An enzyme that catalyzes the first step in the biosynthetic pathway to LEUCINE, forming isopropyl malate from acetyl-CoA and alpha-ketoisovaleric acid. This enzyme was formerly listed as EC 4.1.3.12.
An NAD+ dependent enzyme that catalyzes the oxidation of 3-carboxy-2-hydroxy-4-methylpentanoate to 3-carboxy-4-methyl-2-oxopentanoate. It is involved in the biosynthesis of VALINE; LEUCINE; and ISOLEUCINE.
A species of gram-positive bacteria in the family Clostridiaceae. It is distinctive for its ability to ferment ETHANOL to caproic acid.
Enzymes that catalyze the cleavage of a carbon-carbon bond of a 3-hydroxy acid. (Dorland, 28th ed) EC 4.1.3.
A subclass of enzymes which includes all dehydrogenases acting on primary and secondary alcohols as well as hemiacetals. They are further classified according to the acceptor which can be NAD+ or NADP+ (subclass 1.1.1), cytochrome (1.1.2), oxygen (1.1.3), quinone (1.1.5), or another acceptor (1.1.99).
A species of gram-negative, aerobic, rod-shaped bacteria found in hot springs of neutral to alkaline pH, as well as in hot-water heaters.
Gram-negative aerobic rods found in warm water (40-79 degrees C) such as hot springs, hot water tanks, and thermally polluted rivers.

Inhibition of Escherichia coli isoleucine biosynthesis by isoleucine tetrazole. (1/43)

Growth of a derivative of Escherichia coli K-10 was strongly inhibited by 2 times 10(-4) M L-5(1-amino-2-methylbutyl)-tetrazole (isoleucine tetrazole). Growth inhibition was reversed by isoleucine, threonine, glycyl-L-isoleucine, or glycyl-L-threonine, and, in a valine-resistant mutant, by L-valine. Partial reversal of growth inhibiton was effected by L-leucine, L-methionine, or L-homoserine. The tetrazole inhibited the activity of the biosynthetic threonine deaminase (EC 4.2.1.16 L-threonine hydrolyase [deaminating]), the inhibition being relieved by L-valine. The tetrazole also inhibited isoleucyl-transfer ribonucleic acid (tRNA) synthetase (EC 6.1.1.5 L-isoleucine: tRNA ligase [adenosine monophosphate]), but was without effect on the activities of alpha-isopropylmalate synthetase or acetohydroxy acid synthetase. One class of isoleucine tetrazole-resistant mutants produced biosynthetic threonine deaminases which were no longer subject to feedback inhibition by either isoleucine or the tetrazole.  (+info)

Reversible, coenzyme-A-mediated inactivation of biosynthetic condensing enzymes in yeast: a possible regulatory mechanism. (2/43)

alpha-Isopropylmalate synthase [3-hydroxy-4-methyl-3-carboxyvalerate 2-oxo-3-methylbutyrate-lyase (CoA-acetylating); EC 4.1.3.12], the enzyme catalyzing the first committed step in leucine biosynthesis, and homocitrate synthase [3-hydroxy-3-carboxyadipate 2-oxoglutarate-lyase (CoA-acetylating); EC 4.1.3.21], the first enzyme in lysine biosynthesis in yeast, are rapidly inactivated in the presence of low concentrations of coenzyme A, a product of both reactions. Closely related compounds like 3-dephospho-coenzyme A or oxidized coenzyme A are almost without effect, as are other sulfhydryl compounds. Citrate (si)-synthase [citrate oxaloacetate-lyase (pro-3S-CH2-COO-minus leads to acetyl-CoA); EC 4.1.3.7] appears to be completely resistant against inactivation by coenzyme A. Inactivated alpha-isopropylmalate and homocitrate synthases can be reactivated by dialysis, but not by adding excess substrate. Protection against coenzyme-A-mediated inactivation is provided by relatively high concentrations of the alpha-ketoacid substrate or the specific end product inhibitor of each of the two enzymes. The coenzyme-A-mediated inactivation of alpha-isopropylmalate synthase has been more closely investigated. It requires the presence of divalent metal ions, with Zn++being most effective. The inactivation does not require molecular oxygen. It occurs in the presence of low concentrations of substrates and is observed in toluene-treated cells. These results, together with evidence that alpha-isopropylmalate synthase and homocitrate synthase are located in the mitochondria, suggest a mechanism by which increasing intra-mitochondrial coenzyme A concentrations might serve as a signal of decreasing acetyl-coenzyme A levels, triggering a temporary inactivation of biosynthetic acetyl-coenzyme A-consuming reactions in order to channel the available acetyl-coenzyme A into the citrate cycle.  (+info)

A gene controlling variation in Arabidopsis glucosinolate composition is part of the methionine chain elongation pathway. (3/43)

Arabidopsis and other Brassicaceae produce an enormous diversity of aliphatic glucosinolates, a group of methionine (Met)-derived plant secondary compounds containing a beta-thio-glucose moiety, a sulfonated oxime, and a variable side chain. We fine-scale mapped GSL-ELONG, a locus controlling variation in the side-chain length of aliphatic glucosinolates. Within this locus, a polymorphic gene was identified that determines whether Met is extended predominantly by either one or by two methylene groups to produce aliphatic glucosinolates with either three- or four-carbon side chains. Two allelic mutants deficient in four-carbon side-chain glucosinolates were shown to contain independent missense mutations within this gene. In cell-free enzyme assays, a heterologously expressed cDNA from this locus was capable of condensing 2-oxo-4-methylthiobutanoic acid with acetyl-coenzyme A, the initial reaction in Met chain elongation. The gene methylthioalkylmalate synthase1 (MAM1) is a member of a gene family sharing approximately 60% amino acid sequence similarity with 2-isopropylmalate synthase, an enzyme of leucine biosynthesis that condenses 2-oxo-3-methylbutanoate with acetyl-coenzyme A.  (+info)

Leucine biosynthesis in fungi: entering metabolism through the back door. (4/43)

After exploring evolutionary aspects of branched-chain amino acid biosynthesis, the review focuses on the extended leucine biosynthetic pathway as it operates in Saccharomyces cerevisiae. First, the genes and enzymes specific for the leucine pathway are considered: LEU4 and LEU9 (encoding the alpha-isopropylmalate synthase isoenzymes), LEU1 (isopropylmalate isomerase), and LEU2 (beta-isopropylmalate dehydrogenase). Emphasis is given to the unusual distribution of the branched-chain amino acid pathway enzymes between mitochondrial matrix and cytosol, on the newly defined role of Leu5p, and on regulatory mechanisms governing gene expression and enzyme activity, including new evidence for the metabolic importance of the regulation of alpha-isopropylmalate synthase by coenzyme A. Next, structure-function relationships of the transcriptional regulator Leu3p are addressed, defining its dual role as activator and repressor and discussing evidence in support of the self-masking model. Recent data pointing at a more extended Leu3p regulon are discussed. An overview of the layered controls of the extended leucine pathway is provided that includes a description of the newly recognized roles of Ilv5p and Bat1p in maintaining mitochondrial integrity. Finally, branched-chain amino acid biosynthesis and its regulation in other fungi are summarized, the question of leucine as metabolic signal is addressed, and possible directions of future research in this area are outlined.  (+info)

Repression of the tyrosine, lysine, and methionine biosynthetic pathways in a hisT mutant of Salmonella typhimurium. (5/43)

A comparison was made of the repressibility of certain enzymes in the tyrosine, methionine, and lysine biosynthetic pathways in wild-type Salmonella typhimurium and a hisT mutant. The results show that (i) tyrosine represses the synthesis of the tyrosine-sensitive 3-deoxy-D-arabino-heptulsonic acid 7-phosphate synthetase and the tyrosine aminotransferase to the same extent in a hisT mutant as in wild type and (ii) there is no detectable alteration in the extent to which methionine represses O-succinylhomoserine synthetase or in the extent to which lysine represses the lysine-sensitive beta-aspartokinase as a result of the hisT mutation.  (+info)

Crystal structure of LeuA from Mycobacterium tuberculosis, a key enzyme in leucine biosynthesis. (6/43)

The leucine biosynthetic pathway is essential for the growth of Mycobacterium tuberculosis and is a potential target for the design of new anti-tuberculosis drugs. The crystal structure of alpha-isopropylmalate synthase, which catalyzes the first committed step in this pathway, has been determined by multiwavelength anomalous dispersion methods and refined at 2.0-A resolution in complex with its substrate alpha-ketoisovalerate. The structure reveals a tightly associated, domain-swapped dimer in which each monomer comprises an (alpha/beta)(8) TIM barrel catalytic domain, a helical linker domain, and a regulatory domain of novel fold. Mutational and crystallographic data indicate the latter as the site for leucine feedback inhibition of activity. Domain swapping enables the linker domain of one monomer to sit over the catalytic domain of the other, inserting residues into the active site that may be important in catalysis. The alpha-ketoisovalerate substrate binds to an active site zinc ion, adjacent to a cavity that can accommodate acetyl-CoA. Sequence and structural similarities point to a catalytic mechanism similar to that of malate synthase and an evolutionary relationship with an aldolase that catalyzes the reverse reaction on a similar substrate.  (+info)

Isoleucine biosynthesis in Leptospira interrogans serotype lai strain 56601 proceeds via a threonine-independent pathway. (7/43)

Three leuA-like protein-coding sequences were identified in Leptospira interrogans. One of these, the cimA gene, was shown to encode citramalate synthase (EC 4.1.3.-). The other two encoded alpha-isopropylmalate synthase (EC 4.1.3.12). Expressed in Escherichia coli, the citramalate synthase was purified and characterized. Although its activity was relatively low, it was strictly specific for pyruvate as the keto acid substrate. Unlike the citramalate synthase of the thermophile Methanococcus jannaschii, the L. interrogans enzyme is temperature sensitive but exhibits a much lower K(m) (0.04 mM) for pyruvate. The reaction product was characterized as (R)-citramalate, and the proposed beta-methyl-d-malate pathway was further confirmed by demonstrating that citraconate was the substrate for the following reaction. This alternative pathway for isoleucine biosynthesis from pyruvate was analyzed both in vitro by assays of leptospiral isopropylmalate isomerase (EC 4.2.1.33) and beta-isopropylmalate dehydrogenase (EC 1.1.1.85) in E. coli extracts bearing the corresponding clones and in vivo by complementation of E. coli ilvA, leuC/D, and leuB mutants. Thus, the existence of a leucine-like pathway for isoleucine biosynthesis in L. interrogans under physiological conditions was unequivocally proven. Significant variations in either the enzymatic activities or mRNA levels of the cimA and leuA genes were detected in L. interrogans grown on minimal medium supplemented with different levels of the corresponding amino acids or in cells grown on serum-containing rich medium. The similarity of this metabolic pathway in leptospires and archaea is consistent with the evolutionarily primitive status of the eubacterial spirochetes.  (+info)

Asp578 in LEU4p is one of the key residues for leucine feedback inhibition release in sake yeast. (8/43)

We identified a new mutation, Asp578Tyr, in alpha-isopropylmalate synthase (a LEU4 gene product) that releases leucine feedback inhibition and causes hyperproduction of isoamyl alcohol (i-AmOH) in sake yeast. Spontaneous sake yeast mutants that express resistance to 5,5,5-trifluoro-DL-leucine (TFL) were isolated, and a mutant strain, TFL20, was characterized at the genetic and biochemical levels. An enzyme assay for alpha-isopropylmalate synthase showed that strain TFL20 was released from feedback inhibition by L-leucine. Furthermore, DNA sequencing of the LEU4 gene for a haploid of the mutant TFL20 revealed that aspartic acid in position 578 changes to tyrosine. A comparison of the three-dimensional structures of wild-type LEU4p and mutant LEU4D578Yp by the homology modeling method showed that Asp578 is important for leucine feedback inhibition. We conclude that the mutation from Asp to Tyr in 578 is a novel change causing release from leucine feedback inhibition.  (+info)

Methylthioalkylmalate synthase (MAM) catalyzes the committed step in the side chain elongation of Met, yielding important precursors for glucosinolate biosynthesis in Arabidopsis thaliana and other Brassicaceae species. MAM is believed to have evolved from isopropylmalate synthase (IPMS), an enzyme …
AE006468.LEUA Location/Qualifiers FT CDS_pept complement(132167..133738) FT /codon_start=1 FT /transl_table=11 FT /gene=leuA FT /locus_tag=STM0113 FT /product=2-isopropylmalate synthase FT /EC_number=2.3.3.13 FT /note=similar to E. coli 2-isopropylmalate synthase FT (AAC73185.1); Blastp hit to AAC73185.1 (523 aa), 92% FT identity in aa 1 - 523 FT /db_xref=EnsemblGenomes-Gn:STM0113 FT /db_xref=EnsemblGenomes-Tr:AAL19077 FT /db_xref=GOA:P15875 FT /db_xref=InterPro:IPR000891 FT /db_xref=InterPro:IPR002034 FT /db_xref=InterPro:IPR005671 FT /db_xref=InterPro:IPR013709 FT /db_xref=InterPro:IPR013785 FT /db_xref=InterPro:IPR036230 FT /db_xref=UniProtKB/Swiss-Prot:P15875 FT /protein_id=AAL19077.1 FT /translation=MSQQVIIFDTTLRDGEQALQASLSAKEKLQIALALERMGVDVMEV FT GFPVSSPGDFESVQTIARTIKNSRVCALARCVEKDIDVAAQALKVADAFRIHTFIATSP FT MHIATKLRSTLDEVIERAVYMVKRARNYTDDVEFSCEDAGRTPVDDLARVVEAAINAGA FT RTINIPDTVGYTMPFEFAGIISGLYERVPNIDKAIISVHTHDDLGIAVGNSLAAVHAGA FT ...
University of Canterbury Library α-Isopropylmalate synthase (α-IPMS) is responsible for catalysing the first committed step in leucine biosynthesis. This pathway is found in plants and microorganisms, including pathogenic bacteria such as Mycobacterium tuberculosis and Neisseria meningitidis. α-IPMS catalyses a Claisen condensation reaction between α-ketoisovalerate (KIV) and acetyl coenzyme A (AcCoA) to form the product α-isopropylmalate (IPM). This enzyme undergoes feedback inhibition by the end product of the pathway, leucine. This regulation allows the control of the rate leucine biosynthesis. This project focuses on the α-IPMS enzymes from M. tuberculosis and N. meningitidis (MtuIPMS and NmeIPMS). These α-IPMS enzymes are homodimeric in structure. Each monomer consists of a catalytic domain which comprises of a (β/α)8 barrel fold, two subdomains and a regulatory domain, to which the allosteric binding of the natural inhibitor leucine occurs. The mechanism by which the allosteric ...
A plant pathway that initiates with the formation of citramalate from pyruvate and acetyl-CoA by citramalate synthase (CMS) is proven to contribute to the synthesis of α-ketoacids and vital odor-active esters in apple (Malus × domestica) fruit. Microarray screening led to the invention of a gene with excessive amino acid similarity to 2-isopropylmalate synthase (IPMS). However, practical …. Citramalate synthase yields a biosynthetic pathway for isoleucine and straight- and branched-chain ester formation in ripening apple fruit Read More ». ...
First, to understand the relation between IPMs and $\phi$-divergences, the necessary and sufficient conditions under which these classes intersect are derived: the total variation distance is shown to be the only non-trivial $\phi$-divergence that is also an IPM. This shows that IPMs are essentially different from $\phi$-divergences. Second, empirical estimates of several IPMs from finite i.i.d. samples are obtained, and their consistency and convergence rates are analyzed. These estimators are shown to be easily computable, with better rates of convergence than estimators of $\phi$-divergences. Third, a novel interpretation is provided for IPMs by relating them to binary classification, where it is shown that the IPM between class-conditional distributions is the negative of the optimal risk associated with a binary classifier. In addition, the smoothness of an appropriate binary classifier is proved to be inversely related to the distance between the class-conditional distributions, measured ...
IPMS is a keyboard shorthand-acrynm for I Pissed MySelf. It is used instead of or with relation to terms like lol, lmao, and rofl Usually used in response to something funny.
Hi Chaps and Chapesses, I dont suppose anyone would have either of these kits for sale do they? Im not paying some of the collectors prices that Im seeing on auction sites, but it anyone has either off these kits at rrp, or lower, please let me know. Oh, the Gene Simmons kit need sto be the older long box, not the recent round box ...
Development of integrated population models (IPMs) assume the absence of systematic bias in monitoring programs, yet many potential sources of systematic bias in monitoring data exist (e.g., under-counts of abundance). By integrating multiple sources of data, we can assess whether various sources of monitoring data provide consistent inferences about changes in population size and, thus, whether m ...
Leu4 enzymatic activity is inhibited by leucine and CoA, and the amino acid residues responsible for this property have been identified (7). Although no detailed biochemical characterization of the LEU9-encoded isozyme has been performed, it has been shown that it is less sensitive to leucine inhibition than Leu4 is (3).. It is noteworthy that the leucine biosynthesis intermediate α-IPM plays a dual cellular role. On the one hand, it acts as an intermediate in leucine biosynthesis (5, 6), and on the other, it acts as the coactivator of the Leu3 master regulator (6), which modulates the expression of a number of genes within and beyond amino acid metabolism (6). At low α-IPM concentrations, Leu3 acts as a transcriptional repressor, while at high α-IPM concentrations, it acts as an activator (6). It has been recently found that α-IPM could also have a role in the ability of Leu3 to determine the chronological life span of yeast (11, 12).. A LEU4 deletion (leu4Δ) results in leucine bradytrophy ...
I second every thing thats been said here. As a long time friend (I hope) or pain in the ass (more likely) Ive got to throw in a few thoughts. The bad news is that this happens to us all. The good news is that were around for it to happen. This wouldnt be a Dave story without the next words: Many years back - I built plastic models. Some aircraft but mostly tanks. I was deeply involved in the International Plastic Modelers Society (IPMS) and I was able to build models that were competitive at the national level. By the way if you think that gun people are different and at least a little strange check out the modeling subculture. Its a refuge for people who have very severe cases of Aspergers Syndrome. Ask me how I know. Anyway when I hit around 40 I discovered that my eyes just wouldnt work to do the close up level of detail that I wanted. My eye doc said that even with bifocals or close up reading glasses there wasnt much he could do for me. So I regretfully put the xacto knives and ...
Such a component will lead to new generation of personalized information systems that on one hand provide visual information to the user and on the other hand are sensitive to visual interaction. Using some sort of modified eyeglasses the user will perceive her or his environment the usual way, additional optical information will be provided using the information system (Augmented Reality). This information may be adapted to the overall context, both unconsciously and by intent. Without using the hands or spoken commands the user can control the presented information just with movement or actions of the eyes. At SID 2008, Fraunhofer IPMS will present a respective demonstrator for the first time, which clearly shows the future possibilities of this technology.. ...
Since 25 years our highly reliable SKiiP IPMs are driving light rails, trams and subways all over the world. SEMIKRON stands also for innovative solutions for auxiliary power supplies.
16 June 2014 at Doha Helicopters Club House Branch: IPMS/Doha Modeler: Michael Yare Country of Residence: United Kingdom Chapter: IPMS/Doha Name of Model: UH43D Choctaw Scale: 1/72 Manufacturer: Hobby Boss Comments: Built Out of Box, painted with Revell Acrylics, and built with limited tools and materials
Low-Side Gate Driver}]},{id:16901,link:/products/discrete-power-modules/power-modules/intelligent-power-modules-ipms?blockId=13124,name:Intelligent Power Modules (IPMs),products:[{partId:STK541UC62K-E,description:Intelligent Power Module (IPM), 600 V, 10 A}]}],documentations:[{taxonomyId:13124,documentType:Package Drawing,documentOfficialType:Package Drawings,abbreviation:drawing,numberOf:6},{taxonomyId:13124,documentType:Design & Development Tools,documentOfficialType:Design & Development Tools,abbreviation:tools,numberOf:1},{taxonomyId:13124,documentType:Data Sheet,documentOfficialType:Data Sheets,abbreviation:Datasheets,numberOf:7},{taxonomyId:13124,documentType:Application Notes,documentOfficialType:Application Notes,abbreviation:AppNotes,numberOf:4},{taxonomyId:13124,documentType:Eval Board,documentOfficialType:Evaluation Board ...
My intended post this weekend was a further update on my Operation Overlord diorama but progress was hampered by preparing for and going to the Telford IPMS show (where I am now!). Fortunately I was able to finish the final Reaper figure I bought a while ago (I will be buying some more!) and arrange…
We develop an efficient homogeneous and self-dual interior-point method (IPM) for the linear programs arising in economic model predictive control (MPC) of constrained linear systems with linear objective functions. The algorithm is based on a Riccati iteration procedure, which is adapted to the linear system of equations solved in homogeneous and self-dual IPMs. Fast convergence is further achieved by means of a recent warm-start strategy for homogeneous and self-dual IPMs. We implement the algorithm in MATLAB and C. Its performance is tested using a conceptual power management case study. Closed loop simulations show that 1) the proposed algorithm is significantly faster than several state-of-the-art IPMs based on sparse linear algebra, and 2) warm-start reduces the average number of iterations by 35-40%.. ...
Meanwhile, NaMLab has explored ferroelectric properties in atomic layer deposition (ALD) based thin-films of doped HfO2, and has achieved revolutionary results (LINK). A variety of dopant materials (Si, Al, Ge, Y, Gd, La and Sr) with a crystal radius ranging from 50 to 130 pm has been studied in addition to a mixed Hf1-xZrxO2. The aim is to develop a memory concept with the HfO2 based ferroelectric transistors (FeFET) as building blocks. The FeFET is a long-term contender for an ultra-fast, low-power and non-volatile memory technology. In these devices the information is stored as a polarization state of the gate dielectric and can be read non-destructively as a shift of the threshold voltage. The advantage of a FeFET memory compared to the Flash memory is its faster access times and much lower power consumption at high data rates. In the framework of a project together with GLOBALFOUNDRIES and Fraunhofer IPMS, which was funded by the Free State of Saxony, a one-transistor (1T) FeFET eNVM was ...
Hi guys, Ive been really busy recently, work, moving house, trying to get to most shows on weekends etc, its been non-stop. Loads going on in the background, I have a few kits that are nearing completion (see RFI soon) but decided to keep them off BM due to time reasons but Im putting this up as its a really unusual-unseen built kit.., Ive also just set up a new SIG with the IPMS called Scale Water Bombers, basically, anything thats dropped water or retardant etc over the years from Ford Trimotors to DC-10s... one aircraft that Ive always been fond of is the AJ-1 Savage and two were used for aerial firefighting so Im going to try and replicate that using the lovely Mach2 kit. Some photos - Lovely patina seen on the box, Im guessing from having a nice long holiday up in a loft Mach 2 AJ-2 Savage 1/72nd by Totallyrad.co.uk, on Flickr Bang up-to-date 3D CAD style instructions Mach 2 AJ-2 Savage 1/72nd by Totallyrad.co.uk, on Flickr Tamiya-like mouldings. Mach 2 AJ-2 Savage 1/72nd by ...
Quick Search Product Directory Listing in Alphabetical Index9 on Drugdu.com for 5 Methyl 1H tetrazole|||256852|||jiujiang-zhongxing-medicine-chemical122006, 5 Amino 1H tetrazole|||256851|||jiujiang-zhongxing-medicine-chemical122006, 2 Butyl 4 spirocyclopentane 2 imidazolin 5 one hydrochloride|||256848|||jiujiang-zhongxing-medicine-chemical122006 and more.
1DR8: Crystal structures of 3-isopropylmalate dehydrogenases with mutations at the C-terminus: crystallographic analyses of structure-stability relationships.
1a05: Structure of 3-isopropylmalate dehydrogenase in complex with 3-isopropylmalate at 2.0 A resolution: the role of Glu88 in the unique substrate-recognition mechanism.
beplay全站app安卓-beplay体育官网下载app-beplay全站app安卓,优秀的服务得到了玩家的信任与支持。支持欧洲五大联赛及电竞赛事,同时还有专业的客服为玩家提供贴心的服务
AE006468.PE320 Location/Qualifiers FT CDS_pept 374197..374823 FT /codon_start=1 FT /transl_table=11 FT /locus_tag=STM0330 FT /product=putative 3-isopropylmalate isomerase FT (dehydratase), subunit with LeuC FT /note=similar to E. coli isopropylmalate isomerase subunit FT (AAC73182.1); Blastp hit to AAC73182.1 (201 aa), 39% FT identity in aa 3 - 193 FT /db_xref=EnsemblGenomes-Gn:STM0330 FT /db_xref=EnsemblGenomes-Tr:AAL19284 FT /db_xref=GOA:Q8ZRI9 FT /db_xref=InterPro:IPR000573 FT /db_xref=InterPro:IPR004431 FT /db_xref=InterPro:IPR015928 FT /db_xref=InterPro:IPR033940 FT /db_xref=UniProtKB/Swiss-Prot:Q8ZRI9 FT /protein_id=AAL19284.1 FT /translation=MDTFKQISGRIAPMLEPNIDTDVIMPKQFLKGIDRQGLDKGVFFD FT RRFMAGGQPNPDFILNMPGWQSATFLLVGPNFGCGSSREHAVWGLKQLGVRGLIGSTFA FT GIFDDNCQRNGILTVSLDEPALARLAQLAASADTNSITVSLDRCEITTAEETISFVISE FT LKRAMLAAGEDAIAWTLQYLPEIENFEVAHYSRRPWLKRPASPRG atggatacgt ttaagcaaat cagcgggcga attgcgccga tgctggaacc gaatatcgac 60 actgatgtga ttatgccaaa acagttcctg ...
Chemical Entities of Biological Interest (ChEBI) is a freely available dictionary of molecular entities focused on small chemical compounds.
The invention relates to tetrazole derivatives of bile acids, processes for their preparation, and use of these compounds as medicaments and cholesterol lowering agents. The tetrazole-bile acid derivatives are of the formula G1--X--G2, where G1 is H, a bile acid radical, or a bile acid radical which is modified on the hydroxyl functions and/or on the carboxyl group, X is a single bond or a bridge group between G1 and G2, and G2 is of the formula: ##STR1##
Staphylococcus aureus; strain: USA300_FPR3757; locus tag: SAUSA300_2013 (SAUSA300_RS11070); symbol: leuD; product: isopropylmalate isomerase small subunit
SWISS-MODEL Repository entry for A0A5S3QAK9 (A0A5S3QAK9_9PSED), 3-isopropylmalate dehydratase small subunit. Pseudomonas protegens
떨어져 있던 미토콘드리아와 소포체가 만나면 MAM이 형성되면서 칼슘의 이동통로가 되는데, 이 때 미토콘드리아로 칼슘이 과도하게 들어가면 미토콘드리아의 기능이 저하되면서 질환이 발생하게 된다. 최근에 MAM은 세포 내 신호전달이 오가는 허브로 주목받고 있으며, 실제로 많은 신경퇴행성질환 환자들의 유전자 변성이 해당 부위에서 발견된 바 있다 ...
Norvaline (abbreviated as Nva) is an amino acid with the formula CH3(CH2)2CH(NH2)CO2H. The compound is an isomer of the more common amino acid valine. Like most other α-amino acids, norvaline is chiral. It is a white, water-soluble solid. Norvaline is a non-proteinogenic unbranched-chain amino acid. It has previously been reported to be a natural component of an antifungal peptide of Bacillus subtilis. Norvaline and other modified unbranched chain amino acids have received attention because they appear to be incorporated in some recombinant proteins found in E. coli. Its biosynthesis has been examined. The incorporation of Nva into peptides reflects the imperfect selectivity of the associated aminoacyl-tRNA synthetase. In Miller-Urey experiments probing prebiotic synthesis of amino acids, norvaline, but also norleucine, are produced. Norvaline is known to promote tissue regeneration and muscle growth, and to become a precursor in the penicillin biosynthetic pathway. Norvaline and norleucine ...
5-Amino-1, 2, 3, 4-Tetrazole Potassium Salt CAS 136369-04-5 specifications & features from suppliers/manufacturer We offer 5-Amino-1, 2, 3, 4-tetrazole potassium salt for competitive price. Synonym: 1H-Tetrazol-5-amine potassium saltIf you need a specific offer, please send us your enquiry mentioning the quantity you are interested in, so we are able to give you
1DPZ: Crystal structures of 3-isopropylmalate dehydrogenases with mutations at the C-terminus: crystallographic analyses of structure-stability relationships.
SWISS-MODEL Repository entry for B3DPI3 (LEUD_BIFLD), 3-isopropylmalate dehydratase small subunit. Bifidobacterium longum (strain DJO10A)
The highlight of the Argosy Universitys Sept. 29, 2017 graduation was the awarding of doctorate degrees to five graduates: (l-r) Dr. Johnny Siaumau Mapu, Dr. Lisa Tasi Vasai Mapu, Dr. Sheri Saeni Vasai -Taase, Dr. Lealofi Seau, and Dr. Usoalii Faiai Jr. Congratulations! [photo: Leua Aiono Frost]. ...
TY - JOUR. T1 - Overproduction and substrate specificity of 3-isopropylmalate dehydrogenase from thiobacillus ferrooxidans. AU - Matsunami, Hideyuki. AU - Kawaguchi, Hiroshi. AU - Inagaki, Kenji. AU - Eguchi, Tadashi. AU - Kakinuma, Katsumi. AU - Tanaka, Hidehiko. N1 - Copyright: Copyright 2017 Elsevier B.V., All rights reserved.. PY - 1998. Y1 - 1998. N2 - We constructed an overexpression system in Escherichia coli of the leuB gene coding for 3-isopropylmalate dehydrogenase in Thiobacillus ferrooxidans. E. coli harboring the plasmid we constructed, pKK leuB1, produced 17-fold the enzyme protein of the expression system previously used for purification. The substrate specificity of the enzyme was analyzed with synthetic (2R, 3S)-3-alkylmalates. The 3-isopropylmalate dehydrogenase of Thiobacillus ferrooxidans had broad specificity toward the alkylmalates.. AB - We constructed an overexpression system in Escherichia coli of the leuB gene coding for 3-isopropylmalate dehydrogenase in Thiobacillus ...
Making his debut with Marvel Comics in 1962, Spiderman has been an icon of the comic superhero scene for over 50 years. Similarly, since the end of World War II, and with a bit more longevity, the VW Beetle has become a worldwide automotive icon in and of itself. Combine the two, and you get Polar Lights Marvel Comics The Amazing Spide
aconitate hydratase/ copper ion binding; FUNCTIONS IN: aconitate hydratase activity, copper ion binding; INVOLVED IN: response to cadmium ion; LOCATED IN: mitochondrion, chloroplast; EXPRESSED IN: 25 plant structures; EXPRESSED DURING: 16 growth stages; CONTAINS InterPro DOMAIN/s: Aconitase family, 4Fe-4S cluster binding site (InterPro:IPR018136), Aconitase/3-isopropylmalate dehydratase large subunit, alpha/beta/alpha (InterPro:IPR001030), Aconitase A/isopropylmalate dehydratase small subunit, swivel (InterPro:IPR000573), Aconitase/3-isopropylmalate dehydratase large subunit, alpha/beta/alpha, subdomain 2 (InterPro:IPR015932), Aconitase/Iron regulatory protein 2/2-methylisocitrate dehydratase (InterPro:IPR015934), Aconitase-like core (InterPro:IPR015937), Aconitase/3-isopropylmalate dehydratase, swivel (InterPro:IPR015928), Aconitase/iron regulatory protein 2 (InterPro:IPR006249), Aconitase/3-isopropylmalate dehydratase large subunit, alpha/beta/alpha, subdomains 1 and 3 (InterPro:IPR015931); ...
Mono- and Stereopictres of 5.0 Angstrom coordination sphere of Bromine atom in PDB 3hpz: Crystal Structure of Mycobacterium Tuberculosis Leua Complexed With Bromopyruvate
Bauerle, R.H., Freundlich, M., Størmer, F.C. and Umbarger, H.E. (1964). Control of isoleucine, valine and leucine biosynthesis. II. Endproduct inhibition by valine of acetohydroxy acid synthetase in Salmonella typhimurium. Biochim. Biophys. Acta 92: 142-149. PMID 14243762. ...
Andreas Dräger, Marcel Kronfeld, Jochen Supper, Hannes Planatscher, Jørgen B. Magnus, Marco Oldiges, and Andreas Zell. Benchmarking Evolutionary Algorithms on Convenience Kinetics Models of the Valine and Leucine Biosynthesis in C. glutamicum. In Dipti Srinivasan and Lipo Wang, editors, IEEE Congress on Evolutionary Computation (CEC 2007), pages 896-903, Singapore, September 2007. IEEE Computational Intelligence Society, IEEE Press. [ DOI , details , link , pdf ...
One of the enzymes involved in a novel pyruvate pathway for isoleucine biosynthesis that is found in some, mainly archaeal, bacteria [1,2]. The enzyme can be inhibited by isoleucine, the end-product of the pathway, but not by leucine [2]. The enzyme is highly specific for pyruvate as substrate, as the 2-oxo acids 3-methyl-2-oxobutanoate, 2-oxobutanoate, 4-methyl-2-oxopentanoate, 2-oxohexanoate and 2-oxoglutarate cannot act as substrate [1,2 ...
SwissBioIsostere is a knowledgebase that provides information on more than 4.5 million molecular substructural replacements extracted from literature and that are useful for compound optimization in drug design. It provides a tool for replacements for a single substructure (e.g. an amide group) or a particular substructure of interest (e.g. carboxylic acid vs tetrazole).. ...
Catalyzes the aldol-type condensation of 2-oxoglutarate with acetyl-CoA to yield homocitrate. Carries out the first step of the alpha-aminoadipate (AAA) lysine biosynthesis pathway.
It is well-known that azide salts can engage nitriles at elevated temperatures to yield tetrazoles; however, there is continued debate as to the mechanism of the reaction. Density functional theory calculations with the hybrid functional B3LYP have been performed to study different mechanisms of tetrazole formation, including concerted cycloaddition and stepwise addition of neutral or anionic azide species. The calculations presented here suggest a previously unsuspected nitrile activation step en route to an imidoyl azide, which then cyclizes to give the tetrazole. The activation barriers are found to correlate strongly with the electron-withdrawing potential of the substituent on the nitrile ...
MAJ Ulises Taymes - Executive Officer mo le USArmy Reserve i Tafuna lea ua faailoa maia lenei galuega o le a amata fausia i le lotoa a le Reserve i Tafuna ina ia kolenia ai fitafita i tomai tau fanafana. [L-R] 1st Lt. Melendez, Jose 411th PSC, LTC Clinton Seybold TSA/AS Det. Commander ma MAJ Ulisses Taymes TSG AS Det. Executive Officer. [ata: Leua Aiono Frost ...
Baixe mam��e imagens para seus projetos criativos. Encontre milhões de imagens e vetores royalty free com preços acessíveis.
In enzymology , a valine-tRNA ligase ( EC 6.1.1.9 ) is an enzyme that catalyzes the chemical reaction The 3 substrates of this enzyme are ATP , L-valine , and tRNA(Val) , whereas its 3 products are AMP , diphosphate , and L-valyl-tRNA(Val) . This enzyme belongs to the family of ligases , to be specific those forming carbon-oxygen bonds in aminoacyl-tRNA and related compounds. The systematic name of this enzyme class is L-valine:tRNAVal ligase (AMP-forming) . Other names in common use include valyl-tRNA synthetase , valyl-transfer ribonucleate synthetase , valyl-transfer RNA synthetase , valyl-transfer ribonucleic acid synthetase , valine transfer ribonucleate ligase , and valine translase . This enzyme participates in valine, leucine and isoleucine biosynthesis and aminoacyl-trna biosynthesis . Structural studies As of late 2007, 5 structures have been solved for this class of enzymes, with PDB accession codes 1GAX , 1IVS , 1IYW , 1WK9 , and 1WKA . See also VARS References Berg P, Bergmann FH, Ofengand
Since treatment of uremic hyperphosphatemia still represents a major problem and phosphate-binding agents carry the well-known… Expand ...
The expert panel further noted that a poor response to IFN beta or GA should be defined as 2 or more relapses within a year of treatment, 1 significant relapse in the past year, a single relapse accompanied by new MRI activity (eg, new Gd+ lesions, new or enlarging T2 hyperintense lesions, or new T1 black holes) within 1 year, or a significant increase in MRI activity even in the absence of clinical activity.9 Natalizumab can also be given to patients who cannot tolerate IFN beta or GA (ie, those who develop flulike symptoms or injection-site reactions). Finally, patients fitting into a poor prognosis category may also benefit from natalizumab (Table 1). In these groups of patients, natalizumab as firstline therapy can be considered. For example, first-line therapy with natalizumab is recommended for patients with a devastating first relapse, or accompanying poor prognosis MRI activity (eg, T1 black hole formation, high number and volume of Gd+ lesions).9 ...
... alpha-isopropylmalate synthase, alpha-isopropylmalic synthetase, isopropylmalate synthase, and isopropylmalate synthetase. This ... Mycobacterium tuberculosis α-isopropylmalate synthase requires a divalent metal ion, of which Mg2+ and Mn2+ give highest ... Kohlhaw G, Leary TR, Umbarger HE (1969). "Alpha-isopropylmalate synthase from Salmonella typhimurium Purification and ... Carvalho LP, Blanchard, JS (2006). "Kinetic and Chemical Mechanism of alpha-Isopropylmalate Synthase from Mycobacterium ...
A systematic name for this compound is 2-aminohexanoic acid. The compound is an isomer of the more common amino acid leucine. ... It arises via the action of 2-isopropylmalate synthase on α-ketobutyrate. The incorporation of Nle into peptides reflects the ...
... (isopropylmalate) is an intermediate in the biosynthesis of leucine, synthesized from oxoisovalerate by 2- ... isopropylmalate synthase and converted into isopropyl-3-oxosuccinate by 3-isopropylmalate dehydrogenase. Two isomers are ... and these are interconverted by isopropylmalate dehydratase. (Articles lacking sources from July 2013, All articles lacking ...
A series of four more enzymes - isopropylmalate synthase, isopropylmalate isomerase, isopropylmalate dehydrogenase, and ... Acetohydroxyacid synthase is the first enzyme for the parallel pathway performing condensation reaction in both steps - ... acetohydroxyacid synthase, ketoacid reductoisomerase, dihydroxyacid dehygrogenase and aminotransferase. Threonine dehydrogenase ... 16 (2): 520-530. doi:10.1016/j.celrep.2016.05.092. PMC 4947548. PMID 27346343. Cummings NE, Williams EM, Kasza I, Konon EN, ...
... homocitrate synthases, (3) biotin carboxyl carrier proteins, (4) isopropylmalate synthases and (5) acyl-CoA carboxylase. The α- ... The generalized reaction for the NaT-DC family is: R - CO− 2 (in) + H+ (out) and 1 or 2 Na+ (in) ←→ R-H + CO2 (in) and 1 or 2 ... 31 (2): 473-87. doi:10.1046/j.1365-2958.1999.01189.x. PMID 10027965. S2CID 35018668. Balsera M, Buey RM, Li XD (March 2011). " ... 10 (2-4): 105-19. doi:10.1159/000091558. PMID 16645308. S2CID 22898166. Granjon T, Maniti O, Auchli Y, Dahinden P, Buchet R, ...
... riboflavin synthase MeSH D08.811.913.225.825 - spermidine synthase MeSH D08.811.913.225.912 - spermine synthase MeSH D08.811. ... 3-isopropylmalate dehydrogenase MeSH D08.811.682.047.524 - ketol-acid reductoisomerase MeSH D08.811.682.047.551 - lactate ... nitric oxide synthase type i MeSH D08.811.682.664.500.772.500 - nitric oxide synthase type ii MeSH D08.811.682.664.500.772.750 ... glycogen synthase kinases MeSH D08.811.913.696.620.682.700.429.500 - glycogen synthase kinase 3 MeSH D08.811.913.696.620.682. ...
Acetolactate synthase Acetohydroxy acid isomeroreductase Dihydroxyacid dehydratase α-Isopropylmalate synthase α-Isopropylmalate ... 226 (2): 411-8. doi:10.1152/ajplegacy.1974.226.2.411. PMID 4855772. Zanchi NE, Gerlinger-Romero F, Guimarães-Ferreira L, de ... 16 (2): 520-530. doi:10.1016/j.celrep.2016.05.092. PMC 4947548. PMID 27346343. Lynch CJ, Adams SH (December 2014). "Branched- ... 569 (Pt 2): 489-99. doi:10.1113/jphysiol.2005.098004. PMC 1464228. PMID 16195315. Verhoeven S, Vanschoonbeek K, Verdijk LB, ...
... promiscuity can be decreased as was the case of γ-humulene synthase (a sesquiterpene synthase) from Abies grandis that is known ... and the bifunctional isopropylmalate isomerase/homoaconitase from Pyrococcus horikoshii have revealed that active site loop ... Codexis). Another example is the possibility of using the promiscuous activities of cysteine synthase (cysM) towards ... including overexpression of the large component of a synthase in the absence of the amine transferase subunit), pathway bypass ...
... berbamunine synthase EC 1.1.3.35: Now EC 1.14.21.4, salutaridine synthase EC 1.1.3.36: Now EC 1.14.21.5, (S)-canadine synthase ... 3-isopropylmalate dehydrogenase EC 1.1.1.86: ketol-acid reductoisomerase (NADP+) EC 1.1.1.87: homoisocitrate dehydrogenase EC ... clavaminate synthase EC 1.14.11.22: Now EC 1.14.20.5, flavone synthase EC 1.14.11.23: Now EC 1.14.20.6, flavonol synthase EC ... anthocyanidin synthase * EC 1.14.20.5: flavone synthase I * EC 1.14.20.6: flavonol synthase * EC 1.14.20.7: 2-oxoglutarate/L- ...
... isopropylmalate synthase (alpha -IPMS) of Mycobacterium tuberculosis, a repeat that is unique to the bacterium. The objective ... Structural and functional characterization of α-isopropylmalate synthase and citramalate synthase, members of the LeuA dimer ... A variable number of tandem repeats result in polymorphic alpha -isopropylmalate synthase in Mycobacterium tuberculosis W ... Subdomain II of α-isopropylmalate synthase is essential for activity: inferring a mechanism of feedback inhibition. Zhang Z, Wu ...
2-isopropylmalate synthase UniProtKBInterProInteractive Modelling. 506 aa; Sequence (Fasta) ; 5 identical sequences: Bacillus ... 2° Structure. Bfactor. Bfactor Range. Clustal. Hydrophobic. Size. Charged. Polar. Proline. Ser/Thr. Cysteine. Aliphatic. ... 2-isopropylmalate synthase. Bacillus cereus (strain ATCC 10987 / NRS 248) ...
Inositol-3-phosphate synthase. 47. SEQF2451,KE952636.1. SEQF2451_00051 jb. [NA] [AA] 1443/480. 1759-317. Pyruvate kinase. ... L-asparagine permease 2. 140. SEQF2451,KE952640.1. SEQF2451_00152 jb. [NA] [AA] 1173/390. 97006-95834. Putative N-acetyl-LL- ... 2-isopropylmalate synthase. 45. SEQF2451,KE952635.1. SEQF2451_00049 jb. [NA] [AA] 2268/755. 32127-29860. Penicillin-binding ... 2. SEQF2451,KE952631.1. SEQF2451_00002 jb. [NA] [AA] 657/218. 2081-1425. putative ABC transporter ATP-binding protein. ...
alpha-Isopropylmalate Synthase Term UI T043990. Date06/08/1981. LexicalTag NON. ThesaurusID UNK (19XX). ... alpha-Isopropylmalate Synthase Registry Number. EC 2.3.3.13. Related Numbers. 9030-98-2. CAS Type 1 Name. 3-Carboxy-3-hydroxy-4 ... An enzyme that catalyzes the first step in the biosynthetic pathway to LEUCINE, forming isopropyl malate from acetyl-CoA and ... An enzyme that catalyzes the first step in the biosynthetic pathway to LEUCINE, forming isopropyl malate from acetyl-CoA and ...
FLS3 (FLAVONOL SYNTHASE 3). F:flavonol synthase activity;P:response to light stimulus, response to sucrose stimulus, flavonoid ... terpene synthase/cyclase family protein. F:lyase activity, magnesium ion binding;P:metabolic process;C:unknown;PO. O.I.. C.G.. ... terpene synthase/cyclase family protein. F:lyase activity, magnesium ion binding;P:metabolic process;C:unknown;PO. O.I.. C.G.. ... THAS1 (THALIANOL SYNTHASE 1). Encodes an oxidosqualene cyclase involved in the biosynthesis of thalianol, a tricyclic ...
Synthase, alpha-Isopropylmalate. alpha Isopropylmalate Synthase. alpha-Isopropylmalate Synthase. Tree number(s):. D08.811. ... Synthase, 2-Isopropylmalate Synthase, alpha-Isopropylmalate alpha Isopropylmalate Synthase alpha-Isopropylmalate Synthase ... An enzyme that catalyzes the first step in the biosynthetic pathway to LEUCINE, forming isopropyl malate from acetyl-CoA and ... An enzyme that catalyzes the first step in the biosynthetic pathway to LEUCINE, forming isopropyl malate from acetyl-CoA and ...
alpha-Isopropylmalate Synthase Term UI T043990. Date06/08/1981. LexicalTag NON. ThesaurusID UNK (19XX). ... alpha-Isopropylmalate Synthase Registry Number. EC 2.3.3.13. Related Numbers. 9030-98-2. CAS Type 1 Name. 3-Carboxy-3-hydroxy-4 ... An enzyme that catalyzes the first step in the biosynthetic pathway to LEUCINE, forming isopropyl malate from acetyl-CoA and ... An enzyme that catalyzes the first step in the biosynthetic pathway to LEUCINE, forming isopropyl malate from acetyl-CoA and ...
2-isopropylmalate synthase. Compositional properties of 2-isopropylmalate synthase (bottom) versus UniprotKB/SwissProt (top). ...
acetolactate synthase small subunit. 05100. ilvB. 1812. biosynthetic-type acetolactate synthase large subunit. ...
3-isopropylmalate dehydratase large subunit 46, 103. DVU2983. leuD. 3-isopropylmalate dehydratase small subunit 46, 103. ... cobyrinic acid a,c-diamide synthase 83, 141. DVU3087. cobH. precorrin-8X methylmutase 46, 141. ... POSITION A C G T 1 1.0 0.0 0.0 0.0 2 0.5 0.0 0.0 0.5 3 0.0 0.0 0.5 0.5 4 0.0 0.0 0.0 1.0 5 1.0 0.0 0.0 0.0 6 1.0 0.0 0.0 0.0 7 ... POSITION A C G T 1 0.333333 0.0 0.0 0.666667 2 0.0 0.0 1.0 0.0 3 0.166667 0.833333 0.0 0.0 4 0.0 0.0 1.0 0.0 5 0.833333 0.0 ...
Oklahoma State University E.coli Gene Expression Database
2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain; 2-isopropylmalate... cl18962 480.407 1.31E-166 88 - ... DRE-TIM metallolyase superfamily; The DRE-TIM metallolyase superfamily includes 2-isopropylmalate... - 480.407 1.31E-166 88 - ... Catalysis of the reaction: 3-methyl-2-oxobutanoate + acetyl-CoA + H(2)O = (2S)-2-isopropylmalate + CoA + H(+). ... The chemical reactions and pathways resulting in the formation of leucine, 2-amino-4-methylpentanoic acid. ...
3-isopropylmalate dehydratase (8) * C-1-tetrahydrofolate synthase, mitochondrial (8) * Argininosuccinate synthase (8) ... Phosphoribosylaminoimidazole-succinocarboxamide synthase (8) * Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 56 kDa ... Inositol phosphorylceramide synthase regulatory subunit KEI1 (5) * Succinate dehydrogenase [ubiquinone] flavoprotein subunit 2 ... Chorismate synthase (8) * 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (8 ...
Note:Only the main profile, including all conditions, is shown. Additional statistics and tissue specific profiles are available here.. ...
Synthase N0000167838 Nitric Oxide Synthase Type I N0000167839 Nitric Oxide Synthase Type II N0000167837 Nitric Oxide Synthase ... Hydroxybutyric Acid N0000167983 3-Hydroxysteroid Dehydrogenases N0000166590 3-Iodobenzylguanidine N0000167952 3-Isopropylmalate ... Glycogen Synthase N0000170539 Glycogen Synthase Kinase 3 N0000170538 Glycogen Synthase Kinases N0000167643 Glycogen-Synthase-D ... N0000169811 Glutamate Plasma Membrane Transport Proteins N0000168386 Glutamate Synthase N0000169065 Glutamate Synthase (NADH) ...
D1.339.431.249 Hydroxymethylbilane Synthase D8.811.520.232.400.550 D8.811.913.225.575 Hydroxymethylglutaryl-CoA Synthase D8.811 ... Synthase D8.811.913.50.575 D8.811.913.50.622 4,5-Dihydro-1-(3-(trifluoromethyl)phenyl)-1H-pyrazol-3-amine D3.383.694.120 D3.383 ... D18.590 Nitric-Oxide Synthase D8.811.682.135.772 D8.811.682.664.500.772 D8.811.682.608.550.772 (Replaced for 2006 by Nitric ... Synthase D8.811.520.224.600.400 D8.811.913.50.368 Citric Acid Cycle G6.535.280 G6.535.335.342 Citrinin D24.185.926.587.272 ...
ATP citrate synthase (also ATP citrate lyase (ACLY)) is an enzyme that in animals represents an important step in fatty acid ... The cleft between the CoA binding and citrate synthase domains forms the active site of the enzyme, where both citrate and ... followed by a CoA binding domain and CoA-ligase domain and finally a C-terminal citrate synthase domain. ... ACLY forms a homotetramer with a rigid citrate synthase homology (CSH) module, flanked by four flexible acetyl-CoA synthetase ...
","6,7-dimethyl-8-ribityllumazine synthase / DMRL synthase / lumazine synthase / riboflavin synthase","protein_coding" " ... ","Aconitase/3-isopropylmalate dehydratase protein","protein_coding" "AT2G43730","No alias","Arabidopsis thaliana","Mannose- ... ","nicotianamine synthase","protein_coding" "Gb_09307","No alias","Gingko biloba","Alpha-bisabolene synthase OS=Abies grandis ( ... ","nicotianamine synthase","protein_coding" "LOC_Os03g19427.1","No alias","Oryza sativa","nicotianamine synthase","protein_ ...
V-type ATP synthase subunit D ahaB 1307282 - 1305879 - , V-type ATP synthase subunit B TERM 798 1305996 - 1305982 - G 71 -7.2 - ... isocitrate/isopropylmalate dehydrogenase Msp_0675 785707 - 786801 + , hypothetical protein TERM 446 786858 - 786872 + T 72 -5.8 ... GMP synthase subunit A Msp_1312 1476739 - 1477665 + , GMP synthase subunit B Msp_1313 1477781 - 1479085 + , ATPase TERM 919 ... putative glutamate synthase, subunit 3 Msp_0670 781568 - 780651 - , putative glutamate synthase, subunit 1 Msp_0671 782134 - ...
1a) (2R,3S)-3-isopropylmalate = 2-isopropylmaleate + H(2)O. Cyclic pyranopterin phosphate + 2 [molybdopterin-synthase sulfur- ... molybdopterin-synthase sulfur-carrier protein]. L-aspartate + 2-oxoglutarate = oxaloacetate + L-glutamate. ATP + L-methionine ... 2 superoxide + 2 H(+) = O(2) + H(2)O(2). The C-O-P bond 3 to the apurinic or apyrimidinic site in DNA is broken by a beta- ... S)-2-hydroxy acid + O(2) = 2-oxo acid + H(2)O(2). 6-phospho-D-glucono-1,5-lactone + H(2)O = 6-phospho-D-gluconate. ATP- ...
... and we thus suggested that the isopropylmalate synthase might have a role in generating citramalate. ... Figure 2. Oxygen Transfer Rate (OTR) and Carbon Transfer Rate (CTR) in mmol/h; S. stipitis (red and yellow) and S. cerevisiae ( ... We sought the presence of citramalate synthase by blasting the protein sequence from microorganisms having this reaction (e.g. ... acetaldehyde dehydrogenase and acetyl-CoA synthase), while, during oxidative growth, acetyl-CoA is mainly generated through the ...
5,6-dimethylbenzimidazole synthase (NADH). DMPPS_syn. 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase (dmpp) ...
Hydroxymethylglutaryl-CoA Synthase. *Malate Synthase. *Phosphatidylcholine-Sterol O-Acyltransferase. *Retinol O-Fatty- ... Long Chain Base Biosynthesis Protein 2*Long Chain Base Biosynthesis Protein 2 ...
This is a maintenance category. It is used for maintenance of the Wikipedia project and is not part of the encyclopedia. It contains pages that are not articles, or it groups articles by status rather than content. Do not include this category in content categories. This is a hidden category. It is not shown on its member pages, unless the corresponding user preference Show hidden categories is set.. ...
3-isopropylmalate dehydratase large subunit 1. QuickGO ontology. BLASTP. 92876. 94081. 1206. tyrosine--tRNA ligase 2. QuickGO ... glycosyl transferase family 2. QuickGO ontology. BLASTP. 97990. 99075. 1086. HD-GYP domain-containing protein. QuickGO ontology ...
... the coculture was scaled up in a high-cell density fed-batch fermentation in a 2 L bioreactor by fine-tuning the inoculation ... Kalscheuer R, Steinbüchel A. A novel bifunctional wax ester synthase/acyl-CoA: diacylglycerol acyltransferase mediates wax ... 3-isopropylmalate; IPOS, 2-isopropyl-3-oxosuccinate; KIC, 2-ketoisocaproate; PP-CoA, propionyl-CoA; FAS, fatty acid synthase; ... and the enzymes acetolactate synthase AlsS from B. subtilis, and E. coli ketol-acid reductoisomerase IlvC and dihydroxy-acid ...
... effects of monovalent cations and divalent metals on the activity of Mycobacterium tuberculosis alpha-isopropylmalate synthase ... A coupled spectrophotometric assay for l-cysteine:1-d-myo-inosityl 2-amino-2-deoxy-alpha-d-glucopyranoside ligase and its ... 2. 48893 OI-LS-348; PUBMED-OI-5/15/2006. Kinetic analysis of the ... Novel ketoconazole analogues based on the replacement of 2,4- ... www.sciencedirect.com/science/article/B6TF9-4JJ2BJM-2/2/27d1f9018ac921fd3763b08fdf29ceb7 10. 48901 OI-LS-348; PUBMED-OI-5/15/ ...
  • alpha-isopropylmalate synthase. (expasy.org)
  • This is the C-terminal regulatory (R) domain of alpha-isopropylmalate synthase, which catalyses the first committed step in the leucine biosynthetic pathway ( PUBMED:15159544 ). (embl-heidelberg.de)
  • We previously discovered that monosulfuron ester sodium (MES), an acetolactate synthase (ALS) inhibitor of the herbicide sulfonylurea family, can induce rapeseed ( Brassica napus L.) male sterility at approximately 1% concentration required for its herbicidal activity. (biomedcentral.com)
  • Sequence and structural similarities point to acatalytic mechanism similar to that of malate synthase and an evolutionaryrelationship with an aldolase that catalyzes the reverse reaction on asimilar substrate. (embl-heidelberg.de)
  • The crystal structure of alpha-isopropylmalatesynthase, which catalyzes the first committed step in this pathway, hasbeen determined by multiwavelength anomalous dispersion methods andrefined at 2.0-A resolution in complex with its substratealpha-ketoisovalerate. (embl-heidelberg.de)
  • Catalyzes the retro-aldol cleavage of 4-hydroxy-2- oxopentanoate to pyruvate and acetaldehyde. (string-db.org)
  • It catalyzes the esterification of the hydroxyl group of lipoprotein cholesterol by the transfer of a fatty acid from the C-2 position of lecithin. (harvard.edu)
  • Citrate (si)-Synthase" is a descriptor in the National Library of Medicine's controlled vocabulary thesaurus, MeSH (Medical Subject Headings) . (umassmed.edu)
  • This graph shows the total number of publications written about "Citrate (si)-Synthase" by people in this website by year, and whether "Citrate (si)-Synthase" was a major or minor topic of these publications. (umassmed.edu)
  • Below are the most recent publications written about "Citrate (si)-Synthase" by people in Profiles. (umassmed.edu)
  • Renaturation of citrate synthase: influence of denaturant and folding assistants. (umassmed.edu)
  • Moreover, 2-ketoisocaproate may serve as precursor for products deriving from this 2-ketoacid, e.g. 3-methylbutanal (isovaleraldehyde), an intermediate for industrial vitamin synthesis, as well as its corresponding alcohol 3-methyl-1-butanol, a potential future biofuel. (uni-ulm.de)
  • In this context, potential limitations during 2-ketoisocaproate synthesis in C. glutamicum were identified, permitting the directed improvement of the newly constructed strain(s). (uni-ulm.de)
  • Further confusing matters, seemingly artifactual zinc can replace bona fide 4Fe-4S clusters in proteins purified for crystallography in the presence of oxygen (1,2,3). (ucsc.edu)
  • A radioenzymatic assay for the activity of acetohydroxy acid synthase [from Salmonella typhimurium] on 1 of its substrates, .alpha. (eurekamag.com)
  • This list contains a list of EC numbers for the second group, EC 2 , transferases , placed in numerical order as determined by the Nomenclature Committee of the International Union of Biochemistry and Molecular Biology . (en-academic.com)
  • For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. (lbl.gov)
  • The natural precursor of the essential amino acid L-leucine, 2-ketoisocaproate, is often used as a therapeutic agent in infusion solutions for kidney-patients and as integral part of functional food for muscle regeneration. (uni-ulm.de)
  • After sterilization of seeds treated with hypochlorous acid (10%) for 10 min, seeds were kept in distilled water for 3 days under dark condition at 4 ˚C to enhance germination.Seedling were grown for 7 days on 1/2 MS agar plate (0.8% agar, pH 5.7) at 22 ˚C, 24 h continuous light condition. (yokohama-cu.ac.jp)
  • Unripe Rubus coreanus Miquel Extract Containing Ellagic Acid Regulates AMPK, SREBP-2, HMGCR, and INSIG-1 Signaling and Cholesterol Metabolism In Vitro and In Vivo. (harvard.edu)
  • MMS19: a large all-scaffold protein === MMS19 is a large protein involved in cytoplasmic iron sulfur assembly first studied with bioinformatic tools 12 years ago (1,2). (ucsc.edu)
  • 3-isopropylmalate dehydratase (isopropylmalate isomerase), the enzyme that catalyzes the second step in the biosynthesis of leucine. (beds.ac.uk)
  • A locus of variable number of the tandem repeat, VNTR4155, resides in the putative leuA gene, encoding for alpha -isopropylmalate synthase (alpha -IPMS) of Mycobacterium tuberculosis, a repeat that is unique to the bacterium. (nih.gov)
  • Characterization of alpha-isopropylmalate synthases containing different copy numbers of tandem repeats in Mycobacterium tuberculosis. (nih.gov)
  • ATP citrate synthase (also ATP citrate lyase (ACLY) ) is an enzyme that in animals represents an important step in fatty acid biosynthesis . (wikipedia.org)
  • The mammalian ATP citrate lyase has a N-terminal citrate-binding domain that adopts a Rossmann fold , followed by a CoA binding domain and CoA-ligase domain and finally a C-terminal citrate synthase domain. (wikipedia.org)
  • The cleft between the CoA binding and citrate synthase domains forms the active site of the enzyme, where both citrate and acetyl-coenzyme A bind. (wikipedia.org)
  • Compositional properties of 2-isopropylmalate synthase (bottom) versus UniprotKB/SwissProt (top). (ucy.ac.cy)
  • Cloning and Expression Analysis of Beta-Isopropylmalate Dehydrogenase from Potato. (mpg.de)
  • 2. The non-naturally occurring microbial biocatalyst of claim 1, wherein said 4-HB biosynthetic pathway comprises 4-hydroxybutanoate dehydrogenase and succinyl-CoA synthetase and CoA-dependent succinic semialdehyde dehydrogenase, or α-ketoglutarate decarboxylase. (patentsencyclopedia.com)
  • When the product is more important, synthase may be used in the name, e.g. phosphosulfolactate synthase (EC 4.4.1.19, Michael addition of sulfite to phosphoenolpyruvate). (ipfs.io)
  • The chemical reactions and pathways resulting in the formation of leucine, 2-amino-4-methylpentanoic acid. (systemsbiology.net)
  • Systematically engineering Escherichia coli for enhanced production of 1,2-propanediol and 1-propanol. (semanticscholar.org)
  • Expression of an Arabidopsis Sucrose Synthase Gene Indicates a Role in Metabolization of Sucrose Both during Phloem Loading and in Sink Organs. (mpg.de)
  • and hydrogen peroxide (H 2 O 2 ) are important signaling molecules inevitably formed in aerobic energy metabolism. (frontiersin.org)
  • In general, metals such as copper and chromium, despite having an important role in biochemistry, can be toxic at high concentrations [2]. (peertechzpublications.com)
  • NT cells expressing the alpha beeta TCR can recognize lipid and lipoglycan antigens presented in the context of nonpolymorphic CD1 molecules, whereas phosphocarbohydrates and akilamines induce constitutive responses in most V gama 9V delta 2 NT lymphocytes. (eurekaselect.com)
  • The production of 1,2-propanediol at enhanced titer and enhanced yield simultaneously in E. coli for the first time is reported and an efficient system for the production of biofuel 1- Propanol biologically is established. (semanticscholar.org)