Chemicals and Drugs
2-Aminoadipate TransaminaseL-Aminoadipate-Semialdehyde Dehydrogenase2-Aminoadipic AcidAlanine Transaminase4-Aminobutyrate TransaminaseTransaminasesAspartate Aminotransferases
2-Aminoadipate Transaminase
A PYRIDOXAL PHOSPHATE containing enzyme that catalyzes the transfer of amino group of L-2-aminoadipate onto 2-oxoglutarate to generate 2-oxoadipate and L-GLUTAMATE.
L-Aminoadipate-Semialdehyde Dehydrogenase
An enzyme that catalyzes the oxidation of L-2-aminoadipate 6-semialdehyde to L-2-aminoadipate (alpha-aminoadipic acid). It is involved in the biosynthetic pathway of LYSINE.
2-Aminoadipic Acid
A metabolite in the principal biochemical pathway of lysine. It antagonizes neuroexcitatory activity modulated by the glutamate receptor, N-METHYL-D-ASPARTATE; (NMDA).
Alanine Transaminase
An enzyme that catalyzes the conversion of L-alanine and 2-oxoglutarate to pyruvate and L-glutamate. (From Enzyme Nomenclature, 1992) EC 2.6.1.2.
4-Aminobutyrate Transaminase
An enzyme that converts brain gamma-aminobutyric acid (GAMMA-AMINOBUTYRIC ACID) into succinate semialdehyde, which can be converted to succinic acid and enter the citric acid cycle. It also acts on beta-alanine. EC 2.6.1.19.
Transaminases
A subclass of enzymes of the transferase class that catalyze the transfer of an amino group from a donor (generally an amino acid) to an acceptor (generally a 2-keto acid). Most of these enzymes are pyridoxyl phosphate proteins. (Dorland, 28th ed) EC 2.6.1.
Aspartate Aminotransferases
Enzymes of the transferase class that catalyze the conversion of L-aspartate and 2-ketoglutarate to oxaloacetate and L-glutamate. EC 2.6.1.1.

alpha-Aminoadipate aminotransferase from an extremely thermophilic bacterium, Thermus thermophilus. (1/6)

The extremely thermophilic bacterium Thermus thermophilus HB27 synthesizes lysine through alpha-aminoadipate (AAA). In this study, a T. thermophilus gene encoding the enzyme that catalyses transamination of AAA was cloned as a mammalian kynurenine/AAA aminotransferase (Kat2) gene homologue. A T. thermophilus mutant with disruption of the Kat2 homologue required a longer lag phase for growth and showed slower growth in minimal medium. Furthermore, addition of AAA or lysine shortened the lag phase and improved the growth rate. The Kat2 homologue was therefore termed lysN. LysN recognizes not only 2-oxoadipate, an intermediate of lysine biosynthesis, but also 2-oxoisocaproate, 2-oxoisovalerate and 2-oxo-3-methylvalerate, intermediates of leucine, valine and isoleucine biosyntheses, respectively, along with oxaloacetate, a compound in the TCA cycle, as an amino acceptor. These results suggest multiple roles of LysN in several cellular metabolic pathways including lysine and branched-chain amino acid biosyntheses.  (+info)

Purification and properties of kynurenine aminotransferase from rat kidney. (2/6)

Previous reports indicated that a single protein exhibits kynurenine aminotransferase (KAT) and alpha-aminoadipate aminotransferase (AadAT) activities. However, recently we discovered that KAT and AadAT activities are associated with two different proteins. KAT from rat kidney supernatant fraction was purified to electrophoretic homogeneity by (NH4)2SO4 fractionation, DEAE-Sephacel and hydroxyapatite chromatography. This procedure separated KAT from AadAT and improved the overall yield and the degree of purification over previously published methods. Some of the properties of purified KAT, such as Mr, subunit structure and the inhibition by dicarboxylic acids, were identical with those reported previously. However, the substrate specificity and pI of purified KAT were different from earlier reports. The same procedure can also be used to purify KAT from rat kidney mitochondria. These results support our earlier observation that KAT and AadAT activities are associated with two proteins and suggest that cytosolic KAT may be structurally similar to the mitochondrial enzyme.  (+info)

Alpha-aminoadipate and kynurenine aminotransferase activities from rat kidney. Evidence for separate identity. (3/6)

alpha-Aminoadipate aminotransferase and kynurenine aminotransferase activities from rat kidney are reportedly associated with the same protein. We observed that when the supernatant fraction was maintained at pH 4.5 for 75 min, 100% of kynurenine aminotransferase activity was lost, whereas only 40% of aminoadipate aminotransferase activity was lost. We purified alpha-aminoadipate aminotransferase and kynurenine aminotransferase from rat kidney supernatant fraction to electrophoretic homogeneity by ammonium sulfate fractionation, DEAE-Sephacel, and hydroxylapatite chromatography. Kynurenine aminotransferase activity was precipitated by pH treatment. The remaining aminoadipate aminotransferase activity was concentrated and injected into rabbits to raise antibodies that were used to prepare an affinity column. A mixture of aminoadipate aminotransferase and kynurenine aminotransferase activities obtained after hydroxylapatite chromatography was subjected to affinity chromatography. Aminoadipate aminotransferase and kynurenine aminotransferase activities resolved as separate peaks, providing evidence that the two activities are associated with two different proteins.  (+info)

Therapeutic modulation of cerebral L-lysine metabolism in a mouse model for glutaric aciduria type I. (4/6)

 (+info)

Purification and properties of 2-aminoadipate: 2-oxoglutarate aminotransferase from bovine kidney. (5/6)

Previous studies with rat kidney preparations indicated that 2-aminoadipate aminotransferase (AadAT) and kynurenine aminotransferase (KAT) activities are properties of a single protein. We found that bovine kidney contains an appreciable amount of AadAT activity, but lacks KAT activity. AadAT from bovine and rat kidney extracts were purified to electrophoretic homogeneity. The purification procedure included fractionation with (NH1)2SO1, heat treatment, DEAE-cellulose chromatography and hydroxyapatite chromatography. Physical and kinetic properties, such as pH optima, Km for substrates, Mr, electrophoretic mobility and inhibition by dicarboxylic acids of bovine kidney AadAT, were similar to those of the rat kidney enzyme. However, bovine kidney AadAT differed from rat kidney AadAT in substrate specificity, amino acid composition and stability when stored. The titration curve of bovine kidney AadAT was also different from that of the rat kidney enzyme. The results suggest that bovine kidney AadAT may have some structural similarity to rat kidney AadAT and that the structural differences observed between the two enzymes may explain the absence of KAT activity in bovine kidney.  (+info)

Cloning and functional expression of a soluble form of kynurenine/alpha-aminoadipate aminotransferase from rat kidney. (6/6)

Several aminotransferases with kynurenine aminotransferase (KAT) activity are able to convert L-kynurenine into kynurenic acid, a putative endogenous modulator of glutamatergic neurotransmission. In the rat, one of the described KAT isoforms has been found to correspond to glutamine transaminase K. In addition, rat kidney alpha-aminoadipate aminotransferase (AadAT) also shows KAT activity. In this report, we describe the isolation of a cDNA clone encoding the soluble form of this aminotransferase isoenzyme from rat (KAT/AadAT). Degenerate oligonucleotides were designed from the amino acid sequences of rat kidney KAT/AadAT tryptic peptides for use as primers for reverse transcription-polymerase chain reaction of rat kidney RNA. The resulting polymerase chain reaction fragment was used to screen a rat kidney cDNA library and to isolate a cDNA clone encoding KAT/AadAT. Analysis of the combined DNA sequences indicated the presence of a single 1275-base pair open reading frame coding for a soluble protein of 425 amino acid residues. KAT/AadAT appears to be structurally homologous to aspartate aminotransferase in the pyridoxal 5'-phosphate binding domain. RNA blot analysis of rat tissues, including brain, revealed a single species of KAT/AadAT mRNA of approximately 2.1 kilobases. HEK-293 cells transfected with the KAT/AadAT cDNA exhibited both KAT and AadAT activities with enzymatic properties similar to those reported for the rat native protein.  (+info)

AADAT - Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial precursor - Homo sapiens (Human) - AADAT gene & proteinAADAT - Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial precursor - Homo sapiens (Human) - AADAT gene & protein
Transaminase with broad substrate specificity. Has transaminase activity towards aminoadipate, kynurenine, methionine and glutamate. Shows activity also towards tryptophan, aspartate and hydroxykynurenine. Accepts a variety of oxo-acids as amino-group acceptors, with a preference for 2-oxoglutarate, 2-oxocaproic acid, phenylpyruvate and alpha-oxo-gamma-methiol butyric acid. Can also use glyoxylate as amino-group acceptor (in vitro).
http://www.uniprot.org/uniprot/Q8N5Z0
Sequence Similarity Search - BLAST
hsa:51166 K00825 kynurenine/2-aminoadipate aminotransferase [EC:2.6.1.7 2.6.1.39] , (RefSeq) AADAT, KAT2, KATII, KYAT2; aminoadipate aminotransferase (A) MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKT IQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQG LCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKP EDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNK FRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQ LMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKV KGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQL IKESL ...
https://www.genome.jp/tools-bin/search_sequence?prog=blast&seqid=hsa:51166+aa
AADAT Antibody - Cat. No. 48-417 | ProSciAADAT Antibody - Cat. No. 48-417 | ProSci
AADAT Antibody (Cat. No. 48-417) can be used to detect Gibbon, Gorilla, Human, Monkey AADAT Antibody in IHC and other applications.
https://www.prosci-inc.com/aadat-antibody-48-417.html
Q8N5Z0 | AADAT - Overview | canSAR BlackQ8N5Z0 | AADAT - Overview | canSAR Black
Search Molecular targets, 3D Structures, Protein families, Compounds, Diseases, Genes, Drugs | the Cancer Drug Discovery Platform | ICR CRUK Cancer Therapeutics Unit | canSAR Black
https://cansarblack.icr.ac.uk/target/Q8N5Z0/synopsis/ligandability
The α-aminoadipate pathway for lysine biosynthesis in fungi | SpringerLinkThe α-aminoadipate pathway for lysine biosynthesis in fungi | SpringerLink
This review provides a description of the biochemistry and enzymology of the α-aminoadipate pathway for lysine biosynthesis in fungi. The α-aminoadipate pathway is unique to fungi and is thus a potential target for the rational design of antifungal drugs. The present state of knowledge of the mechanisms of the seven enzymes in the pathway is presented, as well as detailed information with respect to structures and mechanisms of homocitrate synthase, saccharopine reductase, and saccharopine dehydrogenase. ...
https://link.springer.com/article/10.1385/CBB:46:1:43
AADAT Fragment MS Protein Standard - Creative ProteomicsAADAT Fragment MS Protein Standard - Creative Proteomics
AADAT Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human AADAT protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
https://www.creative-proteomics.com/product/detail-cpilf31648_20178.htm
EC 2.6.1.105EC 2.6.1.105
Accepted name: lysine-8-amino-7-oxononanoate transaminase. Reaction: L-lysine + 8-amino-7-oxononanoate = (S)-2-amino-6-oxohexanoate + 7,8-diaminononanoate. Glossary: (S)-2-amino-6-oxohexanoate = L-2-aminoadipate 6-semialdehyde = L-allysine. Other name(s): DAPA aminotransferase (ambiguous); bioA (gene name) (ambiguous); bioK (gene name). Systematic name: L-lysine:8-amino-7-oxononanoate aminotransferase. Comments: A pyridoxal 5-phosphate enzyme [2]. Participates in the pathway for biotin biosynthesis. The enzyme from the bacterium Bacillus subtilis cannot use S-adenosyl-L-methionine as amino donor and catalyses an alternative reaction for the conversion of 8-amino-7-oxononanoate to 7,8-diaminononanoate (cf. EC 2.6.1.62, adenosylmethionine-8-amino-7-oxononanoate transaminase).. Links to other databases: BRENDA, EXPASY, KEGG, MetaCyc, CAS registry number:. References:. 1. Van Arsdell, S.W., Perkins, J.B., Yocum, R.R., Luan, L., Howitt, C.L., Chatterjee, N.P. and Pero, J.G. Removing a bottleneck in ...
http://www.sbcs.qmul.ac.uk/iubmb/enzyme/EC2/6/1/105.html
Raxone 150 mg film-coated tablets | Patient Info | Chiesi Limited | Medicines.ieRaxone 150 mg film-coated tablets | Patient Info | Chiesi Limited | Medicines.ie
The Summary of Product Characteristics (SPC or SmPC) is a specific document, the wording of which has been agreed with the regulatory authority as part of the medicine approval process. It is required before any medicine is allowed on the market in Europe. It is designed to assist doctors and pharmacists in prescribing and supplying the product ...
https://www.medicines.ie/medicines/raxone-150-mg-film-coated-tablets-34909
KYAT1 (kynurenine aminotransferase 1) - KOMP (Knockout Mouse Project)
The KOMP Repository is located at the University of California Davis and Childrens Hospital Oakland Research Institute. Question? Comments? For Mice, Cells, and germplasm please contact us at [email protected], US 1-888-KOMP-MICE or International +1-530-752-KOMP, or for vectors [email protected] or +1-510-450-7917 ...
https://www.komp.org/geneinfo.php?geneid=33232
Olympian Labs Melatonin 5mg Fast Dissolve 60 Tab -- VitaGloOlympian Labs Melatonin 5mg Fast Dissolve 60 Tab -- VitaGlo
VitaGlo.com - Now Vitamins, Now Foods, EAS, Met-Rx, MuscleTech, and many more Diet, Vitamins, Minerals, Herbal Products. VitaGlo.com is your first choice for nutritional supplements, health, body, and muscle building products
http://vitaglo.com/oy0344.html
Daily Cold and Flu Weather Forecast for Bend, ORDaily Cold and Flu Weather Forecast for Bend, OR
AccuWeather.com provided daily cold and flu weather forecast in Bend, OR. See how the weather will impact the flu and common cold
https://www.accuweather.com/en/us/bend-or/97701/cold-flu-daily-forecast/335268?day=9
CH00115
Rabbit polyclonal antibody raised to a synthetic peptide corresponding to residues 1-22 of Kynurenine Aminotransferase II (KAT II); the epitope for the antibody was derived from human protein sequence that shows homology to mouse protein sequence. ...
https://www.coriell.org/0/sections/Search/Sample_Detail.aspx?Ref=CH00115&PgId=166
Scared me more than COVID: A Kashmiri medical student talks about how one year of lockdown has affec- EdexliveScared me more than COVID: A Kashmiri medical student talks about how one year of lockdown has affec- Edexlive
Ab Aadat Hogayi Hai Lockdown Ki, says Mehran. Even if I wanted to, I couldnt relate to him. The lockdowns that Mehran and I are used to are quite different. I was forced to stay indoors, to keep myself safe from a deadly virus. I was privileged, safe, with my family. I worked from home using my laptop and high speed-WiFi. I used the same network to conduct virtual Netflix Parties with my friends and video call them for hours. We challenged each other to upload photographs on Instagram and whip the perfect Dalgona Coffee. People like me went on virtual dates and attended paid online events. Once in a while, we drove our cars an extra kilometre, when we stepped out to buy essentials.. Mehran couldnt relate to my version of a lockdown ...
https://www.edexlive.com/news/2020/aug/05/scared-me-more-than-covid-a-kashmiri-medical-student-talks-about-how-one-year-of-lockdown-has-affec-13701.html
DLL1 | Discovery of Brain-Penetrant, Irreversible Kynurenine Aminotransferase II InhibitorsDLL1 | Discovery of Brain-Penetrant, Irreversible Kynurenine Aminotransferase II Inhibitors
Background/Purpose: The chance of upper gastrointestinal blood loss (UGIB) increases in patients with coronary artery disease (CAD) because of the frequent usage of antiplatelets. had been significantly old, and had more often utilized antiplatelets and warfarin than in non-CAD individuals. Weighed against non-CAD, the CAD individuals had considerably higher GlasgowCBlatchford rating, complete and pre-endoscopic Rockall rating and complete. Peptic ulcer in CAD individuals was identified more regularly than in non-CAD individuals. UGIB individuals with CAD and non-CAD got similar outcomes in regards to to mortality price, re-bleeding, medical procedures, embolization, and loaded erythrocyte transfusion. Nevertheless, CAD individuals had longer length of hospital remains than non-CAD individuals. Two CAD individuals passed away from cardiac arrest after endoscopy, whereas three non-CAD individuals passed away from pneumonia and severe renal failure throughout their hospitalization. Summary: In ...
http://researchreport-digital.com/tag/dll1/
RNAP | Discovery of Brain-Penetrant, Irreversible Kynurenine Aminotransferase II InhibitorsRNAP | Discovery of Brain-Penetrant, Irreversible Kynurenine Aminotransferase II Inhibitors
Data Availability StatementThe data used to support the results of the research are included within this article. wound healing, and transwell assays, indicating that miR-486-5p is an HCC suppressor. We employed four miRNA databases to predict the target genes of miR-486-5p and verified retrieved genes using qPCR and western blotting. The E3 ubiquitin ligase CBL was significantly downregulated by miR-486-5p overexpression in HCC cell lines at both mRNA and protein level, and overexpression of CBL counteracted the inhibitory effects of miR-486-5p on HCC cell proliferation and migration. Moreover, CBL expression was negatively correlated with miR-486-5p expression in HCC tissues. Collectively, our results suggest that miR-486-5p may S/GSK1349572 cell signaling act as a tumor suppressor gene in HCC by downregulating CBL expression. 1. Introduction Hepatocellular carcinoma (HCC) is the sixth most common cancer worldwide and the third leading cause of cancer-related mortality [1]. Although ...
https://researchreport-digital.com/category/rnap/
Kynurenine aminotransferase 3/glutamine transaminase L/cysteine conjugate beta-lyase 2 is a major glutamine transaminase in the...
PubMed Central Canada (PMC Canada) provides free access to a stable and permanent online digital archive of full-text, peer-reviewed health and life sciences research publications. It builds on PubMed Central (PMC), the U.S. National Institutes of Health (NIH) free digital archive of biomedical and life sciences journal literature and is a member of the broader PMC International (PMCI) network of e-repositories.
http://pubmedcentralcanada.ca/pmcc/articles/PMC5613967/
Lysine metabolism in mammalian brain: An update on the importance of recent discoveries<...Lysine metabolism in mammalian brain: An update on the importance of recent discoveries<...
TY - JOUR. T1 - Lysine metabolism in mammalian brain. T2 - An update on the importance of recent discoveries. AU - Hallen, André. AU - Jamie, Joanne F.. AU - Cooper, Arthur J L. PY - 2013/12. Y1 - 2013/12. N2 - The lysine catabolism pathway differs in adult mammalian brain from that in extracerebral tissues. The saccharopine pathway is the predominant lysine degradative pathway in extracerebral tissues, whereas the pipecolate pathway predominates in adult brain. The two pathways converge at the level of δ1-piperideine-6-carboxylate (P6C), which is in equilibrium with its open-chain aldehyde form, namely, α-aminoadipate δ-semialdehyde (AAS). A unique feature of the pipecolate pathway is the formation of the cyclic ketimine intermediate δ1-piperideine-2- carboxylate (P2C) and its reduced metabolite l-pipecolate. A cerebral ketimine reductase (KR) has recently been identified that catalyzes the reduction of P2C to l-pipecolate. The discovery that this KR, which is capable of reducing not only ...
https://researchers.mq.edu.au/en/publications/lysine-metabolism-in-mammalian-brain-an-update-on-the-importance-
Measurement of the Activity of a Kynurenine-Converting Enzyme and/or a Kynurenic-Acid, Anthranilic-Acid and/or 3...Measurement of the Activity of a Kynurenine-Converting Enzyme and/or a Kynurenic-Acid, Anthranilic-Acid and/or 3...
0026]1. Okuno E, Nishikawa T, M Nakamura, (1996) Kynurenine aminotransferases in the rat. Localization and Characterization. Recent Advances in Tryptophan Research, edited by Graziella Allegri Filipini et al., Plenum Press, New Your, 1996.2. B. Kepplinger, H. Baran, A. Kainz, H. Ferraz-Leite, J. Newcombe and P. Kalina (2005) Age-related increase of kynurenic acid in human cerebrospinal fluid: Positive corratio with IgG and Sa-microglobulin changes. Neurosignals, 14(3), 126-135.3. Kepplinger B, Baran H, Kainz A, Zeiner D, Wallner J (2006) Cerebrospinal Fluid of Multiple Sclerosis patients exert significantly weaker inhibition of Kynurenine Aminotransferase I activity in rat liver homogenate. Multiple Sclerosis 2006; 12:S1-S228, P4964. H. Baran, B. Kepplinger, M. Draxler and H. Ferraz-Leite (2004) Kynurenic acid metabolism in rat, piglet and human tissues. In European Society for Clinical Neuropharmacology by ed L. Battistin, International Proceedings MEDIMOND S.r.1. E505R9004, 227-231.5. H. ...
http://www.patentsencyclopedia.com/app/20100112618
Glutaricaciduria I - NORD (National Organization for Rare Disorders)Glutaricaciduria I - NORD (National Organization for Rare Disorders)
TEXTBOOKS. Goodman SI, Frerman FE. Organic acidemias due to defects in lysine oxidation: 2-ketoadipic acidemia and glutaric acidemia. In: Scriver CR, Beaudet AL, Sly WS, et al. Eds. The Metabolic Molecular Basis of Inherited Disease. 7th ed. McGraw-Hill Companies. New York, NY; 1995:1451-60.. JOURNAL ARTICLES. Bahr O, Mader I, Zschocke J, et al. Adult onset glutaric aciduria type I presenting with leukoencephalopathy. Neurology. 2002;59:1802-04.. Kolker S, Ramaekers VT, Zschocke J, et al. Acute encephalopathy despite early therapy in a patient with homozygosity for E365K in the glutaryl-coenzyme A dehydrogenase gene. J Pediatr 2001;138:277-79.. Zafeiriou DI, Zschocke J, Augustidou-Savvopoulou P, et al. Atypical and variable clinical presentation of glutaric aciduria type I. Neuropediatrics. 2000;31:303-06.. Kafil-Hussain NA, Monavari A, Bowell R, et al. Ocular findings in glutaric aciduria type I. J Pediatr Ophthalmol Strabismus. 2000;37:289-93.. Busquets C, Coll MJ, Merinero B, et al. Prenatal ...
https://rarediseases.org/rare-diseases/glutaricaciduria-i/
Glutaric aciduria type IGlutaric aciduria type I
Infectious Disease Advisor is used by specialists and other medical professionals to help understand and treat infectious diseases. Latest news, research and treatment articles.
http://www.infectiousdiseaseadvisor.com/pediatrics/glutaric-aciduria-type-i/article/624231/
Glutaric aciduria type I - ONAGlutaric aciduria type I - ONA
We offer clinical cancer updates, treatment guidance, and research news to the oncology nursing community. Visit us often for drug therapy testing results, patient care information and more. Download our FREE app today.
https://www.oncologynurseadvisor.com/pediatrics/glutaric-aciduria-type-i/article/624226/
Page 2 - Clinical AdvisorPage 2 - Clinical Advisor
OVERVIEW: What every practitioner needs to know Are you sure your patient has glutaric aciduria type I? What are the typical findings for this disease? Glutaric aciduria type I (GA-I) should be considered in any patient who has a history of dystonia/dyskinesia with macrocephaly. Prior to these overt chronic neurologic symptoms, there is usually a…. ...
https://www.clinicaladvisor.com/author/pulmonology-advisor-contributing-writer-1/page/2/
KEGG PATHWAY: Penicillin and cephalosporin biosynthesis - Reference pathway
Penicillins (Penams) and cephalosporins (cephems) are beta-lactam antibiotics containing 6-aminopenicillanate (6-APA) and 7-aminocephalosporanate (7-ACA) nuclei, respectively. 6-APA and 7-ACA are key intermediates for a variety of semisynthetic penicillin and cephalosporin derivatives. Penicillins are produced only by fungi, while cephalosporins (including cephamycins) are produced by fungi and bacteria. Both antibiotics are synthesized from L-2-aminoadipate, L-cysteine and L-valine through a common pathway. It starts with the condensation of these three amino acids by the non-ribosomal peptide synthetase to form the tripeptide delta-(L-2-aminoadipyl)-L-cysteinyl-D-valine (ACV). The linear ACV tripeptide is then converted to bicyclic isopenicillin N by isopenicillin N synthase, in which the beta-lactam ring is formed. Isopenicillin N is the branch point of penicillin [MD:M00672] and cephalosporin [MD:M00673] pathways ...
http://www.genome.jp/kegg/pathway/map/map00311.html
Human Metabolome Database: Showing metabocard for Aminoadipic acid (HMDB0000510)Human Metabolome Database: Showing metabocard for Aminoadipic acid (HMDB0000510)
Aminoadipic acid (2-aminoadipate) is a metabolite in the principal biochemical pathway of lysine. It is an intermediate in the metabolism (i.e. breakdown or degradation) of lysine and saccharopine.(Wikipedia). It antagonizes neuroexcitatory activity modulated by the glutamate receptor, N-methyl-D-aspartate; (NMDA). Aminoadipic has also been shown to inhibit the production of kynurenic acid in brain tissue slices (PMID: 8566117 ). Kynurenic acid is a broad spectrum excitatory amino acid receptor antagonist. Recent studies have shown that aminoadipic acid is elevated in prostate biopsy tissues from prostate cancer patients (PMID: 23737455 ). Mutations in DHTKD1 (dehydrogenase E1 and transketolase domain-containing protein 1) have been shown to cause human 2-aminoadipic and 2-oxoadipic aciduria via impaired turnover of decarboxylation 2-oxoadipate to glutaryl-CoA, which is the last step in the lysine degradation pathway (PMID: 23141293 ). Aging, diabetes, sepsis and renal failure are known to ...
http://www.hmdb.ca/metabolites/HMDB0000510
Test | Invitae Glutaric Acidemia Type I TestTest | Invitae Glutaric Acidemia Type I Test
Genetic testing for the GCDH gene, which is associated with glutaric aciduria type I (GA1) and elevated C5-DC on newborn screening (NBS) or acylcarnitine analysis.
https://www.invitae.com/en/physician/tests/06195/
RCSB PDB for 1E5QRCSB PDB for 1E5Q
1E5Q: Crystal Structure of Saccharopine Reductase from Magnaporthe Grisea, an Enzyme of the Alpha-Aminoadipate Pathway of Lysine Biosynthesis
http://www.rcsb.org/pdb/explore/biologyAndChemistry.do?structureId=1E5Q
3-methylglutaconic aciduria type I
3-methylglutaconic aciduria type 1 (3MGA1) is a genetic disorder in which the body cannot get energy from a substance called leucine. Leucine is one of the amino acids, which are the building blocks of proteins in our bodies. Because people with 3MGA1 cant break down leucine for energy to support muscle function and growth, they have a variety of symptoms that are present at birth. These symptoms may include developmental delays, seizures, muscle twitches (dystonia), and muscle weakness.. 3MGA1 is caused by a mutation (change) to the AUH gene, which produces a protein to break down leucine. When there is a mutation to the AUH gene, this protein either isnt produced or isnt functional, so the body cant get energy from leucine. Under normal conditions, the protein is present in the part of the cell that produces energy (the mitochondria), so 3MGA1 is a type of mitochondrial disease. 3MGA1 is also an organic acid condition because it causes harmful 3-methylglutaconic acid build up in the ...
http://diseaseinfosearch.org/3-methylglutaconic+aciduria+type+I/26
Glutaric aciduria type 1 | definition of Glutaric aciduria type 1 by Medical dictionaryGlutaric aciduria type 1 | definition of Glutaric aciduria type 1 by Medical dictionary
Looking for online definition of Glutaric aciduria type 1 in the Medical Dictionary? Glutaric aciduria type 1 explanation free. What is Glutaric aciduria type 1? Meaning of Glutaric aciduria type 1 medical term. What does Glutaric aciduria type 1 mean?
http://medical-dictionary.thefreedictionary.com/Glutaric+aciduria+type+1
2017/18 ICD-10-CM Diagnosis Code E71.313: Glutaric aciduria type II2017/18 ICD-10-CM Diagnosis Code E71.313: Glutaric aciduria type II
Free, official coding info for 2018 ICD-10-CM E71.313 - includes detailed rules, notes, synonyms, ICD-9-CM conversion, index and annotation crosswalks, DRG grouping and more.
http://www.icd10data.com/ICD10CM/Codes/E00-E89/E70-E88/E71-/E71.313
List of MeSH codes (D08)List of MeSH codes (D08)
... glycine transaminase MeSH D08.811.913.477.700.535 - leucine transaminase MeSH D08.811.913.477.700.550 - l-lysine 6-transaminase ... l-aminoadipate-semialdehyde dehydrogenase MeSH D08.811.682.657.163.812 - malonate-semialdehyde dehydrogenase (acetylating) MeSH ... beta-alanine-pyruvate transaminase MeSH D08.811.913.477.700.347 - d-alanine transaminase MeSH D08.811.913.477.700.470 - ... transaminases MeSH D08.811.913.477.700.100 - alanine transaminase MeSH D08.811.913.477.700.120 - 2-aminoadipate transaminase ...
https://en.wikipedia.org/wiki/List_of_MeSH_codes_(D08)
List of EC numbers (EC 2)List of EC numbers (EC 2)
... aspartate transaminase EC 2.6.1.2: alanine transaminase EC 2.6.1.3: cysteine transaminase EC 2.6.1.4: glycine transaminase EC ... D-amino-acid transaminase EC 2.6.1.11: acetylornithine transaminase EC 2.6.1.12: alanine-oxo-acid transaminase EC 2.6.1.13: ... UDP-N-acetylbacillosamine transaminase EC 2.6.1.35: glycine-oxaloacetate transaminase EC 2.6.1.36: L-lysine 6-transaminase EC ... glutamine-phenylpyruvate transaminase EC 2.6.1.65: N6-acetyl-β-lysine transaminase EC 2.6.1.66: valine-pyruvate transaminase EC ...
https://en.wikipedia.org/wiki/List_of_EC_numbers_(EC_2)
2-aminoadipate transaminase2-aminoadipate transaminase
... glutamic-ketoadipic transaminase, and glutamate-alpha-ketoadipate transaminase. This enzyme participates in lysine biosynthesis ... Matsuda M, Ogur M (1969). "Separation and specificity of the yeast glutamate-alpha-ketoadipate transaminase". J. Biol. Chem. ... This enzyme belongs to the family of transferases, specifically the transaminases, which transfer nitrogenous groups. The ... Other names in common use include alpha-aminoadipate aminotransferase, 2-aminoadipate aminotransferase, 2-aminoadipic ...
https://en.wikipedia.org/wiki/2-aminoadipate_transaminase
Lysine-pyruvate 6-transaminaseLysine-pyruvate 6-transaminase
In enzymology, a lysine-pyruvate 6-transaminase (EC 2.6.1.71) is an enzyme that catalyzes the chemical reaction L-lysine + ... This enzyme belongs to the family of transferases, specifically the transaminases, which transfer nitrogenous groups. The ... 49 (2): 203-206. doi:10.1111/j.1574-6968.1988.tb02716.x. Portal: Biology v t e (EC 2.6.1, Enzymes of unknown structure, All ... L-2-aminoadipate 6-semialdehyde + L-alanine Thus, the two substrates of this enzyme are L-lysine and pyruvate, whereas its two ...
https://en.wikipedia.org/wiki/Lysine—pyruvate_6-transaminase
L-lysine 6-transaminaseL-lysine 6-transaminase
... belongs to the aminotransferase class-III family. Crystal structures of L-lysine 6-transaminase reveal ... In enzymology, a L-lysine 6-transaminase (EC 2.6.1.36) is an enzyme that catalyzes the chemical reaction L-lysine + 2- ... This enzyme belongs to the family of transferases, specifically the transaminases, which transfer nitrogenous groups. This ... Other names in common use include lysine 6-aminotransferase, lysine epsilon-aminotransferase, lysine epsilon-transaminase, ...
https://en.wikipedia.org/wiki/L-lysine_6-transaminase
AADATAADAT
It converts alpha-aminoadipate to alpha-ketoadipate. It is also one of the Kynurenine-oxoglutarate transaminases. GRCh38: ... Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial, also known as alpha-aminoadipate aminotransferase and kynurenine ... PDBe-KB provides an overview of all the structure information available in the PDB for Human Kynurenine/alpha-aminoadipate ... "Characterization of the human gene encoding alpha-aminoadipate aminotransferase (AADAT)". Molecular Genetics and Metabolism. 76 ...
https://en.wikipedia.org/wiki/AADAT
Kynurenine-oxoglutarate transaminaseKynurenine-oxoglutarate transaminase
Han Q, Cai T, Tagle DA, Robinson H, Li J (August 2008). "Substrate specificity and structure of human aminoadipate ... Han Q, Cai T, Tagle DA, Robinson H, Li J (August 2008). "Substrate specificity and structure of human aminoadipate ... In enzymology, a kynurenine-oxoglutarate transaminase (EC 2.6.1.7) is an enzyme that catalyzes the chemical reaction L- ... This enzyme belongs to the family of transferases, to be specific, the transaminases, that transfer nitrogenous groups. The ...
https://en.wikipedia.org/wiki/Kynurenine—oxoglutarate_transaminase
Kynurenic acidKynurenic acid
It is formed from L-kynurenine in a reaction catalyzed by the enzyme kynurenine-oxoglutarate transaminase. KYNA has been ... "Substrate specificity and structure of human aminoadipate aminotransferase/kynurenine aminotransferase II". Bioscience Reports ... 92 (1-2): 203-9. doi:10.1016/j.physbeh.2007.05.025. PMID 17573079. S2CID 46156877. Erhardt S, Schwieler L, Engberg G (2003). " ... 330 (2): 265-72. doi:10.1016/0006-8993(85)90685-7. PMID 2985194. S2CID 24345638. Hilmas C, Pereira EF, Alkondon M, Rassoulpour ...
https://en.wikipedia.org/wiki/Kynurenic_acid
BiosynthesisBiosynthesis
There are two distinct lysine biosynthetic pathways: the diaminopimelic acid pathway and the α-aminoadipate pathway. The most ... "MetaCyc: L-lysine biosynthesis I". PETERKOFSKY, B; GILVARG, C (May 1961). "N-Succinyl-L-diaminopimelic-glutamic transaminase". ... This reaction that removes the 2'-OH of the ribose sugar to generate deoxyribose is not affected by the bases attached to the ... 10 (2): 113-127. doi:10.1038/nrm2838. PMC 4461372. PMID 20094052. Green, Rachel; Harry F. Noller; et al. (1997). "Ribosomes and ...
https://en.wikipedia.org/wiki/Biosynthesis
Finding step lysJ for L-lysine biosynthesis in Desulfovibrio vulgaris HildenboroughFinding step lysJ for L-lysine biosynthesis in Desulfovibrio vulgaris Hildenborough
Curated proteins matching [LysW]-aminoadipate semialdehyde transaminase. *Curated proteins matching [LysW]-aminoadipate ... LysW]-aminoadipate semialdehyde transaminase; EC 2.6.1.- (uncharacterized). 35%. 81%. 150.6. glutamate-1-semialdehyde 2,1- ... Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase; EC 2.6.1.- (uncharacterized). 33%. 57%. 99. ... Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase; EC 2.6.1.-; EC 2.6.1.118 (characterized, see ...
https://papers.genomics.lbl.gov/cgi-bin/gapView.cgi?orgs=orgsFit&set=aa&orgId=MicrobesOnline__882&path=lys&step=lysJ
B6db activities : 2 6 1 105B6db activities : 2 6 1 105
EC 2.6.1.62, adenosylmethionine 8-amino-7-oxononanoate transaminase).. The second product of the reaction, (S)-2-amino-6- ... Lysine--8-amino-7-oxononanoate transaminase. Alternative names. DAPA aminotransferase (ambiguous);. bioA (gene name) (ambiguous ... L-lysine + 8-amino-7-oxononanoate = (S)-2-amino-6-oxohexanoate + 7,8-diaminononanoate.. ...
http://bioinformatics.unipr.it/cgi-bin/bioinformatics/B6db/activity.pl/Show?_id=2_6_1_105
HOMD :: SEQF3145HOMD :: SEQF3145
2-aminoadipate transaminase. 64. SEQF3145,RYFV01000011.1. SEQF3145_00065 jb [NA] [AA] 957/318. 77403-78359. D-alanine--D- ... Acyl-CoA thioesterase 2. 99. SEQF3145,RYFV01000012.1. SEQF3145_00100 jb [NA] [AA] 1698/565. 32130-30433. Phosphoenolpyruvate- ... 2-succinyl-6-hydroxy-2%2C4-cyclohexadiene-1-carboxylate synthase. 24. SEQF3145,RYFV01000011.1. SEQF3145_00024 jb [NA] [AA] 600/ ... tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase. 173. SEQF3145,RYFV01000013.1. SEQF3145_00181 jb [NA] [AA] 1077/358. ...
https://homd.org/genome/explorer?gid=SEQF3145&anno=prokka
Model Search | BioModelsModel Search | BioModels
L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (3) * V-type proton ATPase subunit D (3) ... Probable kynurenine--oxoglutarate transaminase BNA3 (3) * Cystathionine gamma-synthase (3) * Thioredoxin-3, mitochondrial (3) ... Dolichyl-phosphate-mannose--protein mannosyltransferase 2 (4) * 2,5-diamino-6-ribosylamino-4(3H)-pyrimidinone 5'-phosphate ... 1-phosphatidylinositol 3-phosphate 5-kinase FAB1 (2) * Putative inosine-5'-monophosphate dehydrogenase-like protein YAR075W (2 ...
https://www.ebi.ac.uk/biomodels/search?query=CHEBI:CHEBI:18319
EnzymeEnzyme
Alanine transaminase. Alanine--glyoxylate transaminase. Alanine--oxo-acid transaminase. Alanine--oxomalonate transaminase. ... Aminoadipate-semialdehyde dehydrogenase. Aminobenzoate decarboxylase. Aminobutyraldehyde dehydrogenase. Aminocarboxymuconate- ... Asparagine--oxo-acid transaminase. Asparagine--tRNA ligase. Asparaginyl-tRNA synthase (glutamine-hydrolyzing). Asparagusate ... Aspartate transaminase. Aspartate--ammonia ligase. Aspartate--ammonia ligase (ADP-forming). Aspartate--phenylpyruvate ...
https://www.changbioscience.com/enzyme/ea.htm
MMTBMMTB
2.6.1.5 tyrosine transaminase 2.6.1.51 serine---pyruvate transaminase 2.6.1.58 phenylalanine(histidine) transaminase - - - - - ... 2.6.1.2 alanine transaminase 2.6.1.44 alanine---glyoxylate transaminase 2.6.1.7 kynurenine---oxoglutarate transaminase - - - - ... 2.6.1.18 beta-alanine---pyruvate transaminase 2.6.1.2 alanine transaminase 2.6.1.4 glycine transaminase 2.6.1.40 (R)-3-amino-2- ... 2.6.1.51 serine---pyruvate transaminase 2.6.1.84 arginine---pyruvate transaminase 2.6.1.9 histidinol-phosphate transaminase - - ...
https://metano.tu-bs.de/search/L-alanine =
Protein CCNA 00620 in Caulobacter crescentus NA1000Protein CCNA 00620 in Caulobacter crescentus NA1000
Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase; EC 2.6.1.-; EC 2.6.1.118 (characterized, see ... Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase; EC 2.6.1.-; EC 2.6.1.118 (characterized, see ... Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase; EC 2.6.1.-; EC 2.6.1.118 (characterized, see ... Succinylornithine transaminase; SOAT; Succinylornithine aminotransferase; EC 2.6.1.81. 49%. 341.7. L-proline biosynthesis. argD ...
https://papers.genomics.lbl.gov/cgi-bin/gapView.cgi?orgs=orgsFit&set=aa&orgId=FitnessBrowser__Caulo&locusId=CCNA_00620
MMTBMMTB
1.2.1.31 L-aminoadipate-semialdehyde dehydrogenase 1.2.1.48 long-chain-aldehyde dehydrogenase 1.2.1.5 aldehyde dehydrogenase [ ... 2.6.1.18 beta-alanine---pyruvate transaminase - BRENDA: BS422438 benzaldehyde + 2-oxoglutarate <=> (5R)-5-hydroxy-4-oxo-5- ... S)-2-nitro-1-phenylethanol <=> Nitromethane + benzaldehyde + (R)-2-nitro-1-phenylethanol 4.1.2.47 (S)-hydroxynitrile lyase - ... benzaldehyde + acetaldehyde <=> (R)-benzoin + (S)-2-Hydroxypropiophenone 4.1.1.7 benzoylformate decarboxylase - BRENDA: ...
https://mmtb.tu-bs.de/search/benzaldehyde =
L-proline biosynthesis in Sinorhizobium meliloti 1021L-proline biosynthesis in Sinorhizobium meliloti 1021
... glutamate semialdehyde transaminase. SMc02138. SM_b21186. lysK. [LysW]-lysine hydrolase / [LysW]-ornithine hydrolase. ... LysW]-2-aminoadipate 6-phosphate reductase / [LysW]-glutamylphosphate reductase. lysZ. [LysW]-2-aminoadipate 6-kinase / [LysW]- ... there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, ...
https://papers.genomics.lbl.gov/cgi-bin/gapView.cgi?orgs=orgsFit&set=aa&orgId=FitnessBrowser__Smeli&path=pro
i5k - EOG8RNDVBi5k - EOG8RNDVB
transaminase activity. 4. GO:0047536. 2-aminoadipate transaminase activity. 1. GO:0003700. transcription factor activity, ...
https://i5k.gitlab.io/ArthroFam-fams-2/EOG8RNDVB.html
Protein 3607958 in Dinoroseobacter shibae DFL-12Protein 3607958 in Dinoroseobacter shibae DFL-12
LysW]-aminoadipate semialdehyde transaminase; EC 2.6.1.- (uncharacterized). 31%. 94%. 193.7. beta-alanine-pyruvate transaminase ... LysW]-aminoadipate semialdehyde transaminase; EC 2.6.1.- (uncharacterized). 31%. 94%. 193.7. beta-alanine-pyruvate transaminase ... LysW]-aminoadipate semialdehyde transaminase; EC 2.6.1.- (uncharacterized). 31%. 94%. 193.7. beta-alanine-pyruvate transaminase ... beta-alanine-pyruvate transaminase (EC 2.6.1.18). 65%. 568.5. L-proline biosynthesis. argD. lo. Acetylornithine ...
https://papers.genomics.lbl.gov/cgi-bin/gapView.cgi?orgs=orgsFit&set=aa&orgId=FitnessBrowser__Dino&locusId=3607958
YJR139C 267.488705 INESSENTIAL HOM6 Homoserine dehydrogenase (L-homoserine:NADP oxidoreductase),5-amino-6-(5...YJR139C 267.488705 INESSENTIAL HOM6 "Homoserine dehydrogenase (L-homoserine:NADP oxidoreductase),5-amino-6-(5...
... "aminoadipate-semialdehyde dehydrogenase small subunit (alpha-aminoadipate reductase), amino acid biosynthesis, aminoadipate- ... "phosphoserine transaminase,phosphoserine aminotransferase," YHR025W 143.39381 INESSENTIAL THR1 "homoserine kinase,homoserine ... transaminase (4-aminobutyrate aminotransferase),4-aminobutyrate aminotransferase, " YGR072W 8.896687 INESSENTIAL UPF3 "involved ... "Branched-Chain Amino Acid Transaminase,branched-chain amino acid aminotransferase," YEL065W -0.945446 INESSENTIAL SIT1 " ...
https://genomics.lbl.gov/YeastFitnessData/websitefiles/ratioresults/thrRatio_07.txt
Aspartate Aminotransferases | Profiles RNSAspartate Aminotransferases | Profiles RNS
Transaminase, Glutamic-Oxaloacetic. *L-Aspartate-2-Oxoglutarate Aminotransferase. *Aminotransferase, L-Aspartate-2-Oxoglutarate ... Enzymes of the transferase class that catalyze the conversion of L-aspartate and 2-ketoglutarate to oxaloacetate and L- ... Wimborne HJ, Hu J, Takemoto K, Nguyen NT, Jaeschke H, Lemasters JJ, Zhong Z. Aldehyde dehydrogenase-2 activation decreases ... attenuate staphylococcal enterotoxin B-mediated liver injury by downregulating miR-31 expression and promoting caspase-2- ...
https://profiles.musc.edu/display/101132/
Tryptophan Transaminase | Profiles RNSTryptophan Transaminase | Profiles RNS
"Tryptophan Transaminase" is a descriptor in the National Library of Medicine's controlled vocabulary thesaurus, MeSH (Medical ... This graph shows the total number of publications written about "Tryptophan Transaminase" by people in this website by year, ... Below are the most recent publications written about "Tryptophan Transaminase" by people in Profiles. ... Below are MeSH descriptors whose meaning is more general than "Tryptophan Transaminase". ...
https://researchers.childrensmercy.org/display/26048
ISMARA results: LHX6ISMARA results: LHX6
aminoadipate aminotransferase. chr3_+_108541545. 0.13. ENST00000295756.6. TRAT1. T cell receptor associated transmembrane ... LIM domain only 2 (rhombotin-like 1). chr11_+_67798090. 0.13. ENST00000313468.5. NDUFS8. NADH dehydrogenase (ubiquinone) Fe-S ... thymidine kinase 2, mitochondrial. chr14_+_104182105. 0.07. ENST00000311141.2. ZFYVE21. zinc finger, FYVE domain containing 21 ... NudC domain containing 2. chr12_+_95611569. 0.08. ENST00000261219.6. ENST00000551472.1. ENST00000552821.1. VEZT. vezatin, ...
https://www.ismara.unibas.ch/ISMARA/scratch/NHBE_SC2/ismara_report/pages/LHX6.html
Curated BLASTCurated BLAST
Dsui_2708: succinyldiaminopimelate transaminase. is similar to:. PaperBLAST. ArAT1 / D7F4K3: aromatic amino acid transaminase ( ... ARO8_YEAST / P53090: Aromatic/aminoadipate aminotransferase 1; 2-aminoadipate aminotransferase; 2-aminoadipate transaminase; ... tyrB / GB,AAC77024.1: aromatic-amino-acid transaminase TyrB; EC 2.6.1.57 from Escherichia coli. tyrB / P04693: tyrosine ... tyrB / GB,AAC77024.1: aromatic-amino-acid transaminase TyrB; EC 2.6.1.57 from Escherichia coli. tyrB / P04693: tyrosine ...
https://papers.genomics.lbl.gov/cgi-bin/genomeSearch.cgi?gdb=FitnessBrowser&gid=PS&query=2.6.1.57&word=1
KEGG ORTHOLOGY: K05830KEGG ORTHOLOGY: K05830
2.6.1 Transaminases. 2.6.1.118 [amino-group carrier protein]-gamma-(L-lysyl)-L-glutamate aminotransferase. K05830 lysJ, argD; [ ... and evolutionary relationship between arginine biosynthesis and prokaryotic lysine biosynthesis through alpha-aminoadipate. ... Aminotransferase (transaminase). Class III. K05830 lysJ, argD; [amino-group carrier protein]-gamma-(L-lysyl/L-ornithyl)-L- ... Ontology (5) KEGG BRITE (3) COG (2) Pathway (14) KEGG PATHWAY (12) KEGG MODULE (2) Chemical reaction (6) KEGG ENZYME (2) KEGG ...
https://www.genome.jp/entry/K05830
Aligments for a candidate for lysN in Pseudomonas fluorescens FW300-N1B4Aligments for a candidate for lysN in Pseudomonas fluorescens FW300-N1B4
Transaminase A; EC 2.6.1.1; EC 2.6.1.39 (characterized) to candidate Pf1N1B4_4425 Aspartate aminotransferase (EC 2.6.1.1) ... Align Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; ... 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: ... there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, ...
https://papers.genomics.lbl.gov/cgi-bin/gapView.cgi?orgs=orgsFit&set=carbon&orgId=FitnessBrowser__pseudo1_N1B4&path=lysine&step=lysN&locusId=Pf1N1B4_4425
Model Search | BioModelsModel Search | BioModels
L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (3) * V-type proton ATPase subunit D (3) ... Probable kynurenine--oxoglutarate transaminase BNA3 (3) * Cystathionine gamma-synthase (3) * Thioredoxin-3, mitochondrial (3) ... Dolichyl-phosphate-mannose--protein mannosyltransferase 2 (4) * 2,5-diamino-6-ribosylamino-4(3H)-pyrimidinone 5'-phosphate ... 1-phosphatidylinositol 3-phosphate 5-kinase FAB1 (2) * Putative inosine-5'-monophosphate dehydrogenase-like protein YAR075W (2 ...
https://www.ebi.ac.uk/biomodels/search?query=CHEBI:CHEBI:16566
L-arginine biosynthesis in Sinorhizobium meliloti 1021L-arginine biosynthesis in Sinorhizobium meliloti 1021
... glutamate semialdehyde transaminase. SMc02138. SM_b21186. lysK. [LysW]-lysine hydrolase / [LysW]-ornithine hydrolase. ... LysW]-2-aminoadipate 6-kinase / [LysW]-glutamate kinase. SMc01726. Confidence: high confidence medium confidence low confidence ... 2-aminoadipate/glutamate carrier protein. lysY. [LysW]-2-aminoadipate 6-phosphate reductase / [LysW]-glutamylphosphate ... there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, ...
https://papers.genomics.lbl.gov/cgi-bin/gapView.cgi?orgs=orgsFit&set=aa&orgId=FitnessBrowser__Smeli&path=arg
L-lysine biosynthesis in Phaeobacter inhibens BS107L-lysine biosynthesis in Phaeobacter inhibens BS107
... lysZYJ convert LysW-aminoadipate to LysW-lysine, and lysK releases lysine. ... glutamate semialdehyde transaminase. PGA1_c24230. PGA1_c28750. ... Comment: 2-oxoglutarate and acetyl-CoA are converted to ... 2-aminoadipate-LysW ligase. lysY. [LysW]-2-aminoadipate 6-phosphate reductase / [LysW]-glutamylphosphate reductase. PGA1_c17050 ... LysW]-2-aminoadipate 6-kinase / [LysW]-glutamate kinase. PGA1_c02050. Confidence: high confidence medium confidence low ...
https://papers.genomics.lbl.gov/cgi-bin/gapView.cgi?orgs=orgsFit&set=aa&path=lys&orgId=FitnessBrowser__Phaeo
DeCSDeCS
Glutamine fructose 6-phosphate transaminase (isomerizing) [D08.811.913.477.700.500] Glutamine fructose 6-phosphate transaminase ... aminoadipate aminotransférase 2-aminoadipate: 2-oxoglutarate aminotransférase AadAT alpha-Aminoadipate aminotransférase ... aminoadipate aminotransférase. 2-aminoadipate: 2-oxoglutarate aminotransférase. AadAT. alpha-Aminoadipate aminotransférase. ... 2-aminoadipato transaminasa. Note dapplication:. Enzima que contiene PIRIDOXAL FOSFATO que cataliza la transferencia del grupo ...
https://decs.bvsalud.org/fr/ths/resource/?id=50689
i5k - EOG8RNDVB
transaminase activity. 4. GO:0047536. 2-aminoadipate transaminase activity. 1. GO:0003700. transcription factor activity, ...
https://i5k.gitlab.io/ArthroFam-fams-2/EOG8RNDVB.html
Aligments for a candidate for lysN in Pseudomonas fluorescens FW300-N1B4
Transaminase A; EC 2.6.1.1; EC 2.6.1.39 (characterized) to candidate Pf1N1B4_4425 Aspartate aminotransferase (EC 2.6.1.1) ... Align Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; ... 2 Number of sequences better than 1.0e-02: 1 Number of HSPs gapped: 1 Number of HSPs successfully gapped: 1 Length of query: ... there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, ...
https://papers.genomics.lbl.gov/cgi-bin/gapView.cgi?orgs=orgsFit&set=carbon&orgId=FitnessBrowser__pseudo1_N1B4&path=lysine&step=lysN&locusId=Pf1N1B4_4425
ISMARA results: LHX6ISMARA results: LHX6
aminoadipate aminotransferase. chr3_+_108541545. 0.13. ENST00000295756.6. TRAT1. T cell receptor associated transmembrane ... LIM domain only 2 (rhombotin-like 1). chr11_+_67798090. 0.13. ENST00000313468.5. NDUFS8. NADH dehydrogenase (ubiquinone) Fe-S ... thymidine kinase 2, mitochondrial. chr14_+_104182105. 0.07. ENST00000311141.2. ZFYVE21. zinc finger, FYVE domain containing 21 ... NudC domain containing 2. chr12_+_95611569. 0.08. ENST00000261219.6. ENST00000551472.1. ENST00000552821.1. VEZT. vezatin, ...
https://www.ismara.unibas.ch/ISMARA/scratch/NHBE_SC2/ismara_report/pages/LHX6.html
DeCS 2011 - December 22, 2011 versionDeCS 2011 - December 22, 2011 version
4-Aminobutyrate Transaminase 4-Aminobutyric Acid use gamma-Aminobutyric Acid 4-Aminohippuric Acid use p-Aminohippuric Acid ... 2-Amino-5-phosphonovaleric Acid use 2-Amino-5-phosphonovalerate 2-Amino-6-(1,2,3-trihydroxypropyl)-4(3H)-pteridinone use ... 2-Dehydro-3-Deoxyphosphoheptonate Aldolase use 3-Deoxy-7-Phosphoheptulonate Synthase 2-Fluoro-2-deoxy-D-glucose use ... 2,6-Dichlorophenolindophenol use 2,6-Dichloroindophenol 3 beta-Hydroxy-delta-5-Steroid Dehydrogenase use Progesterone Reductase ...
https://decs.bvs.br/I/DeCS2011_Alfab-0a9.htm
Bio2Vec
1D-1-guanidino-3-amino-1,3-dideoxy-scyllo-inositol transaminase activity ...
https://bio2vec.cbrc.kaust.edu.sa/bio2vec/details/1?iri=GO:0036136
DeCS 2014 - December 16, 2014 version
4-Aminobutyrate Transaminase 4-Aminobutyric Acid use gamma-Aminobutyric Acid 4-Aminohippuric Acid use p-Aminohippuric Acid ... 2-Amino-5-phosphonovaleric Acid use 2-Amino-5-phosphonovalerate 2-Amino-6-(1,2,3-trihydroxypropyl)-4(3H)-pteridinone use ... 2-Dehydro-3-Deoxyphosphoheptonate Aldolase use 3-Deoxy-7-Phosphoheptulonate Synthase 2-Fluoro-2-deoxy-D-glucose use ... 2,6-Dichlorophenolindophenol use 2,6-Dichloroindophenol 3 beta-Hydroxy-delta-5-Steroid Dehydrogenase use Progesterone Reductase ...
https://decs2016.bvsalud.org/I/DeCS2014_Alfab-0a9.htm
DeCS 2011 - December 22, 2011 version
4-Aminobutyrate Transaminase 4-Aminobutyric Acid use gamma-Aminobutyric Acid 4-Aminohippuric Acid use p-Aminohippuric Acid ... 2-Amino-5-phosphonovaleric Acid use 2-Amino-5-phosphonovalerate 2-Amino-6-(1,2,3-trihydroxypropyl)-4(3H)-pteridinone use ... 2-Dehydro-3-Deoxyphosphoheptonate Aldolase use 3-Deoxy-7-Phosphoheptulonate Synthase 2-Fluoro-2-deoxy-D-glucose use ... 2,6-Dichlorophenolindophenol use 2,6-Dichloroindophenol 3 beta-Hydroxy-delta-5-Steroid Dehydrogenase use Progesterone Reductase ...
https://decs2018.bvsalud.org/I/DeCS2011_Alfab-0a9.htm
DeCS 2014 - December 16, 2014 version
4-Aminobutyrate Transaminase 4-Aminobutyric Acid use gamma-Aminobutyric Acid 4-Aminohippuric Acid use p-Aminohippuric Acid ...
https://decs2019.bvsalud.org/I/DeCS2014_Alfab-0a9.htm
DeCS 2011 - December 22, 2011 version
4-Aminobutyrate Transaminase 4-Aminobutyric Acid use gamma-Aminobutyric Acid 4-Aminohippuric Acid use p-Aminohippuric Acid ... 2-Amino-5-phosphonovaleric Acid use 2-Amino-5-phosphonovalerate 2-Amino-6-(1,2,3-trihydroxypropyl)-4(3H)-pteridinone use ... 2-Dehydro-3-Deoxyphosphoheptonate Aldolase use 3-Deoxy-7-Phosphoheptulonate Synthase 2-Fluoro-2-deoxy-D-glucose use ... 2,6-Dichlorophenolindophenol use 2,6-Dichloroindophenol 3 beta-Hydroxy-delta-5-Steroid Dehydrogenase use Progesterone Reductase ...
https://decs2012.bvsalud.org/I/DeCS2011_Alfab-0a9.htm
DeCS 2016 - July 28, 2016 version
4-Aminobutyrate Transaminase 4-Aminobutyric Acid use gamma-Aminobutyric Acid 4-Aminohippuric Acid use p-Aminohippuric Acid ... 2-Amino-5-phosphonovaleric Acid use 2-Amino-5-phosphonovalerate 2-Amino-6-(1,2,3-trihydroxypropyl)-4(3H)-pteridinone use ... 2-Dehydro-3-Deoxyphosphoheptonate Aldolase use 3-Deoxy-7-Phosphoheptulonate Synthase 2-Fluoro-2-deoxy-D-glucose use ... 2,6-Dichlorophenolindophenol use 2,6-Dichloroindophenol 3 beta-Hydroxy-delta-5-Steroid Dehydrogenase use Progesterone Reductase ...
https://decs2017.bvsalud.org/I/DeCS2016_Alfab-0a9.htm
DeCS 2009 - February 20, 2009 version
4-Aminobutyrate Transaminase 4-Aminobutyric Acid use gamma-Aminobutyric Acid 4-Aminohippuric Acid use p-Aminohippuric Acid ... 2-Fluoro-2-deoxyglucose use Fluorodeoxyglucose F18 2H-Benzo(a)quinolizin-2-ol, 2-Ethyl-1,3,4,6,7,11b-hexahydro-3-isobutyl-9,10- ... 2-Amino-5-phosphonovaleric Acid use 2-Amino-5-phosphonovalerate 2-Amino-6-(1,2,3-trihydroxypropyl)-4(3H)-pteridinone use ... 2-Oxoisovalerate Dehydrogenase (Lipoamide) use 3-Methyl-2-Oxobutanoate Dehydrogenase (Lipoamide) 2-PAM Compounds use ...
https://decs2009.bvsalud.org/I/DeCS2009_Alfab-0a9_ing.htm
DeCS 2010 - February 12, 2010 version
4-Aminobutyrate Transaminase 4-Aminobutyric Acid use gamma-Aminobutyric Acid 4-Aminohippuric Acid use p-Aminohippuric Acid ... 2-Amino-5-phosphonovaleric Acid use 2-Amino-5-phosphonovalerate 2-Amino-6-(1,2,3-trihydroxypropyl)-4(3H)-pteridinone use ... 2-Dehydro-3-Deoxyphosphoheptonate Aldolase use 3-Deoxy-7-Phosphoheptulonate Synthase 2-Fluoro-2-deoxy-D-Glucose use ... 2,6-Dichlorophenolindophenol use 2,6-Dichloroindophenol 3 beta-Hydroxy-delta-5-Steroid Dehydrogenase use Progesterone Reductase ...
https://decs2010.bvsalud.org/I/DeCS2010_Alfab-0a9.htm
DeCS 2009 - February 20, 2009 version
4-Aminobutyrate Transaminase 4-Aminobutyric Acid use gamma-Aminobutyric Acid 4-Aminohippuric Acid use p-Aminohippuric Acid ... 2-Fluoro-2-deoxyglucose use Fluorodeoxyglucose F18 2H-Benzo(a)quinolizin-2-ol, 2-Ethyl-1,3,4,6,7,11b-hexahydro-3-isobutyl-9,10- ... 2-Amino-5-phosphonovaleric Acid use 2-Amino-5-phosphonovalerate 2-Amino-6-(1,2,3-trihydroxypropyl)-4(3H)-pteridinone use ... 2-Oxoisovalerate Dehydrogenase (Lipoamide) use 3-Methyl-2-Oxobutanoate Dehydrogenase (Lipoamide) 2-PAM Compounds use ...
https://decs2011.bvsalud.org/I/DeCS2009_Alfab-0a9_ing.htm
DeCS 2012 - February 22, 2012 version
4-Aminobutyrate Transaminase 4-Aminobutyric Acid use gamma-Aminobutyric Acid 4-Aminohippuric Acid use p-Aminohippuric Acid ... 2-Amino-5-phosphonovaleric Acid use 2-Amino-5-phosphonovalerate 2-Amino-6-(1,2,3-trihydroxypropyl)-4(3H)-pteridinone use ... 2-Dehydro-3-Deoxyphosphoheptonate Aldolase use 3-Deoxy-7-Phosphoheptulonate Synthase 2-Fluoro-2-deoxy-D-glucose use ... 2,6-Dichlorophenolindophenol use 2,6-Dichloroindophenol 3 beta-Hydroxy-delta-5-Steroid Dehydrogenase use Progesterone Reductase ...
https://decs2020.bvsalud.org/I/DeCS2012_Alfab-0a9.htm
DeCS 2013 - July 15, 2013 version
4-Aminobutyrate Transaminase 4-Aminobutyric Acid use gamma-Aminobutyric Acid 4-Aminohippuric Acid use p-Aminohippuric Acid ... 2-Amino-5-phosphonovaleric Acid use 2-Amino-5-phosphonovalerate 2-Amino-6-(1,2,3-trihydroxypropyl)-4(3H)-pteridinone use ... 2-Dehydro-3-Deoxyphosphoheptonate Aldolase use 3-Deoxy-7-Phosphoheptulonate Synthase 2-Fluoro-2-deoxy-D-glucose use ... 2,6-Dichlorophenolindophenol use 2,6-Dichloroindophenol 3 beta-Hydroxy-delta-5-Steroid Dehydrogenase use Progesterone Reductase ...
https://decs2013.bvsalud.org/I/DeCS2013_Alfab-0a9.htm
DeCS 2013 - December 17, 2013 version
4-Aminobutyrate Transaminase 4-Aminobutyric Acid use gamma-Aminobutyric Acid 4-Aminohippuric Acid use p-Aminohippuric Acid ... 2-Amino-5-phosphonovaleric Acid use 2-Amino-5-phosphonovalerate 2-Amino-6-(1,2,3-trihydroxypropyl)-4(3H)-pteridinone use ... 2-Dehydro-3-Deoxyphosphoheptonate Aldolase use 3-Deoxy-7-Phosphoheptulonate Synthase 2-Fluoro-2-deoxy-D-glucose use ... 2,6-Dichlorophenolindophenol use 2,6-Dichloroindophenol 3 beta-Hydroxy-delta-5-Steroid Dehydrogenase use Progesterone Reductase ...
https://decs2014.bvsalud.org/I/DeCS2013_Alfab-0a9.htm
DeCS 2012 - February 22, 2012 version
4-Aminobutyrate Transaminase 4-Aminobutyric Acid use gamma-Aminobutyric Acid 4-Aminohippuric Acid use p-Aminohippuric Acid ... 2-Amino-5-phosphonovaleric Acid use 2-Amino-5-phosphonovalerate 2-Amino-6-(1,2,3-trihydroxypropyl)-4(3H)-pteridinone use ... 2-Dehydro-3-Deoxyphosphoheptonate Aldolase use 3-Deoxy-7-Phosphoheptulonate Synthase 2-Fluoro-2-deoxy-D-glucose use ... 2,6-Dichlorophenolindophenol use 2,6-Dichloroindophenol 3 beta-Hydroxy-delta-5-Steroid Dehydrogenase use Progesterone Reductase ...
https://decs2015.bvsalud.org/I/DeCS2012_Alfab-0a9.htm
MMTBMMTB
2.6.1.74 cephalosporin-C transaminase - BRENDA: BS356888 D-Aspartate + 2-oxoadipate <=> oxaloacetate + 2-Aminoadipate 2.6.1.74 ... 1.2.1.31 L-aminoadipate-semialdehyde dehydrogenase - - BRENDA: BS396383 D-serine + 2-oxoadipate <=> Hydroxypyruvate + 2- ... ATP + 2-Aminoadipate + L-cysteine <=> ADP + phosphate + DL-aminoadipyl-L-cysteine 6.3.2.2 glutamate---cysteine ligase - ... 2-piperidone-6-carboxylate + ATP + H2O <=> 2-Aminoadipate + phosphate + ADP 3.5.2.9 5-oxoprolinase (ATP-hydrolysing) - ...
https://mmtb.tu-bs.de/search/2-Aminoadipate%20=
MMTBMMTB
2.6.1.5 tyrosine transaminase 2.6.1.51 serine---pyruvate transaminase 2.6.1.58 phenylalanine(histidine) transaminase - - - - - ... 2.6.1.2 alanine transaminase 2.6.1.44 alanine---glyoxylate transaminase 2.6.1.7 kynurenine---oxoglutarate transaminase - - - - ... 2.6.1.18 beta-alanine---pyruvate transaminase 2.6.1.2 alanine transaminase 2.6.1.4 glycine transaminase 2.6.1.40 (R)-3-amino-2- ... 2.6.1.51 serine---pyruvate transaminase 2.6.1.84 arginine---pyruvate transaminase 2.6.1.9 histidinol-phosphate transaminase - - ...
https://metano.tu-bs.de/search/L-alanine%20=
Tryptophan Transaminase | Colorado PROFILES
"Tryptophan Transaminase" is a descriptor in the National Library of Medicines controlled vocabulary thesaurus, MeSH (Medical ... This graph shows the total number of publications written about "Tryptophan Transaminase" by people in this website by year, ... Below are the most recent publications written about "Tryptophan Transaminase" by people in Profiles. ... Below are MeSH descriptors whose meaning is more general than "Tryptophan Transaminase". ...
https://profiles.ucdenver.edu/display/203545
Human Metabolome Database: HMDB0000978 (4-(2-Aminophenyl)-2,4-dioxobutanoic acid) Protein AssociationsHuman Metabolome Database: HMDB0000978 (4-(2-Aminophenyl)-2,4-dioxobutanoic acid) Protein Associations
Kynurenine--oxoglutarate transaminase 1. Q16773 CCBL1. 9q34.11. Enzyme. Not Available. HMDBP03053. Aminoadipate ... Kynurenine--oxoglutarate transaminase 3. Q6YP21 CCBL2. 1p22.2. Enzyme. Not Available. Displaying all 5 metabolite protein links ... Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial. Q8N5Z0 AADAT. 4q33. Enzyme. Not Available. HMDBP00464. ...
https://hmdb.ca/metabolites/HMDB0000978/metabolite_protein_links
Tryptophan Transaminase | Profiles RNS
"Tryptophan Transaminase" is a descriptor in the National Library of Medicines controlled vocabulary thesaurus, MeSH (Medical ... This graph shows the total number of publications written about "Tryptophan Transaminase" by people in this website by year, ... Below are the most recent publications written about "Tryptophan Transaminase" by people in Profiles. ... Below are MeSH descriptors whose meaning is more general than "Tryptophan Transaminase". ...
https://researchers.childrensmercy.org/display/26048
List of EC numbers (EC 2)List of EC numbers (EC 2)
EC 2, transferases, placed in numerical order as determined by the Nomenclature Committee of the International Union of ... alanine transaminase. *: cysteine transaminase. *: glycine transaminase. *: tyrosine transaminase. *: leucine transaminase. *: ... thyroid-hormone transaminase. *: tryptophan transaminase. *: tryptophan-phenylpyruvate transaminase. *: diamine transaminase. ... b-alanine-pyruvate transaminase. *: 4-aminobutyrate transaminase. *: deleted. *: D-amino acid transaminase. *: (S)-3-amino-2- ...
https://en-academic.com/dic.nsf/enwiki/2736422
KEGG ORTHOLOGY: K05830
2.6.1 Transaminases. 2.6.1.118 [amino-group carrier protein]-gamma-(L-lysyl)-L-glutamate aminotransferase. K05830 lysJ, argD; [ ... and evolutionary relationship between arginine biosynthesis and prokaryotic lysine biosynthesis through alpha-aminoadipate. ... Aminotransferase (transaminase). Class III. K05830 lysJ, argD; [amino-group carrier protein]-gamma-(L-lysyl/L-ornithyl)-L- ... Ontology (5) KEGG BRITE (3) COG (2) Pathway (14) KEGG PATHWAY (12) KEGG MODULE (2) Chemical reaction (6) KEGG ENZYME (2) KEGG ...
https://www.genome.jp/entry/K05830
DeCS 2008 - May 16, 2008 version
4-Aminobutyrate Transaminase. 4-Aminobutyric Acid use gamma-Aminobutyric Acid. 4-Aminohippuric Acid use p-Aminohippuric Acid ... 2H-Benzo(a)quinolizin-2-ol, 2-Ethyl-1,3,4,6,7,11b-hexahydro-3-isobutyl-9,10-dimethoxy- ... 3-Pyridinecarboxylic acid, 1,4-dihydro-2,6-dimethyl-5-nitro-4-(2-(trifluoromethyl)phenyl)-, Methyl ester ... 3,4-Dichloro-N-methyl-N-(2-(1-pyrrolidinyl)-cyclohexyl)-benzeneacetamide, (trans)-Isomer ...
https://decs2008.bvsalud.org/I/DeCS2008_Alfab-0a9_ing.htm
B6db references : 91350058
The levels of glutamate-alpha-ketoadipate transaminase, an enzyme responsible for the conversion of alpha- aminoadipate to ... Use of alpha-aminoadipate and lysine as sole nitrogen source by Schizosaccharomyces pombe and selected pathogenic fungi. ... ketoadipate and alpha-aminoadipate-delta-semialdehyde when grown in medium containing alpha-aminoadipate and lysine, ... Also, 14C-alpha-aminoadipate was converted to 14C-alpha-ketoadipate in vivo. In the ammonium sulfate medium, S. pombe cells ...
http://bioinformatics.unipr.it/cgi-bin/bioinformatics/B6db/bib.pl/Show?91350058
YOR184W 2167.216480 INESSENTIAL SER1 phosphoserine transaminase,phosphoserine aminotransferaseYOR184W 2167.216480 INESSENTIAL SER1 phosphoserine transaminase,phosphoserine aminotransferase
... alpha-aminoadipate reductase), amino acid biosynthesis, aminoadipate-semialdehyde dehydrogenase, cytoplasm YOR303W 1230.967166 ... YOR184W 2167.216480 INESSENTIAL SER1 phosphoserine transaminase,phosphoserine aminotransferase, YJR109C 1533.292175 INESSENTIAL ... transaminase (4-aminobutyrate aminotransferase),4-aminobutyrate aminotransferase, YBR094W -0.939813 INESSENTIAL biological_ ... 2.258234 INESSENTIAL BAT2 Branched-Chain Amino Acid Transaminase,branched-chain amino acid aminotransferase, YDR109C -2.259435 ...
https://genomics.lbl.gov/YeastFitnessData/websitefiles/47_minimal-media_sen.txt
Aspartate Aminotransferases | Profiles RNS
Transaminase, Glutamic-Oxaloacetic. *L-Aspartate-2-Oxoglutarate Aminotransferase. *Aminotransferase, L-Aspartate-2-Oxoglutarate ... Enzymes of the transferase class that catalyze the conversion of L-aspartate and 2-ketoglutarate to oxaloacetate and L- ... Wimborne HJ, Hu J, Takemoto K, Nguyen NT, Jaeschke H, Lemasters JJ, Zhong Z. Aldehyde dehydrogenase-2 activation decreases ... attenuate staphylococcal enterotoxin B-mediated liver injury by downregulating miR-31 expression and promoting caspase-2- ...
https://profiles.musc.edu/display/101132/
Alpha-aminoadipateMitochondrialEnzymeTransferasesBiosynthesisMinor topicConversionPeople
Alpha-aminoadipate8
  • The fission yeast Schizosaccharomyces pombe and pathogenic fungi Candida albicans, Filobasidiella neoformans and Aspergillus fumigatus grew in the medium containing alpha-aminoadipate as the sole nitrogen source. (unipr.it)
  • When grown in the alpha-aminoadipate medium, only S. pombe accumulated a significant amount of alpha-ketoadipate in the culture supernatant. (unipr.it)
  • Also, 14C-alpha-aminoadipate was converted to 14C-alpha-ketoadipate in vivo. (unipr.it)
  • In the ammonium sulfate medium, S. pombe cells converted 14C- alpha-aminoadipate to lysine. (unipr.it)
  • The levels of glutamate-alpha-ketoadipate transaminase, an enzyme responsible for the conversion of alpha- aminoadipate to alpha-ketoadipate, and alpha-aminoadipate reductase, an enzyme required for the conversion of alpha-aminoadipate to lysine, were similar in S. pombe cells grown in the alpha-aminoadipate or ammonium sulfate medium. (unipr.it)
  • However, the level of homoisocitrate dehydrogenase, an enzyme before the alpha-ketoadipate step, was twelvefold lower in S. pombe cells grown in the alpha-aminoadipate medium compared to the level in cells grown in the ammonium sulfate medium. (unipr.it)
  • Pathogenic fungi used in this study did not accumulate alpha- ketoadipate and alpha-aminoadipate-delta-semialdehyde when grown in medium containing alpha-aminoadipate and lysine, respectively, as sole nitrogen source. (unipr.it)
  • However, only pathogenic fungi used both lysine and alpha-aminoadipate as sole nitrogen source. (unipr.it)
Mitochondrial1
  • Wimborne HJ, Hu J, Takemoto K, Nguyen NT, Jaeschke H, Lemasters JJ, Zhong Z. Aldehyde dehydrogenase-2 activation decreases acetaminophen hepatotoxicity by prevention of mitochondrial depolarization. (musc.edu)
Enzyme1
  • A PYRIDOXAL PHOSPHATE containing enzyme that catalyzes the transfer of amino group of L-2-aminoadipate onto 2-oxoglutarate to generate 2-oxoadipate and L-GLUTAMATE. (bvsalud.org)
Transferases1
  • This list contains a list of EC numbers for the second group, EC 2 , transferases , placed in numerical order as determined by the Nomenclature Committee of the International Union of Biochemistry and Molecular Biology . (en-academic.com)
Biosynthesis1
  • For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. (lbl.gov)
Minor topic1
  • This graph shows the total number of publications written about "Tryptophan Transaminase" by people in this website by year, and whether "Tryptophan Transaminase" was a major or minor topic of these publications. (ucdenver.edu)
Conversion1
  • Enzymes of the transferase class that catalyze the conversion of L-aspartate and 2-ketoglutarate to oxaloacetate and L-glutamate. (musc.edu)
People1
  • Below are the most recent publications written about "Tryptophan Transaminase" by people in Profiles. (ucdenver.edu)