AnatomyOrganismsChemicals and DrugsAnalytical, Diagnostic and Therapeutic Techniques and EquipmentPhenomena and ProcessesDisciplines and OccupationsAnthropology, Education, Sociology and Social PhenomenaTechnology, Industry, AgricultureInformation ScienceNamed GroupsHealth CarePublication Characteristics
2-Aminoadipate TransaminaseL-Aminoadipate-Semialdehyde Dehydrogenase2-Aminoadipic AcidAlanine Transaminase4-Aminobutyrate TransaminaseTransaminasesAspartate AminotransferasesKynureninePhenylpyruvic AcidsKynurenine 3-MonooxygenaseAdipocytes, WhiteAdipose Tissue, WhiteAdipose Tissue, BrownLyasesCarbon-Sulfur LyasesCatsGorilla gorillaAntibodiesAntibody SpecificityClostridium beijerinckiiSearch EngineButanolsInformation Storage and RetrievalMagnaportheAcetoneInternetSpace FlightAstronautsWeightlessnessSpacecraftUnited States National Aeronautics and Space AdministrationCosmic RadiationSpace SimulationNicotinamide N-MethyltransferaseGuanidinoacetate N-MethyltransferaseHistamine N-MethyltransferaseGlycine N-MethyltransferasePhosphatidylethanolamine N-MethyltransferaseBetaine-Homocysteine S-MethyltransferaseMethyltransferasesProteomicsMass SpectrometryIsotope LabelingNitrogen IsotopesAmino Acid SequenceCarbon IsotopesLecture NotesMethylmalonyl-CoA MutaseMethylmalonyl-CoA DecarboxylaseFatty AcidsCarbon-Nitrogen LigasesAudiovisual AidsBiotin
2-Aminoadipate Transaminase
A PYRIDOXAL PHOSPHATE containing enzyme that catalyzes the transfer of amino group of L-2-aminoadipate onto 2-oxoglutarate to generate 2-oxoadipate and L-GLUTAMATE.
L-Aminoadipate-Semialdehyde Dehydrogenase
An enzyme that catalyzes the oxidation of L-2-aminoadipate 6-semialdehyde to L-2-aminoadipate (alpha-aminoadipic acid). It is involved in the biosynthetic pathway of LYSINE.
2-Aminoadipic Acid
A metabolite in the principal biochemical pathway of lysine. It antagonizes neuroexcitatory activity modulated by the glutamate receptor, N-METHYL-D-ASPARTATE; (NMDA).
Alanine Transaminase
An enzyme that catalyzes the conversion of L-alanine and 2-oxoglutarate to pyruvate and L-glutamate. (From Enzyme Nomenclature, 1992) EC 2.6.1.2.
4-Aminobutyrate Transaminase
An enzyme that converts brain gamma-aminobutyric acid (GAMMA-AMINOBUTYRIC ACID) into succinate semialdehyde, which can be converted to succinic acid and enter the citric acid cycle. It also acts on beta-alanine. EC 2.6.1.19.
Transaminases
A subclass of enzymes of the transferase class that catalyze the transfer of an amino group from a donor (generally an amino acid) to an acceptor (generally a 2-keto acid). Most of these enzymes are pyridoxyl phosphate proteins. (Dorland, 28th ed) EC 2.6.1.
Aspartate Aminotransferases
Enzymes of the transferase class that catalyze the conversion of L-aspartate and 2-ketoglutarate to oxaloacetate and L-glutamate. EC 2.6.1.1.
Kynurenine
Phenylpyruvic Acids
A group of compounds that are derivatives of phenylpyruvic acid which has the general formula C6H5CH2COCOOH, and is a metabolite of phenylalanine. (From Dorland, 28th ed)
Kynurenine 3-Monooxygenase
An NADPH-dependent flavin monooxygenase that plays a key role in the catabolism of TRYPTOPHAN by catalyzing the HYDROXYLATION of KYNURENINE to 3-hydroxykynurenine. It was formerly characterized as EC 1.14.1.2 and EC 1.99.1.5.
Adipocytes, White
Fat cells with light coloration and few MITOCHONDRIA. They contain a scant ring of CYTOPLASM surrounding a single large lipid droplet or vacuole.
Adipose Tissue, White
Fatty tissue composed of WHITE ADIPOCYTES and generally found directly under the skin (SUBCUTANEOUS FAT) and around the internal organs (ABDOMINAL FAT). It has less vascularization and less coloration than the BROWN FAT. White fat provides heat insulation, mechanical cushion, and source of energy.
Adipose Tissue, Brown
A thermogenic form of adipose tissue composed of BROWN ADIPOCYTES. It is found in newborns of many species including humans, and in hibernating mammals. Brown fat is richly vascularized, innervated, and densely packed with MITOCHONDRIA which can generate heat directly from the stored lipids.
Lyases
A class of enzymes that catalyze the cleavage of C-C, C-O, and C-N, and other bonds by other means than by hydrolysis or oxidation. (Enzyme Nomenclature, 1992) EC 4.
Carbon-Sulfur Lyases
Enzymes that catalyze the cleavage of a carbon-sulfur bond by means other than hydrolysis or oxidation. EC 4.4.
Cats
The domestic cat, Felis catus, of the carnivore family FELIDAE, comprising over 30 different breeds. The domestic cat is descended primarily from the wild cat of Africa and extreme southwestern Asia. Though probably present in towns in Palestine as long ago as 7000 years, actual domestication occurred in Egypt about 4000 years ago. (From Walker's Mammals of the World, 6th ed, p801)
Gorilla gorilla
This single species of Gorilla, which is a member of the HOMINIDAE family, is the largest and most powerful of the PRIMATES. It is distributed in isolated scattered populations throughout forests of equatorial Africa.
Antibodies
Immunoglobulin molecules having a specific amino acid sequence by virtue of which they interact only with the ANTIGEN (or a very similar shape) that induced their synthesis in cells of the lymphoid series (especially PLASMA CELLS).
Antibody Specificity
The property of antibodies which enables them to react with some ANTIGENIC DETERMINANTS and not with others. Specificity is dependent on chemical composition, physical forces, and molecular structure at the binding site.
Clostridium beijerinckii
A species of gram-positive bacteria in the family Clostridiaceae, capable of solventogenesis, and isolated from SOIL, infected WOUNDS, fermenting OLIVES, and spoiled CANDY.
Search Engine
Software used to locate data or information stored in machine-readable form locally or at a distance such as an INTERNET site.
Butanols
Isomeric forms and derivatives of butanol (C4H9OH).
Information Storage and Retrieval
Organized activities related to the storage, location, search, and retrieval of information.
Magnaporthe
A genus of FUNGI, in the family Magnaporthaceae of uncertain position (incertae sedis). It is best known for its species, M. grisea, which is one of the most popular experimental organisms of all fungal plant pathogens. Its anamorph is PYRICULARIA GRISEA.
Acetone
A colorless liquid used as a solvent and an antiseptic. It is one of the ketone bodies produced during ketoacidosis.
Internet
A loose confederation of computer communication networks around the world. The networks that make up the Internet are connected through several backbone networks. The Internet grew out of the US Government ARPAnet project and was designed to facilitate information exchange.
Space Flight
Travel beyond the earth's atmosphere.
Astronauts
Members of spacecraft crew including those who travel in space, and those in training for space flight. (From Webster, 10th ed; Jane's Aerospace Dictionary, 3d ed)
Weightlessness
Condition in which no acceleration, whether due to gravity or any other force, can be detected by an observer within a system. It also means the absence of weight or the absence of the force of gravity acting on a body. Microgravity, gravitational force between 0 and 10 -6 g, is included here. (From NASA Thesaurus, 1988)
Spacecraft
Devices, manned and unmanned, which are designed to be placed into an orbit about the Earth or into a trajectory to another celestial body. (NASA Thesaurus, 1988)
United States National Aeronautics and Space Administration
An independent Federal agency established in 1958. It conducts research for the solution of problems of flight within and outside the Earth's atmosphere and develops, constructs, tests, and operates aeronautical and space vehicles. (From U.S. Government Manual, 1993)
Cosmic Radiation
High-energy radiation or particles from extraterrestrial space that strike the earth, its atmosphere, or spacecraft and may create secondary radiation as a result of collisions with the atmosphere or spacecraft.
Space Simulation
An environment simulating one or more parameters of the space environment, applied in testing space systems or components. Often, a closed chamber is used, capable of approximating the vacuum and normal environments of space. (From NASA Thesaurus, 1988) This also includes simulated EXTRAVEHICULAR ACTIVITY studies in atmosphere exposure chambers or water tanks.
Nicotinamide N-Methyltransferase
An enzyme found primarily in the LIVER that catalyzes the N-methylation of NICOTINAMIDE and other structurally related compounds.
Guanidinoacetate N-Methyltransferase
This enzyme catalyzes the last step of CREATINE biosynthesis by catalyzing the METHYLATION of guanidinoacetate to CREATINE.
Histamine N-Methyltransferase
An enzyme that catalyzes the transfer of a methyl group from S-adenosylmethionine to histamine, forming N-methylhistamine, the major metabolite of histamine in man. EC 2.1.1.8.
Glycine N-Methyltransferase
An enzyme that catalyzes the METHYLATION of GLYCINE using S-ADENOSYLMETHIONINE to form SARCOSINE with the concomitant production of S-ADENOSYLHOMOCYSTEINE.
Phosphatidylethanolamine N-Methyltransferase
An enzyme that catalyses three sequential METHYLATION reactions for conversion of phosphatidylethanolamine to PHOSPHATIDYLCHOLINE.
Betaine-Homocysteine S-Methyltransferase
A ZINC metalloenzyme that catalyzes the transfer of a methyl group from BETAINE to HOMOCYSTEINE to produce dimethylglycine and METHIONINE, respectively. This enzyme is a member of a family of ZINC-dependent METHYLTRANSFERASES that use THIOLS or selenols as methyl acceptors.
Methyltransferases
A subclass of enzymes of the transferase class that catalyze the transfer of a methyl group from one compound to another. (Dorland, 28th ed) EC 2.1.1.
Proteomics
The systematic study of the complete complement of proteins (PROTEOME) of organisms.
Mass Spectrometry
An analytical method used in determining the identity of a chemical based on its mass using mass analyzers/mass spectrometers.
Isotope Labeling
Techniques for labeling a substance with a stable or radioactive isotope. It is not used for articles involving labeled substances unless the methods of labeling are substantively discussed. Tracers that may be labeled include chemical substances, cells, or microorganisms.
Nitrogen Isotopes
Stable nitrogen atoms that have the same atomic number as the element nitrogen, but differ in atomic weight. N-15 is a stable nitrogen isotope.
Amino Acid Sequence
The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.
Carbon Isotopes
Stable carbon atoms that have the same atomic number as the element carbon, but differ in atomic weight. C-13 is a stable carbon isotope.
Lecture Notes
Methylmalonyl-CoA Mutase
An enzyme that catalyzes the conversion of methylmalonyl-CoA to succinyl-CoA by transfer of the carbonyl group. It requires a cobamide coenzyme. A block in this enzymatic conversion leads to the metabolic disease, methylmalonic aciduria. EC 5.4.99.2.
Methylmalonyl-CoA Decarboxylase
A carboxy-lyase that catalyzes the decarboxylation of (S)-2-Methyl-3-oxopropanoyl-CoA to propanoyl-CoA. In microorganisms the reaction can be coupled to the vectorial transport of SODIUM ions across the cytoplasmic membrane.
Fatty Acids
Organic, monobasic acids derived from hydrocarbons by the equivalent of oxidation of a methyl group to an alcohol, aldehyde, and then acid. Fatty acids are saturated and unsaturated (FATTY ACIDS, UNSATURATED). (Grant & Hackh's Chemical Dictionary, 5th ed)
Carbon-Nitrogen Ligases
Enzymes that catalyze the joining of two molecules by the formation of a carbon-nitrogen bond. EC 6.3.
Audiovisual Aids
Auditory and visual instructional materials.
Biotin
A water-soluble, enzyme co-factor present in minute amounts in every living cell. It occurs mainly bound to proteins or polypeptides and is abundant in liver, kidney, pancreas, yeast, and milk.

alpha-Aminoadipate aminotransferase from an extremely thermophilic bacterium, Thermus thermophilus. (1/6)

The extremely thermophilic bacterium Thermus thermophilus HB27 synthesizes lysine through alpha-aminoadipate (AAA). In this study, a T. thermophilus gene encoding the enzyme that catalyses transamination of AAA was cloned as a mammalian kynurenine/AAA aminotransferase (Kat2) gene homologue. A T. thermophilus mutant with disruption of the Kat2 homologue required a longer lag phase for growth and showed slower growth in minimal medium. Furthermore, addition of AAA or lysine shortened the lag phase and improved the growth rate. The Kat2 homologue was therefore termed lysN. LysN recognizes not only 2-oxoadipate, an intermediate of lysine biosynthesis, but also 2-oxoisocaproate, 2-oxoisovalerate and 2-oxo-3-methylvalerate, intermediates of leucine, valine and isoleucine biosyntheses, respectively, along with oxaloacetate, a compound in the TCA cycle, as an amino acceptor. These results suggest multiple roles of LysN in several cellular metabolic pathways including lysine and branched-chain amino acid biosyntheses.  (+info)

Purification and properties of kynurenine aminotransferase from rat kidney. (2/6)

Previous reports indicated that a single protein exhibits kynurenine aminotransferase (KAT) and alpha-aminoadipate aminotransferase (AadAT) activities. However, recently we discovered that KAT and AadAT activities are associated with two different proteins. KAT from rat kidney supernatant fraction was purified to electrophoretic homogeneity by (NH4)2SO4 fractionation, DEAE-Sephacel and hydroxyapatite chromatography. This procedure separated KAT from AadAT and improved the overall yield and the degree of purification over previously published methods. Some of the properties of purified KAT, such as Mr, subunit structure and the inhibition by dicarboxylic acids, were identical with those reported previously. However, the substrate specificity and pI of purified KAT were different from earlier reports. The same procedure can also be used to purify KAT from rat kidney mitochondria. These results support our earlier observation that KAT and AadAT activities are associated with two proteins and suggest that cytosolic KAT may be structurally similar to the mitochondrial enzyme.  (+info)

Alpha-aminoadipate and kynurenine aminotransferase activities from rat kidney. Evidence for separate identity. (3/6)

alpha-Aminoadipate aminotransferase and kynurenine aminotransferase activities from rat kidney are reportedly associated with the same protein. We observed that when the supernatant fraction was maintained at pH 4.5 for 75 min, 100% of kynurenine aminotransferase activity was lost, whereas only 40% of aminoadipate aminotransferase activity was lost. We purified alpha-aminoadipate aminotransferase and kynurenine aminotransferase from rat kidney supernatant fraction to electrophoretic homogeneity by ammonium sulfate fractionation, DEAE-Sephacel, and hydroxylapatite chromatography. Kynurenine aminotransferase activity was precipitated by pH treatment. The remaining aminoadipate aminotransferase activity was concentrated and injected into rabbits to raise antibodies that were used to prepare an affinity column. A mixture of aminoadipate aminotransferase and kynurenine aminotransferase activities obtained after hydroxylapatite chromatography was subjected to affinity chromatography. Aminoadipate aminotransferase and kynurenine aminotransferase activities resolved as separate peaks, providing evidence that the two activities are associated with two different proteins.  (+info)

Therapeutic modulation of cerebral L-lysine metabolism in a mouse model for glutaric aciduria type I. (4/6)

 (+info)

Purification and properties of 2-aminoadipate: 2-oxoglutarate aminotransferase from bovine kidney. (5/6)

Previous studies with rat kidney preparations indicated that 2-aminoadipate aminotransferase (AadAT) and kynurenine aminotransferase (KAT) activities are properties of a single protein. We found that bovine kidney contains an appreciable amount of AadAT activity, but lacks KAT activity. AadAT from bovine and rat kidney extracts were purified to electrophoretic homogeneity. The purification procedure included fractionation with (NH1)2SO1, heat treatment, DEAE-cellulose chromatography and hydroxyapatite chromatography. Physical and kinetic properties, such as pH optima, Km for substrates, Mr, electrophoretic mobility and inhibition by dicarboxylic acids of bovine kidney AadAT, were similar to those of the rat kidney enzyme. However, bovine kidney AadAT differed from rat kidney AadAT in substrate specificity, amino acid composition and stability when stored. The titration curve of bovine kidney AadAT was also different from that of the rat kidney enzyme. The results suggest that bovine kidney AadAT may have some structural similarity to rat kidney AadAT and that the structural differences observed between the two enzymes may explain the absence of KAT activity in bovine kidney.  (+info)

Cloning and functional expression of a soluble form of kynurenine/alpha-aminoadipate aminotransferase from rat kidney. (6/6)

Several aminotransferases with kynurenine aminotransferase (KAT) activity are able to convert L-kynurenine into kynurenic acid, a putative endogenous modulator of glutamatergic neurotransmission. In the rat, one of the described KAT isoforms has been found to correspond to glutamine transaminase K. In addition, rat kidney alpha-aminoadipate aminotransferase (AadAT) also shows KAT activity. In this report, we describe the isolation of a cDNA clone encoding the soluble form of this aminotransferase isoenzyme from rat (KAT/AadAT). Degenerate oligonucleotides were designed from the amino acid sequences of rat kidney KAT/AadAT tryptic peptides for use as primers for reverse transcription-polymerase chain reaction of rat kidney RNA. The resulting polymerase chain reaction fragment was used to screen a rat kidney cDNA library and to isolate a cDNA clone encoding KAT/AadAT. Analysis of the combined DNA sequences indicated the presence of a single 1275-base pair open reading frame coding for a soluble protein of 425 amino acid residues. KAT/AadAT appears to be structurally homologous to aspartate aminotransferase in the pyridoxal 5'-phosphate binding domain. RNA blot analysis of rat tissues, including brain, revealed a single species of KAT/AadAT mRNA of approximately 2.1 kilobases. HEK-293 cells transfected with the KAT/AadAT cDNA exhibited both KAT and AadAT activities with enzymatic properties similar to those reported for the rat native protein.  (+info)

AADAT - Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial precursor - Homo sapiens (Human) - AADAT gene & proteinAADAT - Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial precursor - Homo sapiens (Human) - AADAT gene & protein
Transaminase with broad substrate specificity. Has transaminase activity towards aminoadipate, kynurenine, methionine and glutamate. Shows activity also towards tryptophan, aspartate and hydroxykynurenine. Accepts a variety of oxo-acids as amino-group acceptors, with a preference for 2-oxoglutarate, 2-oxocaproic acid, phenylpyruvate and alpha-oxo-gamma-methiol butyric acid. Can also use glyoxylate as amino-group acceptor (in vitro).
http://www.uniprot.org/uniprot/Q8N5Z0
Sequence Similarity Search - BLASTSequence Similarity Search - BLAST
hsa:51166 K00825 kynurenine/2-aminoadipate aminotransferase [EC:2.6.1.7 2.6.1.39] , (RefSeq) AADAT, KAT2, KATII, KYAT2; aminoadipate aminotransferase (A) MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKT IQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQG LCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKP EDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNK FRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQ LMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKV KGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQL IKESL ...
https://www.genome.jp/tools-bin/search_sequence?prog=blast&seqid=hsa:51166+aa
AADAT Antibody - Cat. No. 48-417 | ProSciAADAT Antibody - Cat. No. 48-417 | ProSci
AADAT Antibody (Cat. No. 48-417) can be used to detect Gibbon, Gorilla, Human, Monkey AADAT Antibody in IHC and other applications.
https://www.prosci-inc.com/aadat-antibody-48-417.html
Q8N5Z0 | AADAT - Overview | canSAR BlackQ8N5Z0 | AADAT - Overview | canSAR Black
Search Molecular targets, 3D Structures, Protein families, Compounds, Diseases, Genes, Drugs | the Cancer Drug Discovery Platform | ICR CRUK Cancer Therapeutics Unit | canSAR Black
https://cansarblack.icr.ac.uk/target/Q8N5Z0/synopsis/ligandability
The α-aminoadipate pathway for lysine biosynthesis in fungi | SpringerLinkThe α-aminoadipate pathway for lysine biosynthesis in fungi | SpringerLink
This review provides a description of the biochemistry and enzymology of the α-aminoadipate pathway for lysine biosynthesis in fungi. The α-aminoadipate pathway is unique to fungi and is thus a potential target for the rational design of antifungal drugs. The present state of knowledge of the mechanisms of the seven enzymes in the pathway is presented, as well as detailed information with respect to structures and mechanisms of homocitrate synthase, saccharopine reductase, and saccharopine dehydrogenase. ...
https://link.springer.com/article/10.1385/CBB:46:1:43
AADAT Fragment MS Protein Standard - Creative ProteomicsAADAT Fragment MS Protein Standard - Creative Proteomics
AADAT Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human AADAT protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
https://www.creative-proteomics.com/product/detail-cpilf31648_20178.htm
EC 2.6.1.105EC 2.6.1.105
Accepted name: lysine-8-amino-7-oxononanoate transaminase. Reaction: L-lysine + 8-amino-7-oxononanoate = (S)-2-amino-6-oxohexanoate + 7,8-diaminononanoate. Glossary: (S)-2-amino-6-oxohexanoate = L-2-aminoadipate 6-semialdehyde = L-allysine. Other name(s): DAPA aminotransferase (ambiguous); bioA (gene name) (ambiguous); bioK (gene name). Systematic name: L-lysine:8-amino-7-oxononanoate aminotransferase. Comments: A pyridoxal 5-phosphate enzyme [2]. Participates in the pathway for biotin biosynthesis. The enzyme from the bacterium Bacillus subtilis cannot use S-adenosyl-L-methionine as amino donor and catalyses an alternative reaction for the conversion of 8-amino-7-oxononanoate to 7,8-diaminononanoate (cf. EC 2.6.1.62, adenosylmethionine-8-amino-7-oxononanoate transaminase).. Links to other databases: BRENDA, EXPASY, KEGG, MetaCyc, CAS registry number:. References:. 1. Van Arsdell, S.W., Perkins, J.B., Yocum, R.R., Luan, L., Howitt, C.L., Chatterjee, N.P. and Pero, J.G. Removing a bottleneck in ...
http://www.sbcs.qmul.ac.uk/iubmb/enzyme/EC2/6/1/105.html
Raxone 150 mg film-coated tablets | Patient Info | Chiesi Limited | Medicines.ieRaxone 150 mg film-coated tablets | Patient Info | Chiesi Limited | Medicines.ie
The Summary of Product Characteristics (SPC or SmPC) is a specific document, the wording of which has been agreed with the regulatory authority as part of the medicine approval process. It is required before any medicine is allowed on the market in Europe. It is designed to assist doctors and pharmacists in prescribing and supplying the product ...
https://www.medicines.ie/medicines/raxone-150-mg-film-coated-tablets-34909
KYAT1 (kynurenine aminotransferase 1) - KOMP (Knockout Mouse Project)KYAT1 (kynurenine aminotransferase 1) - KOMP (Knockout Mouse Project)
The KOMP Repository is located at the University of California Davis and Childrens Hospital Oakland Research Institute. Question? Comments? For Mice, Cells, and germplasm please contact us at [email protected], US 1-888-KOMP-MICE or International +1-530-752-KOMP, or for vectors [email protected] or +1-510-450-7917 ...
https://www.komp.org/geneinfo.php?geneid=33232
Olympian Labs Melatonin 5mg Fast Dissolve 60 Tab -- VitaGloOlympian Labs Melatonin 5mg Fast Dissolve 60 Tab -- VitaGlo
VitaGlo.com - Now Vitamins, Now Foods, EAS, Met-Rx, MuscleTech, and many more Diet, Vitamins, Minerals, Herbal Products. VitaGlo.com is your first choice for nutritional supplements, health, body, and muscle building products
http://vitaglo.com/oy0344.html
Daily Cold and Flu Weather Forecast for Bend, ORDaily Cold and Flu Weather Forecast for Bend, OR
AccuWeather.com provided daily cold and flu weather forecast in Bend, OR. See how the weather will impact the flu and common cold
https://www.accuweather.com/en/us/bend-or/97701/cold-flu-daily-forecast/335268?day=9
CH00115CH00115
Rabbit polyclonal antibody raised to a synthetic peptide corresponding to residues 1-22 of Kynurenine Aminotransferase II (KAT II); the epitope for the antibody was derived from human protein sequence that shows homology to mouse protein sequence. ...
https://www.coriell.org/0/sections/Search/Sample_Detail.aspx?Ref=CH00115&PgId=166
DLL1 | Discovery of Brain-Penetrant, Irreversible Kynurenine Aminotransferase II InhibitorsDLL1 | Discovery of Brain-Penetrant, Irreversible Kynurenine Aminotransferase II Inhibitors
Background/Purpose: The chance of upper gastrointestinal blood loss (UGIB) increases in patients with coronary artery disease (CAD) because of the frequent usage of antiplatelets. had been significantly old, and had more often utilized antiplatelets and warfarin than in non-CAD individuals. Weighed against non-CAD, the CAD individuals had considerably higher GlasgowCBlatchford rating, complete and pre-endoscopic Rockall rating and complete. Peptic ulcer in CAD individuals was identified more regularly than in non-CAD individuals. UGIB individuals with CAD and non-CAD got similar outcomes in regards to to mortality price, re-bleeding, medical procedures, embolization, and loaded erythrocyte transfusion. Nevertheless, CAD individuals had longer length of hospital remains than non-CAD individuals. Two CAD individuals passed away from cardiac arrest after endoscopy, whereas three non-CAD individuals passed away from pneumonia and severe renal failure throughout their hospitalization. Summary: In ...
http://researchreport-digital.com/tag/dll1/
RNAP | Discovery of Brain-Penetrant, Irreversible Kynurenine Aminotransferase II InhibitorsRNAP | Discovery of Brain-Penetrant, Irreversible Kynurenine Aminotransferase II Inhibitors
Data Availability StatementThe data used to support the results of the research are included within this article. wound healing, and transwell assays, indicating that miR-486-5p is an HCC suppressor. We employed four miRNA databases to predict the target genes of miR-486-5p and verified retrieved genes using qPCR and western blotting. The E3 ubiquitin ligase CBL was significantly downregulated by miR-486-5p overexpression in HCC cell lines at both mRNA and protein level, and overexpression of CBL counteracted the inhibitory effects of miR-486-5p on HCC cell proliferation and migration. Moreover, CBL expression was negatively correlated with miR-486-5p expression in HCC tissues. Collectively, our results suggest that miR-486-5p may S/GSK1349572 cell signaling act as a tumor suppressor gene in HCC by downregulating CBL expression. 1. Introduction Hepatocellular carcinoma (HCC) is the sixth most common cancer worldwide and the third leading cause of cancer-related mortality [1]. Although ...
https://researchreport-digital.com/category/rnap/
Kynurenine aminotransferase 3/glutamine transaminase L/cysteine conjugate beta-lyase 2 is a major glutamine transaminase in the...Kynurenine aminotransferase 3/glutamine transaminase L/cysteine conjugate beta-lyase 2 is a major glutamine transaminase in the...
PubMed Central Canada (PMC Canada) provides free access to a stable and permanent online digital archive of full-text, peer-reviewed health and life sciences research publications. It builds on PubMed Central (PMC), the U.S. National Institutes of Health (NIH) free digital archive of biomedical and life sciences journal literature and is a member of the broader PMC International (PMCI) network of e-repositories.
http://pubmedcentralcanada.ca/pmcc/articles/PMC5613967/
Lysine metabolism in mammalian brain: An update on the importance of recent discoveries<...Lysine metabolism in mammalian brain: An update on the importance of recent discoveries<...
TY - JOUR. T1 - Lysine metabolism in mammalian brain. T2 - An update on the importance of recent discoveries. AU - Hallen, André. AU - Jamie, Joanne F.. AU - Cooper, Arthur J L. PY - 2013/12. Y1 - 2013/12. N2 - The lysine catabolism pathway differs in adult mammalian brain from that in extracerebral tissues. The saccharopine pathway is the predominant lysine degradative pathway in extracerebral tissues, whereas the pipecolate pathway predominates in adult brain. The two pathways converge at the level of δ1-piperideine-6-carboxylate (P6C), which is in equilibrium with its open-chain aldehyde form, namely, α-aminoadipate δ-semialdehyde (AAS). A unique feature of the pipecolate pathway is the formation of the cyclic ketimine intermediate δ1-piperideine-2- carboxylate (P2C) and its reduced metabolite l-pipecolate. A cerebral ketimine reductase (KR) has recently been identified that catalyzes the reduction of P2C to l-pipecolate. The discovery that this KR, which is capable of reducing not only ...
https://researchers.mq.edu.au/en/publications/lysine-metabolism-in-mammalian-brain-an-update-on-the-importance-
Measurement of the Activity of a Kynurenine-Converting Enzyme and/or a Kynurenic-Acid, Anthranilic-Acid and/or 3...Measurement of the Activity of a Kynurenine-Converting Enzyme and/or a Kynurenic-Acid, Anthranilic-Acid and/or 3...
0026]1. Okuno E, Nishikawa T, M Nakamura, (1996) Kynurenine aminotransferases in the rat. Localization and Characterization. Recent Advances in Tryptophan Research, edited by Graziella Allegri Filipini et al., Plenum Press, New Your, 1996.2. B. Kepplinger, H. Baran, A. Kainz, H. Ferraz-Leite, J. Newcombe and P. Kalina (2005) Age-related increase of kynurenic acid in human cerebrospinal fluid: Positive corratio with IgG and Sa-microglobulin changes. Neurosignals, 14(3), 126-135.3. Kepplinger B, Baran H, Kainz A, Zeiner D, Wallner J (2006) Cerebrospinal Fluid of Multiple Sclerosis patients exert significantly weaker inhibition of Kynurenine Aminotransferase I activity in rat liver homogenate. Multiple Sclerosis 2006; 12:S1-S228, P4964. H. Baran, B. Kepplinger, M. Draxler and H. Ferraz-Leite (2004) Kynurenic acid metabolism in rat, piglet and human tissues. In European Society for Clinical Neuropharmacology by ed L. Battistin, International Proceedings MEDIMOND S.r.1. E505R9004, 227-231.5. H. ...
http://www.patentsencyclopedia.com/app/20100112618
Glutaricaciduria I - NORD (National Organization for Rare Disorders)Glutaricaciduria I - NORD (National Organization for Rare Disorders)
TEXTBOOKS. Goodman SI, Frerman FE. Organic acidemias due to defects in lysine oxidation: 2-ketoadipic acidemia and glutaric acidemia. In: Scriver CR, Beaudet AL, Sly WS, et al. Eds. The Metabolic Molecular Basis of Inherited Disease. 7th ed. McGraw-Hill Companies. New York, NY; 1995:1451-60.. JOURNAL ARTICLES. Bahr O, Mader I, Zschocke J, et al. Adult onset glutaric aciduria type I presenting with leukoencephalopathy. Neurology. 2002;59:1802-04.. Kolker S, Ramaekers VT, Zschocke J, et al. Acute encephalopathy despite early therapy in a patient with homozygosity for E365K in the glutaryl-coenzyme A dehydrogenase gene. J Pediatr 2001;138:277-79.. Zafeiriou DI, Zschocke J, Augustidou-Savvopoulou P, et al. Atypical and variable clinical presentation of glutaric aciduria type I. Neuropediatrics. 2000;31:303-06.. Kafil-Hussain NA, Monavari A, Bowell R, et al. Ocular findings in glutaric aciduria type I. J Pediatr Ophthalmol Strabismus. 2000;37:289-93.. Busquets C, Coll MJ, Merinero B, et al. Prenatal ...
https://rarediseases.org/rare-diseases/glutaricaciduria-i/
Glutaric aciduria type IGlutaric aciduria type I
Infectious Disease Advisor is used by specialists and other medical professionals to help understand and treat infectious diseases. Latest news, research and treatment articles.
http://www.infectiousdiseaseadvisor.com/pediatrics/glutaric-aciduria-type-i/article/624231/
Glutaric aciduria type I - ONAGlutaric aciduria type I - ONA
We offer clinical cancer updates, treatment guidance, and research news to the oncology nursing community. Visit us often for drug therapy testing results, patient care information and more. Download our FREE app today.
https://www.oncologynurseadvisor.com/pediatrics/glutaric-aciduria-type-i/article/624226/
Page 2 - Clinical AdvisorPage 2 - Clinical Advisor
OVERVIEW: What every practitioner needs to know Are you sure your patient has glutaric aciduria type I? What are the typical findings for this disease? Glutaric aciduria type I (GA-I) should be considered in any patient who has a history of dystonia/dyskinesia with macrocephaly. Prior to these overt chronic neurologic symptoms, there is usually a…. ...
https://www.clinicaladvisor.com/author/pulmonology-advisor-contributing-writer-1/page/2/
KEGG PATHWAY: Penicillin and cephalosporin biosynthesis - Reference pathwayKEGG PATHWAY: Penicillin and cephalosporin biosynthesis - Reference pathway
Penicillins (Penams) and cephalosporins (cephems) are beta-lactam antibiotics containing 6-aminopenicillanate (6-APA) and 7-aminocephalosporanate (7-ACA) nuclei, respectively. 6-APA and 7-ACA are key intermediates for a variety of semisynthetic penicillin and cephalosporin derivatives. Penicillins are produced only by fungi, while cephalosporins (including cephamycins) are produced by fungi and bacteria. Both antibiotics are synthesized from L-2-aminoadipate, L-cysteine and L-valine through a common pathway. It starts with the condensation of these three amino acids by the non-ribosomal peptide synthetase to form the tripeptide delta-(L-2-aminoadipyl)-L-cysteinyl-D-valine (ACV). The linear ACV tripeptide is then converted to bicyclic isopenicillin N by isopenicillin N synthase, in which the beta-lactam ring is formed. Isopenicillin N is the branch point of penicillin [MD:M00672] and cephalosporin [MD:M00673] pathways ...
http://www.genome.jp/kegg/pathway/map/map00311.html
Human Metabolome Database: Showing metabocard for Aminoadipic acid (HMDB0000510)Human Metabolome Database: Showing metabocard for Aminoadipic acid (HMDB0000510)
Aminoadipic acid (2-aminoadipate) is a metabolite in the principal biochemical pathway of lysine. It is an intermediate in the metabolism (i.e. breakdown or degradation) of lysine and saccharopine.(Wikipedia). It antagonizes neuroexcitatory activity modulated by the glutamate receptor, N-methyl-D-aspartate; (NMDA). Aminoadipic has also been shown to inhibit the production of kynurenic acid in brain tissue slices (PMID: 8566117 ). Kynurenic acid is a broad spectrum excitatory amino acid receptor antagonist. Recent studies have shown that aminoadipic acid is elevated in prostate biopsy tissues from prostate cancer patients (PMID: 23737455 ). Mutations in DHTKD1 (dehydrogenase E1 and transketolase domain-containing protein 1) have been shown to cause human 2-aminoadipic and 2-oxoadipic aciduria via impaired turnover of decarboxylation 2-oxoadipate to glutaryl-CoA, which is the last step in the lysine degradation pathway (PMID: 23141293 ). Aging, diabetes, sepsis and renal failure are known to ...
http://www.hmdb.ca/metabolites/HMDB0000510
Test | Invitae Glutaric Acidemia Type I TestTest | Invitae Glutaric Acidemia Type I Test
Genetic testing for the GCDH gene, which is associated with glutaric aciduria type I (GA1) and elevated C5-DC on newborn screening (NBS) or acylcarnitine analysis.
https://www.invitae.com/en/physician/tests/06195/
RCSB PDB for 1E5QRCSB PDB for 1E5Q
1E5Q: Crystal Structure of Saccharopine Reductase from Magnaporthe Grisea, an Enzyme of the Alpha-Aminoadipate Pathway of Lysine Biosynthesis
http://www.rcsb.org/pdb/explore/biologyAndChemistry.do?structureId=1E5Q
3-methylglutaconic aciduria type I3-methylglutaconic aciduria type I
3-methylglutaconic aciduria type 1 (3MGA1) is a genetic disorder in which the body cannot get energy from a substance called leucine. Leucine is one of the amino acids, which are the building blocks of proteins in our bodies. Because people with 3MGA1 cant break down leucine for energy to support muscle function and growth, they have a variety of symptoms that are present at birth. These symptoms may include developmental delays, seizures, muscle twitches (dystonia), and muscle weakness.. 3MGA1 is caused by a mutation (change) to the AUH gene, which produces a protein to break down leucine. When there is a mutation to the AUH gene, this protein either isnt produced or isnt functional, so the body cant get energy from leucine. Under normal conditions, the protein is present in the part of the cell that produces energy (the mitochondria), so 3MGA1 is a type of mitochondrial disease. 3MGA1 is also an organic acid condition because it causes harmful 3-methylglutaconic acid build up in the ...
http://diseaseinfosearch.org/3-methylglutaconic+aciduria+type+I/26
Glutaric aciduria type 1 | definition of Glutaric aciduria type 1 by Medical dictionaryGlutaric aciduria type 1 | definition of Glutaric aciduria type 1 by Medical dictionary
Looking for online definition of Glutaric aciduria type 1 in the Medical Dictionary? Glutaric aciduria type 1 explanation free. What is Glutaric aciduria type 1? Meaning of Glutaric aciduria type 1 medical term. What does Glutaric aciduria type 1 mean?
http://medical-dictionary.thefreedictionary.com/Glutaric+aciduria+type+1
2017/18 ICD-10-CM Diagnosis Code E71.313: Glutaric aciduria type II2017/18 ICD-10-CM Diagnosis Code E71.313: Glutaric aciduria type II
Free, official coding info for 2018 ICD-10-CM E71.313 - includes detailed rules, notes, synonyms, ICD-9-CM conversion, index and annotation crosswalks, DRG grouping and more.
http://www.icd10data.com/ICD10CM/Codes/E00-E89/E70-E88/E71-/E71.313
List of MeSH codes (D08)List of MeSH codes (D08)
... glycine transaminase MeSH D08.811.913.477.700.535 - leucine transaminase MeSH D08.811.913.477.700.550 - l-lysine 6-transaminase ... l-aminoadipate-semialdehyde dehydrogenase MeSH D08.811.682.657.163.812 - malonate-semialdehyde dehydrogenase (acetylating) MeSH ... beta-alanine-pyruvate transaminase MeSH D08.811.913.477.700.347 - d-alanine transaminase MeSH D08.811.913.477.700.470 - ... transaminases MeSH D08.811.913.477.700.100 - alanine transaminase MeSH D08.811.913.477.700.120 - 2-aminoadipate transaminase ...
https://en.wikipedia.org/wiki/List_of_MeSH_codes_(D08)
2-aminoadipate transaminase2-aminoadipate transaminase
... glutamic-ketoadipic transaminase, and glutamate-alpha-ketoadipate transaminase. This enzyme participates in lysine biosynthesis ... Matsuda M, Ogur M (1969). "Separation and specificity of the yeast glutamate-alpha-ketoadipate transaminase". J. Biol. Chem. ... This enzyme belongs to the family of transferases, specifically the transaminases, which transfer nitrogenous groups. The ... Other names in common use include alpha-aminoadipate aminotransferase, 2-aminoadipate aminotransferase, 2-aminoadipic ...
https://en.wikipedia.org/wiki/2-aminoadipate_transaminase
Lysine-pyruvate 6-transaminaseLysine-pyruvate 6-transaminase
In enzymology, a lysine-pyruvate 6-transaminase (EC 2.6.1.71) is an enzyme that catalyzes the chemical reaction L-lysine + ... This enzyme belongs to the family of transferases, specifically the transaminases, which transfer nitrogenous groups. The ... 49 (2): 203-206. doi:10.1111/j.1574-6968.1988.tb02716.x. Biology portal v t e. ... L-2-aminoadipate 6-semialdehyde + L-alanine Thus, the two substrates of this enzyme are L-lysine and pyruvate, whereas its two ...
https://en.wikipedia.org/wiki/Lysine—pyruvate_6-transaminase
L-lysine 6-transaminaseL-lysine 6-transaminase
... belongs to the aminotransferase class-III family. Crystal structures of L-lysine 6-transaminase reveal ... In enzymology, a L-lysine 6-transaminase (EC 2.6.1.36) is an enzyme that catalyzes the chemical reaction L-lysine + 2- ... This enzyme belongs to the family of transferases, specifically the transaminases, which transfer nitrogenous groups. This ... Other names in common use include lysine 6-aminotransferase, lysine epsilon-aminotransferase, lysine epsilon-transaminase, ...
https://en.wikipedia.org/wiki/L-lysine_6-transaminase
List of EC numbers (EC 2)List of EC numbers (EC 2)
... aspartate transaminase EC 2.6.1.2: alanine transaminase EC 2.6.1.3: cysteine transaminase EC 2.6.1.4: glycine transaminase EC ... 6-trideoxyglucose transaminase EC 2.6.1.35: glycine-oxaloacetate transaminase EC 2.6.1.36: L-lysine 6-transaminase EC 2.6.1.37 ... glutamine-phenylpyruvate transaminase EC 2.6.1.65: N6-acetyl-b-lysine transaminase EC 2.6.1.66: valine-pyruvate transaminase EC ... glutamine-scyllo-inositol transaminase EC 2.6.1.51: serine-pyruvate transaminase EC 2.6.1.52: phosphoserine transaminase EC 2.6 ...
https://en.wikipedia.org/wiki/List_of_EC_numbers_(EC_2)
AADATAADAT
It converts alpha-aminoadipate to alpha-ketoadipate. It is also one of the Kynurenine-oxoglutarate transaminases. GRCh38: ... Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial, also known as alpha-aminoadipate aminotransferase and kynurenine ... PDBe-KB provides an overview of all the structure information available in the PDB for Human Kynurenine/alpha-aminoadipate ... "Characterization of the human gene encoding alpha-aminoadipate aminotransferase (AADAT)". Molecular Genetics and Metabolism. 76 ...
https://en.wikipedia.org/wiki/AADAT
Kynurenine-oxoglutarate transaminaseKynurenine-oxoglutarate transaminase
Han Q, Cai T, Tagle DA, Robinson H, Li J (August 2008). "Substrate specificity and structure of human aminoadipate ... Han Q, Cai T, Tagle DA, Robinson H, Li J (August 2008). "Substrate specificity and structure of human aminoadipate ... In enzymology, a kynurenine-oxoglutarate transaminase (EC 2.6.1.7) is an enzyme that catalyzes the chemical reaction L- ... This enzyme belongs to the family of transferases, to be specific, the transaminases, that transfer nitrogenous groups. The ...
https://en.wikipedia.org/wiki/Kynurenine—oxoglutarate_transaminase
BiosynthesisBiosynthesis
There are two distinct lysine biosynthetic pathways: the diaminopimelic acid pathway and the α-aminoadipate pathway. The most ... "MetaCyc: L-lysine biosynthesis I". PETERKOFSKY, B; GILVARG, C (May 1961). "N-Succinyl-L-diaminopimelic-glutamic transaminase". ... This reaction that removes the 2'-OH of the ribose sugar to generate deoxyribose is not affected by the bases attached to the ... doi:10.1016/s1367-5931(00)00133-2. PMID 11006546. Sampei, G; Baba, S; Kanagawa, M; Yanai, H; Ishii, T; Kawai, H; Fukai, Y; ...
https://en.wikipedia.org/wiki/Biosynthesis
2-aminoadipate transaminase - Wikipedia2-aminoadipate transaminase - Wikipedia
... glutamic-ketoadipic transaminase, and glutamate-alpha-ketoadipate transaminase. This enzyme participates in lysine biosynthesis ... Matsuda M, Ogur M (1969). "Separation and specificity of the yeast glutamate-alpha-ketoadipate transaminase". J. Biol. Chem. ... This enzyme belongs to the family of transferases, specifically the transaminases, which transfer nitrogenous groups. The ... Other names in common use include alpha-aminoadipate aminotransferase, 2-aminoadipate aminotransferase, 2-aminoadipic ...
https://en.wikipedia.org/wiki/2-aminoadipate_transaminase
2-Aminoadipate Transaminase | Profiles RNS2-Aminoadipate Transaminase | Profiles RNS
"2-Aminoadipate Transaminase" is a descriptor in the National Library of Medicines controlled vocabulary thesaurus, MeSH ( ... A PYRIDOXAL PHOSPHATE containing enzyme that catalyzes the transfer of amino group of L-2-aminoadipate onto 2-oxoglutarate to ... This graph shows the total number of publications written about "2-Aminoadipate Transaminase" by people in this website by year ... Below are the most recent publications written about "2-Aminoadipate Transaminase" by people in Profiles. ...
https://researchers.childrensmercy.org/display/26059
AADAT - Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial precursor - Homo sapiens (Human) - AADAT gene & proteinAADAT - Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial precursor - Homo sapiens (Human) - AADAT gene & protein
Has transaminase activity towards aminoadipate, kynurenine, methionine and glutamate. Shows activity also towards tryptophan, ... Accepts a variety of oxo-acids as amino-group acceptors, with a preference for 2-oxoglutarate, 2-oxocaproic acid, ... Transaminase with broad substrate specificity. Has transaminase activity towards aminoadipate, kynurenine, methionine and ... Kynurenine transaminase activity is competitively inhibited by aminoadipate, asparagine, glutamate, histidine, cysteine, lysine ...
http://www.uniprot.org/uniprot/Q8N5Z0
Aadat - Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial precursor - Rattus norvegicus (Rat) - Aadat gene & proteinAadat - Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial precursor - Rattus norvegicus (Rat) - Aadat gene & protein
Has transaminase activity towards aminoadipate, kynurenine, methionine and glutamate. Shows activity also towards tryptophan, ... Accepts a variety of oxo-acids as amino-group acceptors, with a preference for 2-oxoglutarate, 2-oxocaproic acid, ... Transaminase with broad substrate specificity. Has transaminase activity towards aminoadipate, kynurenine, methionine and ... Kynurenine/alpha-aminoadipate aminotransferase, mitochondrialAdd BLAST. 396. Amino acid modifications. Feature key. Position(s) ...
https://www.uniprot.org/uniprot/Q64602
KEGG ENZYME: 2.6.1.5KEGG ENZYME: 2.6.1.5
phenylalanine-alpha-ketoglutarate transaminase;. phenylpyruvate transaminase;. phenylpyruvic acid transaminase;. tyrosine-alpha ... tyrosine transaminase;. tyrosine aminotransferase;. glutamic-hydroxyphenylpyruvic transaminase;. glutamic phenylpyruvic ... The mitochondrial enzyme may be identical with EC 2.6.1.1 (aspartate transaminase). The three isoenzymic forms are ... L-phenylalanine 2-oxoglutarate aminotransferase;. L-tyrosine aminotransferase;. phenylalanine aminotransferase;. phenylalanine ...
https://www.genome.jp/dbget-bin/www_bget?enzyme+2.6.1.5
Human Metabolome Database: Showing Protein Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial (HMDBP00378)Human Metabolome Database: Showing Protein Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial (HMDBP00378)
Transaminase with broad substrate specificity. Has transaminase activity towards aminoadipate, kynurenine, methionine and ... Han Q, Cai T, Tagle DA, Robinson H, Li J: Substrate specificity and structure of human aminoadipate aminotransferase/kynurenine ... Showing Protein Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial (HMDBP00378). IdentificationBiological properties ... Characterization of the human gene encoding alpha-aminoadipate aminotransferase (AADAT). Mol Genet Metab. 2002 Jul;76(3):172-80 ...
https://hmdb.ca/proteins/HMDBP00378
BRENDA - Search ResultBRENDA - Search Result
dTDP-4-amino-4,6-dideoxy-D-glucose transaminase. Biosynthesis of antibiotics ... ribostamycin:4-(gamma-L-glutamylamino)-(S)-2-hydroxybutanoyl-[BtrI acyl-carrier protein] 4-(gamma-L-glutamylamino)-(S)-2- ...
https://brenda-enzymes.org/search_result.php?a=137&W%5B2%5D=Biosynthesis%20of%20antibiotics&T%5B2%5D=1&Search=Search&l=100&RNV=1&RN=&T%5B0%5D=2&W%5B1%5D=&T%5B1%5D=2&V%5B3%5D=1&W%5B3%5D=&T%5B3%5D=2&V%5B4%5D=1&W%5B4%5D=&T%5B4%5D=2&V%5B5%5D=1&W%5B5%5D=&T%5B5%5D=2&W%5B5%255=&orderByHTMLField=KEGG+Link
Arama sonuçarı KetoglutaricArama sonuçarı "Ketoglutaric"
Aspartate Transaminase Pyridoxal phosphate, Transaminase, Aspartic acid, alpha-Ketoglutaric acid, Oxaloacetic acid, Glutamic ... Alanine Transaminase Enzyme, Alanine cycle, Amine, alpha-Ketoglutaric acid, Alanine, Transamination. Biyoloji Duct Publishing ( ... Aromatic-amino-acid Transaminase Enzyme, Catalysis, Chemical reaction, Enzyme substrate (biology), Aromatic amino acids, alpha- ... D-Amino-acid Transaminase Enzyme, Catalysis, Chemical reaction, Enzyme substrate (biology), Alanine, alpha-Ketoglutaric acid, ...
https://www.morebooks.de/tr/search?q=Ketoglutaric&via_keyword=1
ARO8 Sequence | SGDARO8 Sequence | SGD
bifunctional 2-aminoadipate transaminase/aromatic-amino-acid:2-oxoglutarate transaminase Feature Type. ORF , Verified ...
https://www.yeastgenome.org/locus/S000003170/sequence
KEGG BRITE: Amino acid related enzymesKEGG BRITE: Amino acid related enzymes
K14260 alaA; alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2] K14261 alaC; alanine-synthesizing transaminase [EC:2.6.1 ... K00816 CCBL; kynurenine---oxoglutarate transaminase / cysteine-S-conjugate beta-lyase / glutamine---phenylpyruvate transaminase ... K00832 tyrB; aromatic-amino-acid transaminase [EC:2.6.1.57] K00815 TAT; tyrosine aminotransferase [EC:2.6.1.5] K00838 ARO8; ... K00814 GPT, ALT; alanine transaminase [EC:2.6.1.2] K00835 avtA; valine--pyruvate aminotransferase [EC:2.6.1.66] ...
http://www.genome.jp/kegg-bin/get_htext?ko01007+K00814
AADAT Antibody - Cat. No. 48-417 | ProSciAADAT Antibody - Cat. No. 48-417 | ProSci
Aminoadipate aminotransferase. ... AADAT, 2-aminoadipate transaminase, KAT2, KAT/AadAT, KATII, ...
https://www.prosci-inc.com/aadat-antibody-48-417.html
KEGG SSDB Best Search Result: abe:ARB 01830KEGG SSDB Best Search Result: abe:ARB 01830
ton:TON_1660 alpha-amylase K01176 458 314 ( 214) 77 0.256 347 ,-, 2 ccm:Ccan_22280 bla K01176 470 312 ( -) 77 0.264 345 ,-, 1 ... ssr:SALIVB_1632 alpha-amylase precursor (1,4-alpha-D-gl K01176 483 886 ( 758) 208 0.391 348 ,-, 2 stf:Ssal_00523 alpha-amylase ... lld:P620_07100 cytochrome C oxidase subunit II K01176 491 790 ( 635) 186 0.339 345 ,-, 2 sdy:SDY_1088 alpha-amylase K01176 495 ... sup:YYK_08920 Surface protein 2102 151 ( 2) 40 0.252 214 -, 2 dwi:Dwil_GK21506 maltase A6 598 150 ( 14) 40 0.272 147 ,-, 2 fre: ...
http://www.kegg.jp/ssdb-bin/ssdb_best?org_gene=abe:ARB_01830
Anti-KAT2/AadAT antibody (ab89608) | AbcamAnti-KAT2/AadAT antibody (ab89608) | Abcam
Independently reviewed in 2 review(s). Immunogen corresponding to full length protein. ... Transaminase with broad substrate specificity. Has transaminase activity towards aminoadipate, kynurenine, methionine and ... Kynurenine--oxoglutarate transaminase II antibody. *Kynurenine/alpha-aminoadipate aminotransferase mitochondrial [Precursor] ... Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial antibody. *L kynurenine/alpha aminoadipate aminotransferase ...
https://www.abcam.com/kat2aadat-antibody-ab89608.html
AADAT Antibody 13031-1-AP | ProteintechAADAT Antibody 13031-1-AP | Proteintech
... aminoadipate aminotransferase, KAT/AadAT, KAT2, KATII, Kynurenine aminotransferase II ... Astrocytic and neuronal localization of kynurenine aminotransferase-2 in the adult mouse brain.. Authors - Judit Herédi. View ...
https://www.ptglab.com/Products/AADAT-Antibody-13031-1-AP.htm
List of MeSH codes (D08) - WikipediaList of MeSH codes (D08) - Wikipedia
... glycine transaminase MeSH D08.811.913.477.700.535 - leucine transaminase MeSH D08.811.913.477.700.550 - l-lysine 6-transaminase ... l-aminoadipate-semialdehyde dehydrogenase MeSH D08.811.682.657.163.812 - malonate-semialdehyde dehydrogenase (acetylating) MeSH ... beta-alanine-pyruvate transaminase MeSH D08.811.913.477.700.347 - d-alanine transaminase MeSH D08.811.913.477.700.470 - ... transaminases MeSH D08.811.913.477.700.100 - alanine transaminase MeSH D08.811.913.477.700.120 - 2-aminoadipate transaminase ...
https://en.wikipedia.org/wiki/List_of_MeSH_codes_(D08)
anti-AADAT antibody | Goat AADAT Polyclonal Antibody-NP 057312.1anti-AADAT antibody | Goat AADAT Polyclonal Antibody-NP 057312.1
AADAT: Transaminase with broad substrate specificity. Has transaminase activity towards aminoadipate, kynurenine, methionine ... L kynurenine/alpha aminoadipate aminotransferase; L-kynurenine/alpha-aminoadipate aminotransferase; alpha-aminoadipate ... L kynurenine/alpha aminoadipate aminotransferase antibody; L-kynurenine/alpha-aminoadipate aminotransferase antibody; alpha- ... The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, ...
https://www.mybiosource.com/polyclonal-human-antibody/aadat/421820
3UE8 | Genus3UE8 | Genus
Kynurenine/alpha-aminoadipate aminotransferase, mitochondria publication title Discovery of Brain-Penetrant, Irreversible ... Aspartate Aminotransferase; domain 2. Type I PLP-dependent aspartate aminotransferase-like (Major domain). 3ue8A02. ...
https://genus.fuw.edu.pl/view/3UE8/A/
DeCSDeCS
Aminotransferase, alpha-Aminoadipate Transaminase, 2-Aminoadipate alpha Aminoadipate Aminotransferase alpha-Aminoadipate ... Aminotransferase, alpha-Aminoadipate. Transaminase, 2-Aminoadipate. alpha Aminoadipate Aminotransferase. alpha-Aminoadipate ... Glutamine Fructose 6 Phosphate Transaminase (Isomerizing) [D08.811.913.477.700.500] Glutamine Fructose 6 Phosphate Transaminase ... 2-Aminoadipate Transaminase - Preferred Concept UI. M0113522. Scope note. A PYRIDOXAL PHOSPHATE containing enzyme that ...
https://decs.bvsalud.org/en/ths/resource/?id=50689
alpha-Aminoadipate Aminotransferase Antibody Pairs: Novus Biologicalsalpha-Aminoadipate Aminotransferase Antibody Pairs: Novus Biologicals
Find alpha-Aminoadipate Aminotransferase Antibody Pairs backed by our 100% Guarantee. ... alpha-Aminoadipate Aminotransferase Antibody Pairs for ELISA or Proximity Ligation Assay. ... oxoglutarate transaminase II antibody pair, L kynurenine/alpha aminoadipate aminotransferase antibody pair ... alpha-Aminoadipate Aminotransferase Antibody Pairs. We offer alpha-Aminoadipate Aminotransferase Antibody Pairs for use in ...
https://www.novusbio.com/antibody-pairs/alpha-aminoadipate-aminotransferase
Aminoadipate aminotransferase抗体(ab83918)| Abcam中国Aminoadipate aminotransferase抗体(ab83918)| Abcam中国
Aminoadipate aminotransferase抗体经WB,ELISA验证，可与小鼠样本 ... 购买Aminoadipate aminotransferase兔多克隆抗体(ab83918)， ... Transaminase with broad substrate specificity. Has transaminase ... Kynurenine--oxoglutarate transaminase II antibody. *Kynurenine/alpha-aminoadipate aminotransferase mitochondrial [Precursor] ... Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial antibody. *L kynurenine/alpha aminoadipate
http://www.abcam.cn/aminoadipate-aminotransferase-antibody-ab83918.html
JCM | Free Full-Text | Variation of Genes Encoding Tryptophan Catabolites Pathway Enzymes in Stroke | HTMLJCM | Free Full-Text | Variation of Genes Encoding Tryptophan Catabolites Pathway Enzymes in Stroke | HTML
KATI/glutamine transaminase K (GTK)/cysteine conjugate beta-lyase (CCBL) 1, KATII/aminoadipate aminotransferase (AADAT), KAT ... Joanna Saluk-Bijak 2, Ewelina Synowiec 1, Elzbieta Miller 3. , Tomasz Sliwinski 1. , Natalia Cichon 2 and Michal Bijak 2,*. ... meaning kynurenine transaminase (KAT) activity, was lower, while the kynurenic acid/kynurenine (KYNA/KYN) ratio, meaning ... 2. Materials and Methods. 2.1. Subjects. We recruited 107 patients with stroke and 107 age- and sex-matched control subjects ( ...
https://www.mdpi.com/2077-0383/8/12/2133/htm
Human AADAT Peptide (EMMKRALQY) (PEP-144093CQ) - Creative BiolabsHuman AADAT Peptide (EMMKRALQY) (PEP-144093CQ) - Creative Biolabs
Aminoadipate Aminotransferase; Kynurenine Aminotransferase II; L Kynurenine/Alpha Aminoadipate Aminotransferase; Kynurenine-- ... Oxoglutarate Aminotransferase II; Kynurenine--Oxoglutarate Transaminase II; Kynurenine--Oxoglutarate Transaminase 2; Alpha- ... The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, ...
https://www.antibody-creativebiolabs.com/aadat-peptide-emmkralqy-290942.htm
Pangenomic Approach To Understanding Microbial Adaptations within a Model Built Environment, the International Space Station,...Pangenomic Approach To Understanding Microbial Adaptations within a Model Built Environment, the International Space Station,...
TABLE 2 Antibiotic resistance gene products enriched by strain origin (P , 0.01 and FDR q , 0.1) for B. cereus for origins with ... FIG 2 Heterogeneity in gene presence/absence among ISS-associated B. cereus (A) and S. aureus (B) strains. Symbol shape or ... FastTree 2-approximately maximum-likelihood trees for large alignments. PLoS One 5:e9490. doi:10.1371/journal.pone.0009490. ... 2), each set of strains exhibited similar genomic diversity (i.e., core gene variation and accessory gene presence/absence) in ...
https://msystems.asm.org/content/4/1/e00281-18
ENZYME: 2.-.-.ENZYME: 2.-.-.
Alanine transaminase 2.6.1.3 Cysteine transaminase 2.6.1.4 Glycine transaminase 2.6.1.5 Tyrosine transaminase 2.6.1.6 Leucine ... UDP-N-acetylbacillosamine transaminase 2.6.1.35 Glycine--oxaloacetate transaminase 2.6.1.36 L-lysine 6-transaminase 2.6.1.37 2- ... pyruvate transaminase 2.6.1.41 D-methionine--pyruvate transaminase 2.6.1.42 Branched-chain-amino-acid transaminase 2.6.1.43 ... phenylpyruvate transaminase 2.6.1.65 N(6)-acetyl-beta-lysine transaminase 2.6.1.66 Valine--pyruvate transaminase 2.6.1.67 2- ...
https://enzyme.expasy.org/EC/2.-.-.-
ARO8 | SGDARO8 | SGD
enables 2-aminoadipate transaminase activity (IMP, IDA) * enables aromatic-amino-acid:2-oxoglutarate aminotransferase activity ... 2 3 Name Description. AROmatic amino acid requiring 1 Comparative Info. ...
https://www.yeastgenome.org/locus/S000003170
AADAT Fragment MS Protein Standard - Creative ProteomicsAADAT Fragment MS Protein Standard - Creative Proteomics
... oxoglutarate transaminase. Uniprot ID. Q8N5Z0. Protein Name. Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial. ... Alpha-aminoadipate aminotransferase, Kynurenine aminotransferase II, Kynurenine--oxoglutarate aminotransferase II, Kynurenine-- ...
https://www.creative-proteomics.com/product/detail-cpilf31648_20178.htm
What rhymes with l-lysine 6-transaminase?What rhymes with l-lysine 6-transaminase?
... Lookup it up at Rhymes.net - the most comprehensive rhyming words dictionary on the ... Weve got 0 rhyming words for l-lysine 6-transaminase ». What rhymes with l-lysine 6-transaminase?. This page is about the ... Know what rhymes with l-lysine 6-transaminase? Have another rhyming word for l-lysine 6-transaminase? Let us know!. ... Alternative searches for l-lysine 6-transaminase:. *Search for Synonyms for l-lysine 6-transaminase ...
http://www.rhymes.net/rhyme/l-lysine%206-transaminase
Reactome | GO MolecularFunctionReactome | GO MolecularFunction
S)-2-hydroxy-acid oxidase activity 83068 (alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl-galactosaminide 6-alpha- ... R)-3-amino-2-methylpropionate-pyruvate transaminase activity 419487 (S)-2-(5-amino-1-(5-phospho-D-ribosyl)imidazole-4- ... 2-polyprenyl-6-methoxy-1,4-benzoquinone methyltransferase activity 2161574 20-aldehyde-leukotriene B4 20-monooxygenase activity ... 2-decaprenyl-6-methoxy-1,4-benzoquinone methyltransferase activity 162298 2-hexaprenyl-6-methoxy-1,4-benzoquinone ...
http://reactome.ncpsb.org/content/schema/objects/GO_MolecularFunction
Ch432 Lecture NotesCh432 Lecture Notes
... transaminase; DH Complex; beta-oxidation. Due to the irreversible nature of the DH Complex all three are essential. ... Five aas feed into glutamate which in turns feeds into the TCA cycle at 2-oxo-glutarate. ... of the epsilon amino group where lysine is first reduced using NADPH and condensed with 2-oxo-glutarate to give L-saccharopine ... The aldehyde is then oxidized again and the resulting 2-aminoadipate now follows the branched chain pattern: transaminase, DH ...
http://users.humboldt.edu/rpaselk/C432.S09/C432Notes/C432nLec11.htm
Genome-wide analyses identify a role for SLC17A4 and AADAT in thyroid hormone regulation.Genome-wide analyses identify a role for SLC17A4 and AADAT in thyroid hormone regulation.
2-Aminoadipate Transaminase, Genome-Wide Association Study, Chlorocebus aethiops ...
https://www.repository.cam.ac.uk/handle/1810/289315
Mitochondrial1.39GlutamateGenesLysine biosynthesisEnzymeAntibodyAcidBiosynthesisGlutamicPathwayDehydrogenaseSemialdehydeKynurenine aminotransferasePutativeBroad substrateAmino groupMetabolicPipecolateMolecularMeSHPositively2019Activity
Mitochondrial1
  • The mitochondrial enzyme may be identical with EC 2.6.1.1 (aspartate transaminase). (genome.jp)
1.391
  • In enzymology, a 2-aminoadipate transaminase (EC 2.6.1.39) is an enzyme that catalyzes the chemical reaction L-2-aminoadipate + 2-oxoglutarate ⇌ {\displaystyle \rightleftharpoons } 2-oxoadipate + L-glutamate Thus, the two substrates of this enzyme are L-2-aminoadipate and 2-oxoglutarate, whereas its two products are 2-oxoadipate and L-glutamate. (wikipedia.org)
Glutamate11
  • Other names in common use include alpha-aminoadipate aminotransferase, 2-aminoadipate aminotransferase, 2-aminoadipic aminotransferase, glutamic-ketoadipic transaminase, and glutamate-alpha-ketoadipate transaminase. (wikipedia.org)
  • A PYRIDOXAL PHOSPHATE containing enzyme that catalyzes the transfer of amino group of L-2-aminoadipate onto 2-oxoglutarate to generate 2-oxoadipate and L-GLUTAMATE. (childrensmercy.org)
  • Has transaminase activity towards aminoadipate, kynurenine, methionine and glutamate. (uniprot.org)
  • L-kynurenine + 2-oxoglutarate = 4-(2-aminophenyl)-2,4-dioxobutanoate + L-glutamate. (uniprot.org)
  • L-2-aminoadipate + 2-oxoglutarate = 2-oxoadipate + L-glutamate. (uniprot.org)
  • Five aa's feed into glutamate which in turns feeds into the TCA cycle at 2-oxo-glutarate. (humboldt.edu)
  • Active with glutamate, phenylalanine, tyrosine and tryptophan as amino donors and with phenylpyruvate, hydroxyphenylpyruvate, 2-oxoglutarate and pyruvate as amino acceptors. (string-db.org)
  • Does not accept glutamate or 2-oxoglutarate as substrates. (string-db.org)
  • All three GABA related genes -- glutamate decarboxylase 1 (GAD1) and 2 (GAD2) and 4-aminobutyrate aminotransferase (ABAT) -- were lower in mesenchymal tumors, which in contrast showed higher IDO1 (indoleamine 2, 3-dioxygenase 1) and TDO2 (tryptophan 2, 3-diaxygenase). (beds.ac.uk)
  • Catalyzes the transfer of the amino group of L-glutamate to [LysW]-aminoadipate 6-semialdehyde, generating [LysW]-gamma-L-lysine. (expasy.org)
  • Pseudomonas putida KT2440, a derivative of P. putida mt-2 from which the TOL plasmid was cured ( 15 , 25 ), can grow on proline, lysine, glutamate, and other amino acids as the sole carbon and nitrogen source. (asm.org)
Genes3
  • All of the structural genes necessary for the biosynthesis of cephamycin C in S. clavuligerus are organized into a cluster together with regulatory and resistance genes ( 2 ). (asm.org)
  • All the genes and enzymes involved in the d -lysine pathway, except for those involved in the conversion of d -lysine into Δ 1 -piperideine-2-carboxylate, have been identified previously ( 30 ). (asm.org)
  • RESULTS: A total of 3729 (69 per sample) integration breakpoints were found in the human genome, including some hotspot genes and KEGG pathways, especially in patients with abnormal transaminases. (bvsalud.org)
Lysine biosynthesis2
  • This review provides a description of the biochemistry and enzymology of the α-aminoadipate pathway for lysine biosynthesis in fungi. (springer.com)
  • α-Aminoadipate aminotransferase (AAA-AT) catalyzes the amination of 2-oxoadipate to a-aminoadipate in the fourth step of the a-aminoadipate pathway of lysine biosynthesis in fungi. (northwestern.edu)
Enzyme6
  • This enzyme belongs to the family of transferases, specifically the transaminases, which transfer nitrogenous groups. (wikipedia.org)
  • The systematic name of this enzyme class is L-2-aminoadipate:2-oxoglutarate aminotransferase. (wikipedia.org)
  • The following ENZYME entries belong to class 2. (expasy.org)
  • A pyridoxal 5'-phosphate enzyme [2]. (qmul.ac.uk)
  • This enzyme displays broad substrate selectivity, utilizing several amino acids and 2-oxo acids as substrates. (northwestern.edu)
  • The gene encoding PP3590, called here amaC , forms an operon with dpkA , the gene encoding the enzyme involved in conversion of Δ 1 -piperideine-2-carboxylate to l -pipecolate in the d -lysine catabolic pathway. (asm.org)
Antibody4
  • We offer alpha-Aminoadipate Aminotransferase Antibody Pairs for use in common research applications: Immunoprecipitation, Western Blot. (novusbio.com)
  • Each alpha-Aminoadipate Aminotransferase Antibody Pair is fully covered by our Guarantee+, to give you complete peace of mind and the support when you need it. (novusbio.com)
  • Our alpha-Aminoadipate Aminotransferase Antibody Pairs can be used in a variety of model species: Human. (novusbio.com)
  • Choose from our alpha-Aminoadipate Aminotransferase Antibody Pairs. (novusbio.com)
Acid13
  • Accepts a variety of oxo-acids as amino-group acceptors, with a preference for 2-oxoglutarate, 2-oxocaproic acid, phenylpyruvate and alpha-oxo-gamma-methiol butyric acid. (uniprot.org)
  • 2-Oxoadipic acid is produced from lysine in the cytosol of cells via the saccharopine and the pipecolic acid pathways. (hmdb.ca)
  • 2-Oxoadipic aciduria is an in-born error of metabolism of lysine, tryptophan, and hydroxylysine, in which abnormal quantities of 2-aminoadipic acid are found in body fluids along with 2-oxoadipic acid. (hmdb.ca)
  • 4-(2-Amino-3-hydroxyphenyl)-2,4-dioxobutanoic acid belongs to the class of organic compounds known as alkyl-phenylketones. (foodb.ca)
  • 4-(2-Amino-3-hydroxyphenyl)-2,4-dioxobutanoic acid is a strong basic compound (based on its pKa). (foodb.ca)
  • General aromatic amino acid transaminase involved in several otherwise unrelated metabolic pathways. (string-db.org)
  • Aminoadipic acid (2-aminoadipate) is a metabolite in the principal biochemical pathway of lysine. (hmdb.ca)
  • 18448817 ). Proteolytic breakdown of these tissues can lead to the release of free 2-aminoadipic acid. (hmdb.ca)
  • also oxoglutaric acid has been linked to the inborn metabolic disorders including d-2-hydroxyglutaric aciduria. (bovinedb.ca)
  • 1986) Peptides of 2-aminopimelic acid: antibacterial agents that inhibit diaminopimelic acid biosynthesis. (springer.com)
  • Lehninger 2004 Figure 18.1 Voet, Voet & Pratt 2013 Fig 21.6 Amino Acid Deamination Transamination - most amino acids are deaminated by this process carried out by transaminases (aminotransferases). (slidegur.com)
  • A key process in amino acid degradation is transamination , in which the amino group of an amino acid is transferred to an α-ketoacid, typically catalysed by a transaminase . (wikidoc.org)
  • Further bioactivity-guided fractionation resulted in the isolation of three PTP1B inhibitory ursane-type triterpenes: ursolic acid (1), 2-oxopomolic acid (2), and 2α, 19α-dihydroxy-3-oxo-urs-12-en-28-oic acid (3). (bvsalud.org)
Biosynthesis1
  • Bhattacharjee, J. K. (1985) α-Aminoadipate pathway for the biosynthesis of lysine in lower eukaryotes. (springer.com)
Glutamic1
  • ASPA (aspartoacylase) and GOT1 (glutamic-oxaloacetic transaminase 1) had lower expression in GBM (associated with poor outcomes). (beds.ac.uk)
Pathway4
  • 4-(2 Amino-3-hydroxyphenyl)-2,4-dioxobutanoate is found in the tryptophan metabolic pathway and is an intermediate in tryptophan degradation [Kegg: C05645]. (hmdb.ca)
  • Current scientific interest in the Ehrlich pathway is supported by increased demands for natural flavor compounds such as isoamyl alcohol and 2-phenylethanol, which can be produced from amino acids in yeast-based bioconversion processes ( 14 ), as well as by the need to control flavor profiles of fermented food products. (asm.org)
  • The α-aminoadipate pathway is unique to fungi and is thus a potential target for the rational design of antifungal drugs. (springer.com)
  • Bhattacharjee, J. K. (1992) Evolution of α-aminoadipate pathway for the synthesis of lysine in fungi, in Handbook of Evolution of Metabolic Function (Mortlock, R. P., ed. (springer.com)
Dehydrogenase2
  • In the matrix of mitochondria, 2-oxoadipate is decarboxylated to glutaryl-CoA by the 2-oxoadipate dehydrogenase complex and then converted to acetyl-CoA. (hmdb.ca)
  • In this study we report that the conversion of d -lysine into Δ 1 -piperideine-2-carboxylate can be mediated by a d -lysine aminotransferase (PP3590) and a d -lysine dehydrogenase (PP3596). (asm.org)
Semialdehyde1
  • Catabolites of hydroxylysine and tryptophan enter these pathways as 2-aminoadipic- -semialdehyde and 2-oxoadipate, respectively. (hmdb.ca)
Kynurenine aminotransferase1
  • Astrocytic and neuronal localization of kynurenine aminotransferase-2 in the adult mouse brain. (ptglab.com)
Putative1
  • Trievel, Raymond C. / Crystal structure of Saccharomyces cerevisiae Aro8, a putative α-aminoadipate aminotransferase . (northwestern.edu)
Broad substrate1
  • Transaminase with broad substrate specificity. (uniprot.org)
Amino group1
  • Note the unusual 'transamination' of the epsilon amino group where lysine is first reduced using NADPH and condensed with 2-oxo-glutarate to give L -saccharopine. (humboldt.edu)
Metabolic2
  • Phospholipid transfer protein activity is determined by type 2 diabetes mellitus and metabolic syndrome, and is positively associated with serum transaminases. (genes2cognition.org)
  • break proteins down in times of metabolic need (muscle a prime source) 2. (slidegur.com)
Pipecolate4
  • The amaAB operon encodes two enzymes to convert pipecolate to 2-aminoadipate. (microbiologyresearch.org)
  • Growth on pipecolate was retarded in the gcdG and gcdH mutants, suggesting the importance of glutarate in pipecolate and 2-aminoadipate utilization. (microbiologyresearch.org)
  • In one of the pathways δ-aminovalerate is the key metabolite, whereas in the other l -lysine is racemized to d -lysine, and l -pipecolate and α-aminoadipate are the key metabolites. (asm.org)
  • d -lysine → α-keto-ε-amino caproate → Δ 1 -piperideine-2-carboxylate → pipecolate → Δ 1 -piperideine-6-carboxylate → α-amino-δ-formylcaproate → α-AMA → α-ketoadipate. (asm.org)
Molecular1
  • Molecular function: transaminase activity. (expasy.org)
MeSH1
  • 2-Aminoadipate Transaminase" is a descriptor in the National Library of Medicine's controlled vocabulary thesaurus, MeSH (Medical Subject Headings) . (childrensmercy.org)
Positively1
  • The HBV DNA load and inflammation activity grade score were further found to be positively correlated with transaminase levels. (bvsalud.org)
20191
Activity3
  • To this end, the UDP- N -acetylmuramoylalanyl- D -glutamyl-2,6- meso -diaminopimelate ligase ortholog was also identified, cloned, and was shown to possess meso -diaminopimelate ligase activity in vivo . (frontiersin.org)
  • The average, maximum and total frequencies of given breakpoint types, parameters of clonal hepatocyte expansion, were negatively correlated with HBV DNA load, transaminase levels and liver inflammation activity grade score. (bvsalud.org)
  • Compounds 1-3 and structurally related triterpenes (4-8) were further analyzed the structure-activity relationship, and were evaluated the inhibitory selectivity against four homologous protein tyrosine phosphatases (TCPTP, VHR, SHP-1 and SHP-2). (bvsalud.org)
Arama sonuçarı Ketoglutaric
Arama sonuçarı "Ketoglutaric" (morebooks.de)
Anti-KAT2/AadAT antibody (ab89608) | Abcam
Anti-KAT2/AadAT antibody (ab89608) | Abcam (abcam.com)
AADAT Antibody - Cat. No. 48-417 | ProSci
AADAT Antibody - Cat. No. 48-417 | ProSci (prosci-inc.com)
AADAT Antibody 13031-1-AP | Proteintech
AADAT Antibody 13031-1-AP | Proteintech (ptglab.com)
2-Aminoadipate Transaminase | Profiles RNS
2-Aminoadipate Transaminase | Profiles RNS (researchers.childrensmercy.org)
Anti-AADAT antibody | Goat AADAT Polyclonal Antibody-NP_057312.1
Anti-AADAT antibody | Goat AADAT Polyclonal Antibody-NP_057312.1 (mybiosource.com)
KEGG REACTION: R08920
KEGG REACTION: R08920 (genome.jp)
3UE8 | Genus
3UE8 | Genus (genus.fuw.edu.pl)
Aminoadipate aminotransferase抗体(ab83918)| Abcam中国
Aminoadipate aminotransferase抗体(ab83918)| Abcam中国 (abcam.cn)
JCM | Free Full-Text | Variation of Genes Encoding Tryptophan Catabolites Pathway Enzymes in Stroke | HTML
JCM | Free Full-Text | Variation of Genes Encoding Tryptophan Catabolites Pathway Enzymes in Stroke | HTML (mdpi.com)
Pangenomic Approach To Understanding Microbial Adaptations within a Model Built Environment, the International Space Station,...
Pangenomic Approach To Understanding Microbial Adaptations within a Model Built Environment, the International Space Station,... (msystems.asm.org)
Genome-wide analyses identify a role for SLC17A4 and AADAT in thyroid hormone regulation.
Genome-wide analyses identify a role for SLC17A4 and AADAT in thyroid hormone regulation. (repository.cam.ac.uk)
Human Metabolome Database: Showing metabocard for 4-(2-Amino-3-hydroxyphenyl)-2,4-dioxobutanoic acid (HMDB0004083)
Human Metabolome Database: Showing metabocard for 4-(2-Amino-3-hydroxyphenyl)-2,4-dioxobutanoic acid (HMDB0004083) (hmdb.ca)
Q8N5Z0 | AADAT - Overview | canSAR Black
Q8N5Z0 | AADAT - Overview | canSAR Black (cansarblack.icr.ac.uk)
TYR1 protein (Saccharomyces cerevisiae) - STRING interaction network
TYR1 protein (Saccharomyces cerevisiae) - STRING interaction network (string-db.org)
Molecular characterization of lysR-lysXE, gcdR-gcdHG and amaR-amaAB operons for lysine export and catabolism: a comprehensive...
Molecular characterization of lysR-lysXE, gcdR-gcdHG and amaR-amaAB operons for lysine export and catabolism: a comprehensive... (microbiologyresearch.org)
Metabolic Brain Disease 2/2019 | springermedizin.de
Metabolic Brain Disease 2/2019 | springermedizin.de (springermedizin.de)
The Ehrlich Pathway for Fusel Alcohol Production: a Century of Research on Saccharomyces cerevisiae Metabolism | Applied and...
The Ehrlich Pathway for Fusel Alcohol Production: a Century of Research on Saccharomyces cerevisiae Metabolism | Applied and... (aem.asm.org)
13C-metabolic flux ratio and novel carbon path analyses confirmed that Trichoderma reesei uses primarily the respirative...
13C-metabolic flux ratio and novel carbon path analyses confirmed that Trichoderma reesei uses primarily the respirative... (bmcsystbiol.biomedcentral.com.live.oscarjournals.springer.com)
Overview of Amino Acid and Organic Acid Metabolism Disorders - Pediatrics - Merck Manuals Professional Edition
Overview of Amino Acid and Organic Acid Metabolism Disorders - Pediatrics - Merck Manuals Professional Edition (merckmanuals.com)
Massively Parallel Fitness Profiling Reveals Multiple Novel Enzymes in Pseudomonas putida Lysine Metabolism | mBio
Massively Parallel Fitness Profiling Reveals Multiple Novel Enzymes in Pseudomonas putida Lysine Metabolism | mBio (mbio.asm.org)
KEGG PATHWAY: ko00310
KEGG PATHWAY: ko00310 (kegg.jp)
Amino Acids, Dicarboxylic - DrugBank
Amino Acids, Dicarboxylic - DrugBank (drugbank.ca)
ACY3 antibody ACY3 antibody|产品详情|上海拜力生物科技有限公司
ACY3 antibody ACY3 antibody|产品详情|上海拜力生物科技有限公司 (lookbio.com)
Origin of the canonical twenty amino acids required for life
Origin of the canonical twenty amino acids required for life (reasonandscience.heavenforum.org)
Transferase | ProSpec
Transferase | ProSpec (prospecbio.com)
Biological Synthesis of Difunctional Hexanes and Pentanes from Carbohydrate Feedstocks - Patent application
Biological Synthesis of Difunctional Hexanes and Pentanes from Carbohydrate Feedstocks - Patent application (patentsencyclopedia.com)