  • 3(ili 17)b-hidroksisteroid dehidrogenaza ( EC 1.1.1.51 , beta-hidroksi steroidna dehidrogenaza , 17-ketoreduktaza , 17beta-hidroksi steroidna dehidrogenaza , 3beta-hidroksisteroidna dehidrogenaza , 3beta-hidroksi steroidna dehidrogenaza ) je enzim sa sistematskim imenom 3(or 17)beta-hidroksisteroid:NAD(P) + oksidoreduktaza . (wikipedia.org)
  • Messenger RNA levels for type 3 17beta-HSD and aromatase were measured in adipose tissue from the subcutaneous abdominal and intra-abdominal depots using a quantitative multiplex competitive RT-PCR assay. (edu.au)
  • Type 3 17beta-HSD is co-expressed with aromatase in the abdominal preadipocytes of women. (edu.au)
  • With the exception of 3β-hydroxysteroid dehydrogenase (HSD), the enzymes involved in the conversion of cholesterol to steroid hormones are located in either the mitochondria or the endoplasmic reticulum. (biomedcentral.com)
  • These enzymes are suitable for the microanalysis of 3α-hydroxy-, 3β-hydroxy-, and 3-ketosteroids. (elsevier.com)
  • Thus, somewhat different immunostaining patterns of the steroidogenic enzymes, P450SCC and 3 HSD, were observed, but both varied during the lifespan of the primate corpus luteum in the menstrual cycle and following simulated early pregnancy. (grantome.com)
  • AdhD alcohol dehydrogenase from the thermophile Pyrococcus furiosus is one of the enzymes being engineered with these features by the Banta Lab. (proteopedia.org)
  • The glucocorticoid hypothesis is affirmed by studies that have shown that elevated maternal cortisol is associated with heightened HPA activity [ 2 ] and alterations in brain structure [ 3 ] in affected offspring. (hindawi.com)
  • In all three regions of the MG of follicles of the ovulable type, 3βOHD activity was lowest in estrus and diestrus-1, increased on diestrus-2 and peaked in proestrus. (elsevier.com)
  • In estrus and diestrus-1, the level of 3βOHD activity in the three regions was comparable. (elsevier.com)
  • The model simulations show that A4 synthesis can change paradoxically when 3β-HSD activity is varied. (elsevier.com)
  • Self-reported activity was scored as 1 (inactive), 2 (light), 3 (moderate), or 4 (heavy) for each domain of exercise (leisure and home), and the overall score was calculated as 1/2 of leisure plus home scores minus 1. (aacrjournals.org)
  • Has 3α-HSD and 20α-HSD activity in addition to 17β-HSD activity. (wikipedia.org)
  • Has 3α-HSD activity and catalyzes conversion of the weak androgen androstanediol into the powerful androgen dihydrotestosterone in the prostate gland. (wikipedia.org)
  • The type 3 enzyme is a 3-ketosteroid reductase expressed predominantly in kidney. (elsevier.com)
  • The preference for AKR1C1 and AKR1C2 to form 3β-hydroxytibolone, and the preference of the liver-specific AKR1C4 to form 3α-hydroxytibolone, may explain why 3β-hydroxytibolone is the major metabolite in human target tissues and why 3α-hydroxytibolone is the major circulating metabolite. (aspetjournals.org)
  • Complementary DNA clones encoding 3α-hydroxysteroid dehydrogenase (3αHSD) were isolated from a rat liver cDNA λgt11 expression library using monoclonal antibodies as probes. (elsevier.com)
  • Western blot analyses of various hamster tissues reveal high levels of expression of 3β-hydroxysteroid dehydrogenase (3β-HSD) in adrenal and liver, and moderate levels of expression in kidney. (elsevier.com)
  • The cloning of cDNAs for 3β-HSD from the liver and kidney should help in elucidating the function of this enzyme in these tissues. (elsevier.com)
  • Using NAD + , the 3-hydroxymetabolites were efficiently oxidized by homogeneous recombinant AKR1C2 and AKR1C4. (aspetjournals.org)
  • 3β-HSD deficiency is caused by a deficiency (shortage) of the 3β-HSD enzyme. (medlineplus.gov)
  • As a result of cortisol absence, corticotropin ( ACTH ) secretion increases and leads to produce 3-hydroxy-delta-5-steroids pregnenolone, 17-hydroxypregnenolone , and dehydroepiandrosterone ( DHEA ), also their sulfates. (wikidoc.org)
  • As a result of cortisol absence, corticotropin ( ACTH ) secretion increases the production of 3-hydroxy-delta-5-steroids pregnenolone , 17-hydroxypregnenolone , and dehydroepiandrosterone ( DHEA ). (wikidoc.org)
  • Pregnenolone is next metabolized to androgens by 3β-hydroxysteroid dehydrogenase (3β-HSD) [ 14 ]. (scielo.cl)
  • Prior research has suggested that musk gland development and function might be regulated by androgens [ 2 , 3 ] produced by the testis under the control of the hypothalamus-pituitary-testis system [ 4 , 5 ]. (scielo.cl)
  • Additionally, catalyzes the interconversion between 3beta-hydroxy and 3-oxo-5alpha-androstane steroids controlling the bioavalability of the active forms. (uniprot.org)
  • The enzyme 3beta/17beta-hydroxysteroid dehydrogenase (3beta/17beta-HSD) is a steroid-inducible component of the Gram-negative bacterium Conramonas testosteroni. (diva-portal.org)
  • Immunoelectron microscopic localization of 3beta-hydroxysteroid dehydrogenase and type 5 17beta-hydroxysteroid dehydrogenase in the human prostate and mammary gland. (semanticscholar.org)
  • catalyzes the chemical reaction: a 3β-hydroxy-Δ5-steroid + NAD+ ⇌ a 3-oxo-Δ5-steroid + NADH + H+ Thus, the two substrates of this enzyme are 3β-hydroxy-Δ5-steroid and NAD+, whereas its three products are 3-oxo-Δ5-steroid, NADH, and H+. (wikipedia.org)
  • As reviewed by Mesiano and Jaffe, 5 during much of gestation the fetal adrenal gland is deficient in the enzyme 3β-hydroxysteroid dehydrogenase (3βHSD), which catalyzes an essential step in the production of cortisol from cholesterol. (aappublications.org)
  • Induction of 11beta-hydroxysteroid dehydrogenase type 2 and hyperaldosteronism are essential for enhanced sodium absorption after total colectomy in rats. (curehunter.com)
  • Hydroxysteroid Dehydrogenase Deficiency with Hyperaldosteronism. (nii.ac.jp)
  • Human steroidogenesis, showing reactions of 3β-HSD near-left in green box. (wikipedia.org)
  • Human aldo-keto reductase (AKR)1C isoforms have been shown to act as 3α/3β-hydroxysteroid dehydrogenases (HSDs) on 5α-dihydrotestosterone (5α-DHT). (aspetjournals.org)
  • The mathematical model developed in this study simulates the network of reactions catalyzed by 3β-HSD and P450c17 that characterizes steroid synthesis in human, non-human primate, ovine, and bovine species. (elsevier.com)
  • Strogen Forte (standardized extract of plant Sabalis Serrulata) were examined on in vitro activities of rat and human testicular Δ 5 -3β-HSD. (elsevier.com)
  • Inflammatory mediators down-regulate 11beta-hydroxysteroid dehydrogenase type 2 in a human lung epithelial cell line BEAS-2B and the rat lung. (curehunter.com)
  • On examination, she had a male appearance with severe hirsutism, male hair balding, clitoromegaly of 3 cm and bilateral palpable inguinal mass of 2 mL. (eurospe.org)
  • Immunocytochemical analysis was then undertaken to investigate the localization of the 3βHSD-like substance in the zebrafish brain and spinal cord. (elsevier.com)
  • At the core of this process is the placental enzyme 11 β -hydroxysteroid dehydrogenase type 2 (11 β -HSD2), an enzyme that is expressed primarily within the syncytiotrophoblast of the placenta where it catalyses the conversion of active cortisol into its inactive product cortisone, thereby controlling the levels of cortisol that reach the fetus [ 4 ]. (hindawi.com)
  • On the basis of experience with genetically defined 21-hydroxylase late-onset adrenal hyperplasia, patients were presumed to suffer from 3β-hydroxysteroid dehydrogenase-deficient late-onset adrenal hyperplasia if they demonstrated a dehydroepiandrosterone or 17-hydroxypregnenolone response to corticotropin-(1-24) stimulation (absolute poststimulation level or net increment) greater than threefold the upper 95th percentile of controls. (elsevier.com)
  • CONCLUSIONS: Although an exaggerated response of 17-hydroxypregnenolone to adrenal stimulation is common in hyperandrogenism, a response severe enough to merit consideration as 3β-hydroxysteroid dehydrogenase-deficient late-onset adrenal hyperplasia was not encountered in this unselected patient population, suggestive of the rarity of this disorder. (elsevier.com)