An enzyme involved in the biosynthesis of isoleucine and valine. It converts 2-acetolactate into 3-hydroxy-2-oxo-isovalerate. Also acts on 2-hydroxy-2-acetobutyrate to form 2-hydroxy-2-oxo-3-methylvalerate. EC 5.4.99.3.
A flavoprotein enzyme that catalyzes the formation of acetolactate from 2 moles of PYRUVATE in the biosynthesis of VALINE and the formation of acetohydroxybutyrate from pyruvate and alpha-ketobutyrate in the biosynthesis of ISOLEUCINE. This enzyme was formerly listed as EC 4.1.3.18.
An enzyme that catalyzes the conversion of methylmalonyl-CoA to succinyl-CoA by transfer of the carbonyl group. It requires a cobamide coenzyme. A block in this enzymatic conversion leads to the metabolic disease, methylmalonic aciduria. EC 5.4.99.2.
An enzyme that catalyzes the conversion of 2-phospho-D-glycerate to 3-phospho-D-glycerate. EC 5.4.2.1.
Enzymes that catalyze the cleavage of a carbon-carbon bond of a 3-hydroxy acid. (Dorland, 28th ed) EC 4.1.3.
An enzyme that catalyzes the transfer of phosphate from C-3 of 1,3-diphosphoglycerate to C-2 of 3-phosphoglycerate, forming 2,3-diphosphoglycerate. EC 5.4.2.4.
Pesticides used to destroy unwanted vegetation, especially various types of weeds, grasses (POACEAE), and woody plants. Some plants develop HERBICIDE RESISTANCE.
An essential branched-chain aliphatic amino acid found in many proteins. It is an isomer of LEUCINE. It is important in hemoglobin synthesis and regulation of blood sugar and energy levels.
A product of fermentation. It is a component of the butanediol cycle in microorganisms. In mammals it is oxidized to carbon dioxide.
A branched-chain essential amino acid that has stimulant activity. It promotes muscle growth and tissue repair. It is a precursor in the penicillin biosynthetic pathway.
A plant family of the order Liliales, subclass Liliidae, class Liliopsida (monocotyledons). Most species are perennials, native primarily to tropical America. They have creeping rootstocks, fibrous roots, and leaves in clusters at the base of the plant or borne on branched stems. The fruit is a capsule containing many seeds, or a one-seeded winged structure.
Amino acids which have a branched carbon chain.
Diminished or failed response of PLANTS to HERBICIDES.
The coenzyme form of Vitamin B1 present in many animal tissues. It is a required intermediate in the PYRUVATE DEHYDROGENASE COMPLEX and the KETOGLUTARATE DEHYDROGENASE COMPLEX.
Salts and esters of hydroxybutyric acid.
Enzymes of the isomerase class that catalyze the transfer of acyl-, phospho-, amino- or other groups from one position within a molecule to another. EC 5.4.
Salts or esters of LACTIC ACID containing the general formula CH3CHOHCOOR.
A species of gram-negative, facultatively anaerobic, rod-shaped bacteria (GRAM-NEGATIVE FACULTATIVELY ANAEROBIC RODS) commonly found in the lower part of the intestine of warm-blooded animals. It is usually nonpathogenic, but some strains are known to produce DIARRHEA and pyogenic infections. Pathogenic strains (virotypes) are classified by their specific pathogenic mechanisms such as toxins (ENTEROTOXIGENIC ESCHERICHIA COLI), etc.
An intermediate compound in the metabolism of carbohydrates, proteins, and fats. In thiamine deficiency, its oxidation is retarded and it accumulates in the tissues, especially in nervous structures. (From Stedman, 26th ed)
Derivatives of BUTYRIC ACID. Included under this heading are a broad variety of acid forms, salts, esters, and amides that contain the carboxypropane structure.

The yeast A kinases differentially regulate iron uptake and respiratory function. (1/13)

Yeast has three A kinase catalytic subunits, which have greater than 75% identity and are encoded by the TPK genes (TPK1, TPK2, and TPK3) [Toda, T., Cameron, S., Sass, P., Zoller, M. & Wigler, M. (1987) Cell 50, 277-287]. Although they are redundant for viability, the three A kinases are not redundant for pseudohyphal growth [Robertson, L. S. & Fink, G. R. (1998) Proc. Natl. Acad. Sci. USA 95, 13783-13787; Pan, X. & Heitman, J. (1999) Mol. Cell. Biol. 19, 4874-4887]; Tpk2, but not Tpk1 or Tpk3, is required for pseudohyphal growth. Genome-wide transcriptional profiling has revealed unique signatures for each of the three A kinases leading to the identification of additional functional diversity among these proteins. Tpk2 negatively regulates genes involved in iron uptake and positively regulates genes involved in trehalose degradation and water homeostasis. Tpk1 is required for the derepression of branched chain amino acid biosynthesis genes that seem to have a second role in the maintenance of iron levels and DNA stability within mitochondria. The fact that TPK2 mutants grow better than wild types on nonfermentable carbon sources and on media deficient in iron supports the unique role of Tpk2 in respiratory growth and carbon source use.  (+info)

Structure and expression of a cyanobacterial ilvC gene encoding acetohydroxyacid isomeroreductase. (2/13)

Acetohydroxyacid isomeroreductase (AHAIR) is the shared second enzyme in the biosynthetic pathways leading to isoleucine and valine. AHAIR is encoded by the ilvC gene in bacteria. A 1,544-bp fragment of genomic DNA containing the ilvC gene was cloned from the cyanobacterium Synechocystis sp. strain PCC 6803, and the complete nucleotide sequence was determined. The identity of the gene was established by comparison of the nucleotide and derived peptide sequences with those of other ilvC genes. The highest degree of sequence similarity was found with the ilvC gene from Rhizobium meliloti. The isolated Synechocystis ilvC gene complemented an Escherichia coli ilvC mutant lacking AHAIR activity. The expressed Synechocystis gene encodes a protein that has a molecular mass of 35.7 kDa and that has AHAIR activity in an in vitro assay. Polyclonal antibodies raised against purified Synechocystis AHAIR produced a single band on a Western blot (immunoblot) of a Synechocystis cell extract and detected the protein in an extract of an E. coli ilvC mutant strain that was transformed with a plasmid containing the Synechocystis ilvC gene. The antibody did not react with an extract of an E. coli ilvC mutant strain that was transformed with a control plasmid lacking the Synechocystis ilvC gene or with an extract of an E. coli IlvC+ control strain.  (+info)

Isolation and kinetic properties of acetohydroxy acid isomeroreductase from spinach (Spinacia oleracea) chloroplasts overexpressed in Escherichia coli. (3/13)

Acetohydroxy acid isomeroreductase catalyses a two-step reaction, an alkyl migration and a NADPH-dependent reduction, in the assembly of the carbon skeletons of branched-chain amino acids. Detailed investigations of acetohydroxy acid isomeroreductase aimed at elucidating the biosynthetic pathway of branched-chain amino acids and at designing new inhibitors of the enzyme having herbicidal potency have so far been conducted with the enzymes isolated from bacteria. To gain more information on a plant system, the gene encoding the mature acetohydroxy acid isomeroreductase from spinach (Spinacia oleracea) leaf chloroplasts has been used to transform Escherichia coli cells and to overexpress the enzyme. A rapid protocol is described that allows the preparation of large quantities of pure spinach chloroplast acetohydroxy acid isomeroreductase. Kinetic and structural properties of the plant enzyme expressed in Escherichia coli are compared with those reported in our previous studies on the native enzymes purified from spinach chloroplasts and with those reported for the corresponding enzymes isolated from Escherichia coli and Salmonella typhimurium. Both the plant and the bacterial enzymes obey an ordered mechanism in which NADPH binds first, followed by substrate (either 2-acetolactate or 2-aceto-2-hydroxybutyrate). Inhibition studies employing an inactive substrate analogue, 2-hydroxy-2-methyl-3-oxopentanoate, showed, however, that the binding of 2-hydroxy-2-methyl-3-oxopentanoate and NADPH occurs randomly, suggestive of some flexibility of the plant enzyme active site. The observed preference of the enzyme for 2-aceto-2-hydroxybutyrate over 2-acetolactate is discussed with regard to the contribution of acetohydroxy acid isomeroreductase activity in the partitioning between isoleucine and valine biosyntheses. Moreover, the kinetic properties of the chloroplast enzyme support the notion that biosynthesis of branched-chain amino acids in plants is controlled by light. As judged by analytical-ultracentrifugation and gel-filtration analyses the overexpressed plant enzyme is a dimer of identical subunits.  (+info)

Isolation, characterization and sequence analysis of a full-length cDNA clone encoding acetohydroxy acid reductoisomerase from spinach chloroplasts. (4/13)

Acetohydroxy acid reductoisomerase (AHRI), the second enzyme in the parallel isoleucine/valine-biosynthetic pathway, catalyses an unusual two-step reaction in which the substrate, either 2-acetolactate or 2-aceto-2-hydroxybutyrate, is converted via an alkyl migration and an NADPH-dependent reduction to give 2,3-dihydroxy-3-methylbutyrate or 2,3-dihydroxy-3-methylvalerate respectively. We have isolated and characterized a full-length cDNA from a lambda gt11 spinach library encoding the complete acetohydroxy acid reductoisomerase protein precursor. The 2050-nucleotide sequence contains a 1785-nucleotide open reading frame. The derived amino acid sequence indicates that the protein precursor consists of 595 amino acid residues including a presequence peptide of 72 amino acid residues. The N-terminal sequence of the first 16 amino acid residues of the purified AHRI confirms the identity of the cDNA. The derived amino acid sequence from this open reading frame shows 23% identity with the deduced amino acid sequences of the Escherichia coli and Saccharomyces cerevisiae AHRI proteins. There are two blocks of conserved amino acid residues in these three proteins. One of these is a sequence similar to the 'fingerprint' region of the NAD(P)H-binding site found in a large number of NAD(P)H-dependent oxidoreductases. The other, a short sequence (Lys-Xaa-Xaa-Xaa-Xaa-Xaa-Xaa-Xaa-Ser-His-Gly-Phe) containing the amino acids lysine and histidine, could well be the catalytic site of the first step of the AHRI reaction. Southern-blot analysis indicated that AHRI is encoded by a single gene per haploid genome of about 7.5 kbp containing at least four introns.  (+info)

Characterization of enzymes of the branched-chain amino acid biosynthetic pathway in Methanococcus spp. (5/13)

Methanococcus aeolicus, Methanococcus maripaludis, and Methanococcus voltae contain similar levels of four enzymes of branched-chain amino acid biosynthesis: acetohydroxy acid synthase, acetohydroxy acid isomeroreductase, dihydroxy acid dehydratase, and transaminase B. Following growth at low partial pressures of H2-CO2, the levels of these enzymes in extracts of M. voltae are reduced three- to fivefold, which suggests that their synthesis is regulated. The enzymes from M. aeolicus were found to be similar to the eubacterial and eucaryotic enzymes with respect to molecular weights, pH optima, kinetic properties, and sensitivities to O2. The acetohydroxy acid isomeroreductase has a specific requirement for Mg2+, and other divalent cations were inhibitory. It was stimulated threefold by K+ and NH4+ ions and was able to utilize NADH as well as NADPH. The partially purified enzyme was not sensitive to O2. The dihydroxy acid dehydratase is extremely sensitive to O2, and it has a half-life under 5% O2 of 6 min at 25 degrees C. Divalent cations were required for activity, and Mg2+, Mn2+, Ni2+, Co2+, and Fe2+ were nearly equally effective. In conclusion, the archaebacterial enzymes are functionally homologous to the eubacterial and eucaryotic enzymes, which implies that this pathway is very ancient.  (+info)

Purification and characterization of acetohydroxyacid reductoisomerase from spinach chloroplasts. (6/13)

Acetohydroxyacid reductoisomerase was purified over 400-fold to a specific activity of 62 nkat.mg-1, with 2-aceto-2-hydroxybutyrate as substrate, from the stroma of spinach leaf chloroplasts. The enzyme was not intrinsically membrane bound. The native enzyme was a tetramer with a subunit Mr of 59,000. The activity was optimum between pH 7.5 and 8.5. The apparent Km for 2-acetolactate was 25 microM and for 2-aceto-2-hydroxybutyrate was 37 microM. The enzyme required Mg2+ and the Vmax. was attained at physiological Mg2+ concentrations. NADP+ competitively inhibited the reaction when NADPH was the varied substrate. The native enzyme eluted from Mono-Q ion-exchange resins as three distinct peaks of activity. This elution pattern was preserved when the peaks were combined, dialysed and re-chromatographed. Each form exhibited identical Mr of 59,000 after SDS/polyacrylamide gel electrophoresis (PAGE), whereas they were easily distinguishable from each other after PAGE under non-denaturing conditions. These results provide evidence for the existence of multiple forms of acetohydroxyacid reductoisomerase in chloroplasts isolated from spinach leaves.  (+info)

The ILV5 gene of Saccharomyces cerevisiae is highly expressed. (7/13)

The nucleotide sequence of the yeast ILV5 gene, which codes for the branched-chain amino acid biosynthesis enzyme acetohydroxyacid reductoisomerase, has been determined. The ILV5 coding region is 1,185 nucleotides, corresponding to a polypeptide with a molecular weight of 44,280. Transcription of the ILV5 mRNA initiates at position -81 upstream from the ATG translation start codon and terminates between 218 and 222 bases downstream from the stop codon. Consensus sequences have been identified for initiation and termination of transcription, and for general control of amino acid biosynthesis, as well as repression by leucine. The ILV5 gene is regulated slightly by general amino acid control. Codon usage of the ILV5 gene has the strong bias observed in yeast genes that are highly expressed. In agreement with this, the reductoisomerase monomer, with an apparent molecular weight of 40,000, has been identified in an SDS polyacrylamide gel pattern of total soluble yeast proteins as a gene dosage dependent band.  (+info)

The herbicidally active experimental compound Hoe 704 is a potent inhibitor of the enzyme acetolactate reductoisomerase. (8/13)

Growth inhibition of plants and bacteria by the experimental herbicide Hoe 704 (2-methylphosphinoyl-2-hydroxyacetic acid) was alleviated by the addition of the branched-chain amino acids to growth media. Hoe 704 caused a massive accumulation of acetoin and acetolactate, indicating its direct interference with the branched-chain amino acid biosynthetic pathway. The second enzyme of this pathway, acetolactate reductoisomerase (EC 1.1.1.86), was found to be subject to strong inhibition by Hoe 704. The inhibition was time-dependent and competitive with the enzyme's substrate, acetolactate. This report establishes acetolactate reductoisomerase as a new target for a herbicidal compound.  (+info)

Other olathe newest dating online sites for seniors names in common use include dihydroxyisovalerate dehydrogenase more peaches Troy, AL I acid reductoisomerase, alpha-keto-beta-hydroxylacyl reductoisomerase, 2-hydroxyketo acid reductoisomerase, acetohydroxy acid reductoisomerase, or someone that loves sports dehydrogenase, isomeroreductase, Montra Dallas massage Dallas reviews dating services in Troy and reductoisomerase.. This starts becoming a problem. The resulting perpendicular vector is which creates more of a. Jim al-khalili investigates the progress say hi looking for mature people in colorado and asks up to ft 5 of track bed per week.. I think going too light of the Nsa West Raleigh NC other times smaller litter sizes and more acknowledgments, or obvious references.. ...
Butamax suggests that a broad construction is most consistent with the intrinsic evidence and skill in the art, namely, an enzyme that is structurally similar to acetohydroxy acid isomeroreductase or ketol acid reductoisomerase [KARI] enzymes 1 known by the EC number 1.1.1.86 2 and that converts acetolactate to 2,3-dihydroxyisovalerate. (D.I. 492 at 9) Under this construction, to determine whether an enzyme literally meets the claim term, a skilled artisan would: (1) compare the enzymes amino acid sequence to the sequences of known KARI enzymes having EC number 1.1.1.86 (D.I. 492 at 10; [p. 599] D.I. 494 at ¶ 45); and (2) test the enzyme for activity using a standard KARI assay, e.g., the assay described in a 1969 reference by Arfin & Umbarger 3 (D.I. 492 at 10; D.I. 495 at ¶¶ 41-43). According to Butamax, [t]his two prong analysis, consistent with the intrinsic evidence, allows a skilled artisan to come to a conclusion that an enzyme literally meets the KARI claim element. (D.I. 492 ...
Our previous studies revealed that the staphylococcal protein Gcp is essential for bacterial growth; however, the essential function of Gcp remains undefined. In this study, we demonstrated that Gcp plays an important role in the modulation of the br
The enzyme can also transfer the acetaldehyde from pyruvate to 2-oxobutanoate, forming 2-ethyl-2-hydroxy-3-oxobutanoate, also known as 2-aceto-2-hydroxybutanoate, a reaction in the biosynthesis of isoleucine ...
... MISSISSAUGA ON Jan. 11 / Vasogen Inc.(NA...To participate via webcast please go to ... Direct Dial 416-641-6142 ...,Vasogen,to,Conduct,Year-end,2007,Conference,Call,biological,advanced biology technology,biology laboratory technology,biology device technology,latest biology technology
1OZH: The crystal structure of Klebsiella pneumoniae acetolactate synthase with enzyme-bound cofactor and with an unusual intermediate.
Involved in the biosynthesis of branched-chain amino acids (BCAA). Catalyzes an alkyl-migration followed by a ketol-acid reduction of (S)-2-acetolactate (S2AL) to yield (R)-2,3-dihydroxy-isovalerate. In the isomerase reaction, S2AL is rearranged via a Mg-dependent methyl migration to produce 3-hydroxy-3-methyl-2-ketobutyrate (HMKB). In the reductase reaction, this 2-ketoacid undergoes a metal-dependent reduction by NADPH to yield (R)-2,3-dihydroxy-isovalerate.
Flumetsulam (CDX-F0080), CAS98967-40-9, is a high purity and quality chemical. Used as pesticide, reference material, acetolactate synthase inhibitor.
Hi Dr. Nagler, Do you know if living near mold would effect t? Are they not both related to the central nervous system? I am in my first year of t....
The first case of field evolved acetolactate synthase (ALS) inhibiting herbicide resistance in the model plant, mouse-ear cress, was reported in winter wheat fields in Westmoreland County, Virginia. A putative resistant (R) mouse-ear population was assessed for ALS resistance relative to a putative susceptible (S) and a susceptible lab population Columbia (C). Results indicated that the R population needed 23 to >2400 fold rate of thifensulfuron relative to S or C population, and it has evolved cross-resistance to sulfonylureas (SU), triazolopyrimidine sulfonanilides (TP), and sulfonylaminocarbonyltriazolinones (SCT). Further studies sequenced the whole genome for four field populations, representing two locations and two resistance levels (high and low) per location, to characterize the genetic mechanism of ALS resistance. The results revealed that all populations contained mutations in the ALS gene at the Pro197 site, although the Pro was substituted by Phe in one location and Thr in the ...
The worlds first wiki where authorship really matters. Due credit and reputation for authors. Imagine a global collaborative knowledge base for original thoughts.
The acetolactate synthase enzyme (ALS) plays a key role in the biochemical pathways of the branched-chain amino acids leucine, isoleucine and valine. The application of ALS-inhibiting herbicides blocks this synthesis pathway. Lack of the aforementioned amino acids interferes with protein synthesis, causing the plant to die off.This gene encodes a modified acetolactate synthase, which confers tolerance to several acetolactate synthase-inhibiting herbicides such as, for example, sulfonylurea ...
Strain Information. E. coli K-12 MG1655. Description. Genotype: F- lambda- ilvG- rfb-50 rph-1. Serotype: OR:H48:K- This strain was sequenced by the Blattner laboratory because it approximates wild-type E. coli and has been maintained as a laboratory strain with minimal genetic manipulation, having only been cured of the temperate bacteriophage lambda and F plasmid by means of ultraviolet light and acridine orange, respectively. (Blattner, et al. 1997). The mutations listed in the genotype are present in most K-12 strains and were probably acquired early in the history of the laboratory strain. A frameshift at the end of rph results in decreased pyrE expression and a mild pyrimidine starvation, such that the strain grows 10 to 15% more slowly in pyrimidine-free medium than in medium containing uracil (Jensen 1993). The ilvG- mutation is a frameshift that knocks out acetohydroxy acid synthase II (Lawther, et al. 1982). The rfb-50 mutation is an IS5 insertion that results in the absence of ...
SpaceCollective.org uses cookies to store visitors preferences and to record session information for many purposes, including ensuring that visitors are not repeatedly offered the same Web page content based on browser type and user profile information. We do not link the information we store in cookies to any personally identifiable information you submit while on our site. You may be able to configure your browser to accept or reject all or some cookies, or notify you when a cookie is set - each browser is different, so check the Help menu of your browser to learn how to change your cookie preferences - however, you must enable cookies from SpaceCollective.org in order to use most functions on the site ...
... phosphoglycerate mutase MeSH D08.811.399.894.200 - amino acid isomerases MeSH D08.811.399.894.200.200 - alanine racemase MeSH ... acetolactate synthase MeSH D08.811.913.200.650 - transaldolase MeSH D08.811.913.200.825 - transketolase MeSH D08.811.913.225. ... chorismate mutase MeSH D08.811.399.520.250.500 - prephenate dehydratase MeSH D08.811.399.520.250.750 - prephenate dehydrogenase ... bisphosphoglycerate mutase MeSH D08.811.399.520.750.625 - phosphoglucomutase MeSH D08.811.399.520.750.700 - ...
Other names in common use include acetolactate mutase, and acetohydroxy acid isomerase. This enzyme participates in valine, ... In enzymology, a 2-acetolactate mutase (EC 5.4.99.3) is an enzyme that catalyzes the chemical reaction 2-acetolactate ⇌ {\ ... The systematic name of this enzyme class is 2-acetolactate methylmutase. ... 2-acetolactate, and one product, 3-hydroxy-3-methyl-2-oxobutanoate. This enzyme belongs to the family of isomerases, ...
... phosphoenolpyruvate mutase EC 5.4.2.10: phosphoglucosamine mutase EC 5.4.2.11: phosphoglycerate mutase (2,3-diphosphoglycerate- ... benzene mutase EC 5.4.4.2: isochorismate synthase EC 5.4.4.3: 3-(hydroxyamino)phenol mutase EC 5.4.4.4: geraniol isomerase EC ... isobutyryl-CoA mutase EC 5.4.99.14: 4-carboxymethyl-4-methylbutenolide mutase EC 5.4.99.15: (1→4)-α-D-glucan 1-α-D- ... methylaspartate mutase EC 5.4.99.2: methylmalonyl-CoA mutase EC 5.4.99.3: 2-acetolactate mutase EC 5.4.99.4: 2- ...
The second step involves the NADPH+-dependent reduction of α-acetolactate and migration of methyl groups to produce α, β- ... This process is mediated by a phenylalanine (PheA) or tyrosine (TyrA) specific chorismate mutase-prephenate dehydrogenase. PheA ... It begins with the condensation of two equivalents of pyruvate catalyzed by acetohydroxy acid synthase yielding α-acetolactate ... Enzymes involved in this biosynthesis include acetolactate synthase (also known as acetohydroxy acid synthase), acetohydroxy ...
Substance with mutase mechanism of action (substance). Code System Preferred Concept Name. Substance with mutase mechanism of ... Methylaspartate mutase (substance) {83682009 , SNOMED-CT } Methylmalonyl-coenzyme A mutase (substance) {56024005 , SNOMED-CT } ... Bisphosphoglycerate mutase (substance) {2168009 , SNOMED-CT } Chorismate mutase (substance) {4067000 , SNOMED-CT } Cycloartenol ... Substance with mutase mechanism of action (substance) {130945002 , SNOMED-CT } Parent/Child (Relationship Type) 2-acetolactate ...
Acetolactate decarboxylase (substance) {89203004 , SNOMED-CT } Acetolactate synthase (substance) {49354001 , SNOMED-CT } ... Isobutyryl-coenzyme A mutase (substance) {130897008 , SNOMED-CT } Isochorismate synthase (substance) {1105007 , SNOMED-CT } ... Chorismate mutase (substance) {4067000 , SNOMED-CT } Chorismate synthase (substance) {22224001 , SNOMED-CT } Citramalate lyase ... Methylaspartate mutase (substance) {83682009 , SNOMED-CT } Methylglyoxal synthase (substance) {20211008 , SNOMED-CT } ...
Enzyme (substance) {90668006 , SNOMED-CT } Substance with mutase mechanism of action (substance) {130945002 , SNOMED-CT } ...
... independent phosphoglycerate mutase' /product='phosphoglycerate mutase' /protein_id='BAP60234.1' /transl_table=11 /translation ... alpha-acetolactate decarboxylase' /protein_id='BAP60780.1' /transl_table=11 /translation=' ... mutase' /product='putative phosphoglycerate mutase' /protein_id='BAP60764.1' /transl_table=11 /translation=' ... chorismate mutase' /protein_id='BAP60743.1' /transl_table=11 /translation='MSNSSEKRLEEIRKRINEIDEQLIELIAERTSFAPEIAALKKSL ...
chorismate mutase activity GO:0004106 * trans-2-decenoyl-acyl-carrier-protein isomerase activity ...
Acetolactate synthase catalytic subunit, mitochondrial (4) * Phosphoglycerate mutase 1 (4) * GTP cyclohydrolase-2 (4) ... Dolichyl-phosphate-mannose--protein mannosyltransferase 2 (4) * 2,5-diamino-6-ribosylamino-4(3H)-pyrimidinone 5'-phosphate ... 1-phosphatidylinositol 3-phosphate 5-kinase FAB1 (2) * Putative inosine-5'-monophosphate dehydrogenase-like protein YAR075W (2 ... Phosphatidylinositol 4,5-bisphosphate 5-phosphatase INP51 (2) * L-serine dehydratasePutative truncated L-serine dehydratase ...
Acetolactate decarboxylase. Acetolactate synthase. Acetone carboxylase. Acetone-cyanohydrin lyase. Acetoxybutynylbithiophene ... Hydroxyamino)benzene mutase. (Iso)eugenol O-methyltransferase. (R)-2-haloacid dehalogenase. (R)-2-hydroxy-fatty-acid ... 3-(hydroxyamino)phenol mutase. 3-(imidazol-5-yl)lactate dehydrogenase. 3-aci-nitropropanoate oxidase. 3-alpha (17-beta)- ... S)-2-haloacid dehalogenase. (S)-2-hydroxy-acid oxidase. (S)-2-hydroxy-fatty-acid dehydrogenase. (S)-2-methylmalate dehydratase ...
Acetolactate synthase large subunit (EC 2.2.1.6)::Acetolactate synthase small subunit (EC 2.2.1.6)::Long-chain-fatty-acid--CoA ... Chorismate mutase I (EC 5.4.99.5)::Prephenate dehydratase (EC 4.2.1.51)::2-keto-3-deoxy-D-arabino-heptulosonate-7-phosphate ... Phosphoglycerate mutase (EC 5.4.2.11)::UDP-glucose 4-epimerase (EC 5.1.3.2)::Inosine/xanthosine triphosphatase (EC 3.6.1.-):: ... Phosphoglucosamine mutase (EC 5.4.2.10)::Penicillin-binding protein 2 (PBP-2)::Rod shape-determining protein RodA::D-alanyl-D- ...
Glyoxylate carboligase; acetolactate synthase large subunit ilvB 1407_ssl3769-sacB ATGTTGGTACTTTCCGTCCTATCTT… hypothetical ... phosphoglucosamine mutase 1523_sll1219-sacB ATGCACTACGCCATCCCCAAAACCT… hypothetical protein 1524_sll1218-sacB ... D-isomer specific 2-hydroxyacid dehydrogenase family 1483_slr2124-sacB ATGAAACCAGTTGTTCTTATCACCG… short-chain alcohol ... 14-dihydroxy-2-naphtoic acid prenyltransferase menA 1453_slr1519-sacB ATGGCTGGGCTGGCCTGGGCTAAGG… pentapeptide repeat-containing ...
acetolactate synthase 3 large subunit. 95. SEQF3707,CP072381.1. QUC05141.1 jb [NA] [AA] 492/163. 1055800-1056291. acetolactate ... 5-(carboxyamino)imidazole ribonucleotide mutase. 22. SEQF3707,CP072381.1. QUC05068.1 jb [NA] [AA] 1089/362. 978000-979088. 5-( ... tRNA 2-thiocytidine(32) synthetase TtcA. 29. SEQF3707,CP072381.1. QUC05075.1 jb [NA] [AA] 483/160. 985672-985190. C40 family ... hydrogenase 2 operon protein HybA. 44. SEQF3707,CP072381.1. QUC05090.1 jb [NA] [AA] 1227/408. 1000465-1001691. Ni/Fe- ...
Acetolactate synthase isozyme 3 large subunit. 192. SEQF2969,KV788369.1. SEQF2969_00194 jb [NA] [AA] 1038/345. 62987-61950. ... UDP-galactopyranose mutase. 34. SEQF2969,KV788368.1. SEQF2969_00034 jb [NA] [AA] 252/83. 34942-35193. hypothetical protein. ... Acetolactate synthase isozyme 2 large subunit. 198. SEQF2969,KV788369.1. SEQF2969_00200 jb [NA] [AA] 1371/456. 71774-70404. ... AI-2 transport protein TqsA. 107. SEQF2969,KV788368.1. SEQF2969_00109 jb [NA] [AA] 1521/506. 119417-120937. Long-chain-aldehyde ...
... "acetolactate synthase 2 small subunit [Ensembl]. ACT domain [Interproscan].","protein_coding" "AAK98919","spr0115"," ... ","N5-carboxyaminoimidazole ribonucleotide mutase [Ensembl]. AIR carboxylase [Interproscan].","protein_coding" "AKP16206","fpr_ ... region 4 type 2, RNA polymerase sigma-70 region 2 [InterProScan].","protein_coding" "AGT26855","N559_5281","Klebsiella ... Sigma-70 region 2, SnoaL-like domain [Interproscan].","protein_coding" "CCP42909","No alias","Mycobacterium tuberculosis"," ...
... "chorismate mutase,chorismate mutase," YPL164C -5.671157 INESSENTIAL MLH3 MutL Homolog YBL007C -5.909717 INESSENTIAL SLA1 " ... "Small regulatory subunit of Acetolactate synthase,acetolactate synthase, " YLR239C 0.252074 INESSENTIAL "biological_process ... "phosphoglycerate mutase, involved in glycolysis, glycolysis*, phosphoglycerate mutase, cytosol" YGR248W 1.175903 INESSENTIAL ... "Phospo-mutase homolog, biological_process unknown," YNL278W -0.218885 INESSENTIAL CAF120 CCR4 associated factor 120 kDa YHR026W ...
Acetolactate synthase catalytic subunit, mitochondrial (4) * Phosphoglycerate mutase 1 (4) * GTP cyclohydrolase-2 (4) ... Dolichyl-phosphate-mannose--protein mannosyltransferase 2 (4) * 2,5-diamino-6-ribosylamino-4(3H)-pyrimidinone 5'-phosphate ... 1-phosphatidylinositol 3-phosphate 5-kinase FAB1 (2) * Putative inosine-5'-monophosphate dehydrogenase-like protein YAR075W (2 ... Phosphatidylinositol 4,5-bisphosphate 5-phosphatase INP51 (2) * L-serine dehydratasePutative truncated L-serine dehydratase ...
","acetolactate synthase 3 regulatory subunit [Ensembl]. ACT domain, Small subunit of acetolactate synthase [Interproscan]."," ... ","phosphoglycero mutase III, cofactor-independent [Ensembl]. Metalloenzyme superfamily, BPG-independent PGAM N-terminus (iPGM_ ... ","alpha-acetolactate decarboxylase [Ensembl]. Alpha-acetolactate decarboxylase [Interproscan].","protein_coding" "CPD21311"," ... ","Probable acetolactate synthase IlvG (acetohydroxy-acid synthase)(ALS) [Ensembl]. Thiamine pyrophosphate enzyme [Interproscan ...
The genes for acetolactate synthase (alsS) and acetolactate decarboxylase (alsD), both involved in acetoin production, were up- ... phosphoglycerate mutase; pycA, pyruvate carboxylase; pykA, pyruvate kinase; SA2155, malate:quinone-oxidoreductase; sdhA, ... Additional file 2: Genes with higher expression in wild-type versus Δ ccpA mutant. The table represents genes showing a higher ... Figure 2. Northern blot analyses of CcpA-dependent genes. A, Transcription of genes showing differential expression in the ccpA ...
","Alpha-acetolactate decarboxylase [Ensembl]. Alpha-acetolactate decarboxylase [Interproscan].","protein_coding" "AAL00077"," ... ","Phosphoglycerate mutase [Ensembl]. Histidine phosphatase superfamily (branch 1) [Interproscan].","protein_coding" "AAK99714 ... ","maltose O-acetyltransferase [Ensembl]. Chorismate mutase type II, Maltose acetyltransferase, Hexapeptide repeat of succinyl- ... 2]IO[6]A)-hydroxylase (MiaE) [Interproscan].","protein_coding" "CRP67829","copA_5","Pseudomonas aeruginosa","Copper resistance ...
YPR060C 165.889039 INESSENTIAL ARO7 chorismate mutase,chorismate mutase, YIR034C 163.882468 INESSENTIAL LYS1 saccharopine ... 2.820493 INESSENTIAL ILV6 Small regulatory subunit of Acetolactate synthase,acetolactate synthase, YOR196C -2.825993 ... 0.517369 INESSENTIAL GPM2 phosphoglycerate mutase, involved in glycolysis, glycolysis*, phosphoglycerate mutase, cytosol ... 3.110739 INESSENTIAL GPM3 phosphoglycerate mutase, glycolysis*, phosphoglycerate mutase, cytosol YCL049C -3.113486 INESSENTIAL ...
Other names in common use include acetolactate mutase, and acetohydroxy acid isomerase. This enzyme participates in valine, ... In enzymology, a 2-acetolactate mutase (EC 5.4.99.3) is an enzyme that catalyzes the chemical reaction 2-acetolactate ⇌ {\ ... The systematic name of this enzyme class is 2-acetolactate methylmutase. ... 2-acetolactate, and one product, 3-hydroxy-3-methyl-2-oxobutanoate. This enzyme belongs to the family of isomerases, ...
Enzyme (substance) {90668006 , SNOMED-CT } Substance with mutase mechanism of action (substance) {130945002 , SNOMED-CT } ...
chorismate mutase activity GO:0004106 * trans-2-decenoyl-acyl-carrier-protein isomerase activity ...
Acetolactate decarboxylase. Acetolactate synthase. Acetone carboxylase. Acetone-cyanohydrin lyase. Acetoxybutynylbithiophene ... Hydroxyamino)benzene mutase. (Iso)eugenol O-methyltransferase. (R)-2-haloacid dehalogenase. (R)-2-hydroxy-fatty-acid ... 3-(hydroxyamino)phenol mutase. 3-(imidazol-5-yl)lactate dehydrogenase. 3-aci-nitropropanoate oxidase. 3-alpha (17-beta)- ... S)-2-haloacid dehalogenase. (S)-2-hydroxy-acid oxidase. (S)-2-hydroxy-fatty-acid dehydrogenase. (S)-2-methylmalate dehydratase ...
The genes for acetolactate synthase (alsS) and acetolactate decarboxylase (alsD), both involved in acetoin production, were up- ... phosphoglycerate mutase; pycA, pyruvate carboxylase; pykA, pyruvate kinase; SA2155, malate:quinone-oxidoreductase; sdhA, ... Additional file 2: Genes with higher expression in wild-type versus Δ ccpA mutant. The table represents genes showing a higher ... Figure 2. Northern blot analyses of CcpA-dependent genes. A, Transcription of genes showing differential expression in the ccpA ...
","Alpha-acetolactate decarboxylase [Ensembl]. Alpha-acetolactate decarboxylase [Interproscan].","protein_coding" "AAL00077"," ... ","Phosphoglycerate mutase [Ensembl]. Histidine phosphatase superfamily (branch 1) [Interproscan].","protein_coding" "AAK99714 ... ","maltose O-acetyltransferase [Ensembl]. Chorismate mutase type II, Maltose acetyltransferase, Hexapeptide repeat of succinyl- ... 2]IO[6]A)-hydroxylase (MiaE) [Interproscan].","protein_coding" "CRP67829","copA_5","Pseudomonas aeruginosa","Copper resistance ...
Acetolactate synthase catalytic subunit, mitochondrial (4) * Phosphoglycerate mutase 1 (4) * GTP cyclohydrolase-2 (4) ... Dolichyl-phosphate-mannose--protein mannosyltransferase 2 (4) * 2,5-diamino-6-ribosylamino-4(3H)-pyrimidinone 5-phosphate ... 1-phosphatidylinositol 3-phosphate 5-kinase FAB1 (2) * Putative inosine-5-monophosphate dehydrogenase-like protein YAR075W (2 ... Phosphatidylinositol 4,5-bisphosphate 5-phosphatase INP51 (2) * L-serine dehydratasePutative truncated L-serine dehydratase ...
Acetolactate synthase catalytic subunit, mitochondrial (4) * Phosphoglycerate mutase 1 (4) * GTP cyclohydrolase-2 (4) ... Dolichyl-phosphate-mannose--protein mannosyltransferase 2 (4) * 2,5-diamino-6-ribosylamino-4(3H)-pyrimidinone 5-phosphate ... 1-phosphatidylinositol 3-phosphate 5-kinase FAB1 (2) * Putative inosine-5-monophosphate dehydrogenase-like protein YAR075W (2 ... Phosphatidylinositol 4,5-bisphosphate 5-phosphatase INP51 (2) * L-serine dehydratasePutative truncated L-serine dehydratase ...
... independent phosphoglycerate mutase /product=phosphoglycerate mutase /protein_id=BAP60234.1 /transl_table=11 /translation ... alpha-acetolactate decarboxylase /protein_id=BAP60780.1 /transl_table=11 /translation= ... mutase /product=putative phosphoglycerate mutase /protein_id=BAP60764.1 /transl_table=11 /translation= ... chorismate mutase /protein_id=BAP60743.1 /transl_table=11 /translation=MSNSSEKRLEEIRKRINEIDEQLIELIAERTSFAPEIAALKKSL ...
YPR060C 165.889039 INESSENTIAL ARO7 chorismate mutase,chorismate mutase, YIR034C 163.882468 INESSENTIAL LYS1 saccharopine ... 2.820493 INESSENTIAL ILV6 Small regulatory subunit of Acetolactate synthase,acetolactate synthase, YOR196C -2.825993 ... 0.517369 INESSENTIAL GPM2 phosphoglycerate mutase, involved in glycolysis, glycolysis*, phosphoglycerate mutase, cytosol ... 3.110739 INESSENTIAL GPM3 phosphoglycerate mutase, glycolysis*, phosphoglycerate mutase, cytosol YCL049C -3.113486 INESSENTIAL ...
Acetolactate synthase large subunit (EC 2.2.1.6)::Acetolactate synthase small subunit (EC 2.2.1.6)::Long-chain-fatty-acid--CoA ... Chorismate mutase I (EC 5.4.99.5)::Prephenate dehydratase (EC 4.2.1.51)::2-keto-3-deoxy-D-arabino-heptulosonate-7-phosphate ... Phosphoglycerate mutase (EC 5.4.2.11)::UDP-glucose 4-epimerase (EC 5.1.3.2)::Inosine/xanthosine triphosphatase (EC 3.6.1.-):: ... Phosphoglucosamine mutase (EC 5.4.2.10)::Penicillin-binding protein 2 (PBP-2)::Rod shape-determining protein RodA::D-alanyl-D- ...
Acetolactate synthase isozyme 3 large subunit. 192. SEQF2969,KV788369.1. SEQF2969_00194 jb [NA] [AA] 1038/345. 62987-61950. ... UDP-galactopyranose mutase. 34. SEQF2969,KV788368.1. SEQF2969_00034 jb [NA] [AA] 252/83. 34942-35193. hypothetical protein. ... Acetolactate synthase isozyme 2 large subunit. 198. SEQF2969,KV788369.1. SEQF2969_00200 jb [NA] [AA] 1371/456. 71774-70404. ... AI-2 transport protein TqsA. 107. SEQF2969,KV788368.1. SEQF2969_00109 jb [NA] [AA] 1521/506. 119417-120937. Long-chain-aldehyde ...
acetolactate synthase 3 large subunit. 95. SEQF3707,CP072381.1. QUC05141.1 jb [NA] [AA] 492/163. 1055800-1056291. acetolactate ... 5-(carboxyamino)imidazole ribonucleotide mutase. 22. SEQF3707,CP072381.1. QUC05068.1 jb [NA] [AA] 1089/362. 978000-979088. 5-( ... tRNA 2-thiocytidine(32) synthetase TtcA. 29. SEQF3707,CP072381.1. QUC05075.1 jb [NA] [AA] 483/160. 985672-985190. C40 family ... hydrogenase 2 operon protein HybA. 44. SEQF3707,CP072381.1. QUC05090.1 jb [NA] [AA] 1227/408. 1000465-1001691. Ni/Fe- ...
Glyoxylate carboligase; acetolactate synthase large subunit ilvB 1407_ssl3769-sacB ATGTTGGTACTTTCCGTCCTATCTT… hypothetical ... phosphoglucosamine mutase 1523_sll1219-sacB ATGCACTACGCCATCCCCAAAACCT… hypothetical protein 1524_sll1218-sacB ... D-isomer specific 2-hydroxyacid dehydrogenase family 1483_slr2124-sacB ATGAAACCAGTTGTTCTTATCACCG… short-chain alcohol ... 14-dihydroxy-2-naphtoic acid prenyltransferase menA 1453_slr1519-sacB ATGGCTGGGCTGGCCTGGGCTAAGG… pentapeptide repeat-containing ...
2-polyprenyl-3-methyl-5-hydroxy-6-methoxy-1,4-benzoquinol O-methyltransferase activity ... 2-octaprenyl-3-methyl-5-hydroxy-6-methoxy-1,4-benzoquinone methyltransferase activity ...
","acetolactate synthase 3, small subunit, valine-sensitive [Ensembl]. ACT domain, Small subunit of acetolactate synthase [ ... ","chorismate mutase T [Ensembl]. Prephenate dehydrogenase, Chorismate mutase type II [Interproscan].","protein_coding" " ... ","acetolactate synthase II, small subunit [Ensembl]. ACT domain [Interproscan].","protein_coding" "AAL22753","STM3903"," ... ","acetolactate synthase II, large subunit [Ensembl]. Thiamine pyrophosphate enzyme [Interproscan].","protein_coding" "AAL22752 ...
Chorismate mutase activity specified by the aroQ domain could supply PPA for both PHE and TYR biosynthesis. Likewise, HisHb, ... acetolactate synthase, phenylalanine hydroxylase, prephenate dehydratase and formyltetrahydrofolate deformylase. Recruitment of ... The fusion physically links chorismate mutase (which forms PPA) with TyrAc_Δ (which utilizes PPA). The two protein domains of ... Chen S, Vincent S, Wilson DB, Ganem B: Mapping of chorismate mutase and prephenate dehydrogenase domains in the Escherichia ...
fig,[email protected][email protected]^Organic [email protected]^Alpha-acetolactate [email protected]^Alpha-acetolactate decarboxylase (EC 4.1.1.5)@^ ... Phosphoglucosamine mutase (EC 5.4.2.10)@^fig,644279.4.peg.2300, fig,[email protected]~Cell Wall and [email protected]^Cell Wall and ... fig,[email protected][email protected]^Organic [email protected]^Alpha-acetolactate [email protected]^Acetolactate synthase, catabolic (EC 2.2.1.6)@^ ... Alpha-acetolactate operon (3). Fermentation (38). Butanol Biosynthesis (4). Fermentations: Mixed acid (12). Fermentations: ...
Chorismate Mutase [D08.811.399.520.250] * Methylmalonyl-CoA Mutase [D08.811.399.520.625] * Phosphotransferases (Phosphomutases ... 2-Acetolactate Mutase Preferred Term Term UI T043966. Date01/01/1999. LexicalTag NON. ThesaurusID NLM (1975). ... 2-Acetohydroxy-3-Ketoacid Isomeroreductase Term UI T043965. Date11/11/1974. LexicalTag NON. ThesaurusID UNK (19XX). ... 2-Acetolactate Mutase Preferred Concept UI. M0023185. Registry Number. EC 5.4.99.3. Scope Note. An enzyme involved in the ...
Chorismate Mutase [D08.811.399.520.250] * Methylmalonyl-CoA Mutase [D08.811.399.520.625] * Phosphotransferases (Phosphomutases ... 2-Acetolactate Mutase Preferred Term Term UI T043966. Date01/01/1999. LexicalTag NON. ThesaurusID NLM (1975). ... 2-Acetohydroxy-3-Ketoacid Isomeroreductase Term UI T043965. Date11/11/1974. LexicalTag NON. ThesaurusID UNK (19XX). ... 2-Acetolactate Mutase Preferred Concept UI. M0023185. Registry Number. EC 5.4.99.3. Scope Note. An enzyme involved in the ...
Human N0000168121 Chorismate Mutase N0000166668 Chorismic Acid N0000007918 Chromans N0000007919 Chromates N0000169072 Chromatin ... Acetohexamide N0000006036 acetohydroxamic acid N0000166800 Acetoin N0000167958 Acetoin Dehydrogenase N0000169059 Acetolactate ... N0000166719 Methylmalonic Acid N0000168054 Methylmalonyl-CoA Decarboxylase N0000168120 Methylmalonyl-CoA Mutase N0000168446 ... 27 N0000170401 D-Ala(2),MePhe(4),Met(0)-ol-enkephalin N0000168380 D-Alanine Transaminase N0000167841 D-Amino-Acid Oxidase ...
D8.811.682.47.50 Acetolactate Synthase D8.586.520.224.600.100 D8.811.520.224.600.100 Acetyl Coenzyme A D8.176.211.300.75 D8.211 ... Methylmalonyl-CoA Mutase D8.586.399.520.625 D8.811.399.520.625 Methylobacillus B3.440.400.425.485 B3.660.75.495.500 B3.660. ... B1.150.900.649.77.380.120 Bisphosphoglycerate Mutase D8.586.399.520.750.250 D8.811.399.520.750.250 Black Widow Spider B1.131. ... D6.472.785.400.125 Chorismate Mutase D8.586.399.520.250 D8.811.399.520.250 Chromaffin Granules A11.284.195.190.500.207 A11.284. ...
"Methylmalonyl-CoA Mutase" is a descriptor in the National Library of Medicines controlled vocabulary thesaurus, MeSH (Medical ... This graph shows the total number of publications written about "Methylmalonyl-CoA Mutase" by people in this website by year, ... Below are the most recent publications written about "Methylmalonyl-CoA Mutase" by people in Profiles. ... Below are MeSH descriptors whose meaning is more general than "Methylmalonyl-CoA Mutase". ...
Bisphosphoglycerate Mutase Bisphosphonate-Associated Osteonecrosis of the Jaw Bite Force Bites and Stings Bites, Human ... Acetolactate Synthase Acetone Acetonitriles Acetophenones Acetoxyacetylaminofluorene Acetrizoic Acid Acetyl Coenzyme A Acetyl- ... Chorismate Mutase Chorismic Acid Choristoma Choroid Choroid Diseases Choroid Hemorrhage Choroid Neoplasms Choroid Plexus ... 2),MePhe(4),Met(0)-ol-enkephalin D-Alanine Transaminase D-Amino-Acid Oxidase D-Aspartate Oxidase D-Aspartic Acid D-Xylulose ...
Acetolactate synthase catalytic subunit, mitochondrial (8) * Phosphoglycerate mutase 1 (8) * GTP cyclohydrolase-2 (8) ... Inactive deaminase YJL070C (2) * L-serine dehydratasePutative truncated L-serine dehydratase SDL1Putative truncated L-serine ... Phosphatidylinositol 4,5-bisphosphate-binding protein SLM1 (2) * Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase ... Enolase-related protein 1Enolase-related protein 2 (2) * Putative inosine-5-monophosphate dehydrogenase-like protein YAR075W ( ...
EC 5.4.99.67: 4-amino-4-deoxychorismate mutase *. *No Wikipedia article. EC 5.5: Intramolecular Lyases[]. EC 5.5.1: ... EC 5.4.2.13: phosphogalactosamine mutase *. *No Wikipedia article. EC 5.4.3: Transferring Amino Groups[]. *EC 5.4.3.1: deleted ... EC 5.4.2.11: phosphoglycerate mutase (2,3-diphosphoglycerate-dependent). *EC 5.4.2.12: phosphoglycerate mutase (2,3- ... EC 5.4.2.1: Now recognized as two separate enzymes EC 5.4.2.11, phosphoglycerate mutase (2,3-diphosphoglycerate-dependent) and ...
... acetolactate synthase Rhto_03298; acetolactate synthase small subunit Rhto_03988) was detected in xylose- as compared to ... Apart from upregulation of phosphoglycerate mutase during growth on xylose, no significant differences were observed in the ... acetolactate synthase Rhto_03298; ketol-acid reductoisomerase Rhto_04566) and the interconversion of methionine and cysteine ( ... Table 2 Lipid class composition of R. toruloides presented as percentage of total identified lipids. Full size table. ...
... chorismate mutase rps17E 117441 - 117623 + , 30S ribosomal protein S17e TERM 65 117623 - 117637 + F 78 -3.6 -5.99318 , opp_ ... acetolactate synthase 3 regulatory subunit ilvB1 29483 - 27804 - , IlvB1 Msp_0027 29173 - 29499 + , hypothetical protein ilvH ... cofactor-independent phosphoglycerate mutase TERM 914 1463690 - 1463718 + F 84 -5.6 -5.7506 , gap 1, opp_overlap 1463693 ... UDP-galactopyranose mutase TERM 41 79532 - 79556 + g 78 -6.5 -4.788 , TATAGTTACATAATC TTCCCATAAAT GTT ATTTGAGGGAA ...
... acetolactate synthase ALS,acid labile subunit ALS,acid-labile subunit ALS,acute lateral sclerosis ALS,advanced life support ALS ... chorismate mutase Cm,chronic meningitis Cm,chylomicron Cm,circular muscle Cm,circulating monocyte Cm,clindamycin Cm,clinical ... shell> lvg -f:a -F:1:2. II. Test Cases: IOTA,information overload testing aid IOTA,international ovarian tumor analysis IOTA, ... isoelectric point IGF-2,insulin-like growth factor 2 IGF-2,insulin-like growth factor 2 IGF-2,insulin-like growth factor 2 IGF- ...
... acetolactate synthase ALS,acid labile subunit ALS,acid-labile subunit ALS,acute lateral sclerosis ALS,advanced life support ALS ... chorismate mutase Cm,chronic meningitis Cm,chylomicron Cm,circular muscle Cm,circulating monocyte Cm,clindamycin Cm,clinical ... shell> lvg -f:a -F:1:2. II. Test Cases: IOTA,information overload testing aid IOTA,international ovarian tumor analysis IOTA, ... isoelectric point IGF-2,insulin-like growth factor 2 IGF-2,insulin-like growth factor 2 IGF-2,insulin-like growth factor 2 IGF- ...
... beta-lumicolchicine beta lumicolchicines beta-lumicolchicines beta lysin beta-lysin beta lysine mutase beta-lysine mutase beta ... acetohydroxybutyrate acetoin acetoin dehydrogenase acetoin dehydrogenases acetokinase acetokinases acetol acetolactate acetols ... alpha-methylbutyryl coenzyme A alphamethyldopa alpha methyldopa alpha-methyldopa alpha-methyleneglutarate mutase alpha- ... acids bisphosphatidic acids bisphosphine bisphosphines bisphospho bisphosphoglycerate bisphosphoglycerate mutase ...
","Acetolactate synthase 1, chloroplastic OS=Brassica napus (sp,p27818,ilvb1_brana : 235.0)","protein_coding" "Gb_14994","No ... ","chorismate mutase 3","protein_coding" "AT1G69920","GSTU12","Arabidopsis thaliana","glutathione S-transferase TAU 12"," ... subunit 2 of Pol V RNA polymerase","protein_coding" "Gb_31813","No alias","Gingko biloba","F-box/kelch-repeat protein At5g15710 ... ","Acetolactate synthase 1, chloroplastic OS=Nicotiana tabacum (sp,p09342,ilvb1_tobac : 211.0)","protein_coding" "Gb_40088","No ...
... beta-lumicolchicine beta lumicolchicines beta-lumicolchicines beta lysin beta-lysin beta lysine mutase beta-lysine mutase beta ... acetohydroxybutyrate acetoin acetoin dehydrogenase acetoin dehydrogenases acetokinase acetokinases acetol acetolactate acetols ... alpha-methylbutyryl coenzyme A alphamethyldopa alpha methyldopa alpha-methyldopa alpha-methyleneglutarate mutase alpha- ... acids bisphosphatidic acids bisphosphine bisphosphines bisphospho bisphosphoglycerate bisphosphoglycerate mutase ...
fig,[email protected][email protected]^Organic [email protected]^Alpha-acetolactate [email protected]^Alpha-acetolactate decarboxylase (EC 4.1.1.5)@^ ... Phosphoglucosamine mutase (EC 5.4.2.10)@^fig,553590.4.peg.1101, fig,[email protected]~Cell Wall and [email protected]^Cell Wall and ... fig,[email protected][email protected]^Organic [email protected]^Alpha-acetolactate [email protected]^Acetolactate synthase, catabolic (EC 2.2.1.6)@^ ... Alpha-acetolactate operon (3). Fermentation (42). Butanol Biosynthesis (4). Fermentations: Mixed acid (14). Fermentations: ...
  • Other names in common use include acetolactate mutase, and acetohydroxy acid isomerase. (wikipedia.org)
  • ACT domain, Small subunit of acetolactate synthase [Interproscan]. (ntu.edu.sg)