An enzyme localized predominantly within the plasma membrane of lymphocytes. It catalyzes the transfer of long-chain fatty acids, preferentially unsaturated fatty acids, to lysophosphatides with the formation of 1,2-diacylglycero-3-phosphocholine and CoA. EC
Enzymes from the transferase class that catalyze the transfer of acyl groups from donor to acceptor, forming either esters or amides. (From Enzyme Nomenclature 1992) EC 2.3.
An enzyme that transfers acyl groups from acyl-CoA to glycerol-3-phosphate to form monoglyceride phosphates. It acts only with CoA derivatives of fatty acids of chain length above C-10. Also forms diglyceride phosphates. EC
An enzyme secreted from the liver into the plasma of many mammalian species. It catalyzes the esterification of the hydroxyl group of lipoprotein cholesterol by the transfer of a fatty acid from the C-2 position of lecithin. In familial lecithin:cholesterol acyltransferase deficiency disease, the absence of the enzyme results in an excess of unesterified cholesterol in plasma. EC
An enzyme that catalyses the last step of the TRIACYLGLYCEROL synthesis reaction in which diacylglycerol is covalently joined to LONG-CHAIN ACYL COA to form triglyceride. It was formerly categorized as EC
An enzyme that catalyzes the formation of cholesterol esters by the direct transfer of the fatty acid group from a fatty acyl CoA derivative. This enzyme has been found in the adrenal gland, gonads, liver, intestinal mucosa, and aorta of many mammalian species. EC
An autosomal recessively inherited disorder caused by mutation of LECITHIN CHOLESTEROL ACYLTRANSFERASE that facilitates the esterification of lipoprotein cholesterol and subsequent removal from peripheral tissues to the liver. This defect results in low HDL-cholesterol level in blood and accumulation of free cholesterol in tissue leading to a triad of CORNEAL OPACITY, hemolytic anemia (ANEMIA, HEMOLYTIC), and PROTEINURIA.
Lipid infiltration of the hepatic parenchymal cells resulting in a yellow-colored liver. The abnormal lipid accumulation is usually in the form of TRIGLYCERIDES, either as a single large droplet or multiple small droplets. Fatty liver is caused by an imbalance in the metabolism of FATTY ACIDS.
Steroid acids and salts. The primary bile acids are derived from cholesterol in the liver and usually conjugated with glycine or taurine. The secondary bile acids are further modified by bacteria in the intestine. They play an important role in the digestion and absorption of fat. They have also been used pharmacologically, especially in the treatment of gallstones.
A condition produced by a deficiency of CHOLINE in animals. Choline is known as a lipotropic agent because it has been shown to promote the transport of excess fat from the liver under certain conditions in laboratory animals. Combined deficiency of choline (included in the B vitamin complex) and all other methyl group donors causes liver cirrhosis in some animals. Unlike compounds normally considered as vitamins, choline does not serve as a cofactor in enzymatic reactions. (From Saunders Dictionary & Encyclopedia of Laboratory Medicine and Technology, 1984)
The systematic identification and quantitation of all the metabolic products of a cell, tissue, organ, or organism under varying conditions. The METABOLOME of a cell or organism is a dynamic collection of metabolites which represent its net response to current conditions.
A mass spectrometry technique used for analysis of nonvolatile compounds such as proteins and macromolecules. The technique involves preparing electrically charged droplets from analyte molecules dissolved in solvent. The electrically charged droplets enter a vacuum chamber where the solvent is evaporated. Evaporation of solvent reduces the droplet size, thereby increasing the coulombic repulsion within the droplet. As the charged droplets get smaller, the excess charge within them causes them to disintegrate and release analyte molecules. The volatilized analyte molecules are then analyzed by mass spectrometry.
Complex sets of enzymatic reactions connected to each other via their product and substrate metabolites.
A large lobed glandular organ in the abdomen of vertebrates that is responsible for detoxification, metabolism, synthesis and storage of various substances.
The dynamic collection of metabolites which represent a cell's or organism's net metabolic response to current conditions.
C22-unsaturated fatty acids found predominantly in FISH OILS.
Organic, monobasic acids derived from hydrocarbons by the equivalent of oxidation of a methyl group to an alcohol, aldehyde, and then acid. Fatty acids are saturated and unsaturated (FATTY ACIDS, UNSATURATED). (Grant & Hackh's Chemical Dictionary, 5th ed)
A saturated 14-carbon fatty acid occurring in most animal and vegetable fats, particularly butterfat and coconut, palm, and nutmeg oils. It is used to synthesize flavor and as an ingredient in soaps and cosmetics. (From Dorland, 28th ed)
14-carbon saturated monocarboxylic acids.
FATTY ACIDS in which the carbon chain contains one or more double or triple carbon-carbon bonds.
Biological molecules that possess catalytic activity. They may occur naturally or be synthetically created. Enzymes are usually proteins, however CATALYTIC RNA and CATALYTIC DNA molecules have also been identified.
The terms, expressions, designations, or symbols used in a particular science, discipline, or specialized subject area.
Four or five slender jointed digits in humans and primates, attached to each HAND.
A broad category of oxidoreductases that either reduce double bonds or oxidize single bonds between OXYGEN and CARBON in organic compounds.
A transferase that catalyzes the addition of aliphatic, aromatic, or heterocyclic FREE RADICALS as well as EPOXIDES and arene oxides to GLUTATHIONE. Addition takes place at the SULFUR. It also catalyzes the reduction of polyol nitrate by glutathione to polyol and nitrite.
A genus of gram-negative bacteria widely distributed in fresh water as well as marine and hypersaline habitats.
A enzyme that catalyzes the transfer of acetyl groups from ACETYL CoA to acyl-carrier protein to form COENZYME A and acetyl-acyl-carrier protein.
A plant species of the family CUCURBITACEAE, order Violales, subclass Dilleniidae known for the melon fruits with reticulated (net) surface including cantaloupes, honeydew, casaba, and Persian melons.
The use of statistical methods in the analysis of a body of literature to reveal the historical development of subject fields and patterns of authorship, publication, and use. Formerly called statistical bibliography. (from The ALA Glossary of Library and Information Science, 1983)
Criminal acts committed during, or in connection with, war, e.g., maltreatment of prisoners, willful killing of civilians, etc.
Copies of a work or document distributed to the public by sale, rental, lease, or lending. (From ALA Glossary of Library and Information Science, 1983, p181)
"The business or profession of the commercial production and issuance of literature" (Webster's 3d). It includes the publisher, publication processes, editing and editors. Production may be by conventional printing methods or by electronic publishing.

Synthesis of azidophospholipids and labeling of lysophosphatidylcholine acyltransferase from developing soybean cotyledons. (1/118)

A photoreactive substrate analog of lysophosphatidylcholine (LPC), 1-([(4-azidosalicyl)-12-amino)]dodecanoyl-sn-glycerol-3-phospho cholin e (azido-LPC) was synthesized. Fast atom bombardment mass spectrometry was employed to confirm the structures of azido-LPC and its intermediates. Azido-LPC was used to label putative acyl-CoA:LPC acyltransferase from microsomal membranes of developing soybean cotyledons. The synthesized substrate analog acts as a substrate for the target acyltransferases and phospholipases in the dark. When the microsomal membranes were incubated with the acyl acceptor analog and immediately photolyzed, LPC acyltransferase was irreversibly inhibited. Photoinactivation of the enzyme by the photoprobe decreased in the presence of LPC. Microsomal membranes were photolyzed with 125I-labeled azido-LPC and analyzed by SDS-PAGE followed by autoradiography. These revealed that the analog preferentially labeled 54- and 114-kDa polypeptides. Substrate protected the labeling of both the polypeptides. In our earlier report, the same polypeptides were also labeled with photoreactive acyl-CoA analogs, suggesting that these polypeptides could be putative LPC acyltransferase(s). These results demonstrated that the photoreactive phospholipid analog could be a powerful tool to label acyltransferases involved in lipid biosynthesis.  (+info)

Effects of inhibitors of arachidonic acid turnover on the production of prostaglandins by the guinea-pig uterus. (2/118)

The supply of free arachidonic acid from phospholipids is generally regarded as the rate-limiting step for prostaglandin (PG) synthesis by tissues. Two enzymes involved in arachidonic acid uptake into, and release from, phospholipids are acyl-CoA:lysophospholipid acyltransferase (ACLAT) and phospholipase A2 (PLA2), respectively. PGF2 alpha produced by the endometrium induces luteolysis in several species including guinea-pigs. Thimerosal, an inhibitor of ACLAT, and aristolochic acid, an inhibitor of PLA2, both reduced, in a concentration-dependent manner, the output of PGF2 alpha from guinea-pig endometrium cultured for 24 h on days 7 and 15 of the oestrous cycle. This study showed that the continual production of PGF 2 alpha by guinea-pig endometrium is not only dependent upon the activity of PLA2 for releasing free arachidonic acid for PGF2 alpha synthesis, but also on the incorporation of arachidonic acid into the phospholipid pool by the activity of ACLAT. The inhibitory effects of thimerosal and aristolochic acid on the outputs of PGE2 and 6-keto-PGF1 alpha were less marked, particularly on day 7 when the low output of PGE2 was unaffected and the output of 6-keto-PGF1 alpha was increased at the lower concentrations of thimerosal. This finding indicates that there are different pools of arachidonic acid bound as phospholipid for the syntheses of PGF2 alpha and 6-keto-PGF1 alpha by guinea-pig endometrium.  (+info)

Inhibition of the plastidial phosphatidylcholine synthesis by silver, copper, lead and mercury induced by formation of mercaptides with the lyso-PC acyltransferase. (3/118)

Plastids greatly rely on the import of extraplastidial precursors for the synthesis of their own lipids, and several studies have shown that a lyso-PC acyltransferase located in the envelope may be involved in the import process. Because the presence of heavy metals in soil or in nutrient solutions induces changes in the lipid composition of plastid membranes (and therefore greatly reduces the photosynthetic capability of plants), we analysed the effect of several metal salts on plastidial lyso-PC acyltransferase activity. Among the 12 heavy metals studied, silver, copper, mercury and lead inhibited this activity. Metal bound to the enzyme was not - or only very slightly - released from the protein except when thiol-reducing agents (and not imidazole) were added. The results strongly suggest that the inhibitory effect is due to a formation of mercaptide between metal and cysteine(s). The relationship between the inhibition of the plastidial lyso-PC acyltransferase activity and the in vivo effects of metal salts on the plastid membranes is discussed.  (+info)

Acylation of lysophosphatidylcholine plays a key role in the response of monocytes to lipopolysaccharide. (4/118)

Mononuclear phagocytes play a pivotal role in the progression of septic shock by producing tumor necrosis factor-alpha (TNF-alpha) and other inflammatory mediators in response to lipopolysaccharide (LPS) from Gram-negative bacteria. Our previous studies have shown monocyte and macrophage activation correlate with changes in membrane phospholipid composition, mediated by acyltransferases. Interferon-gamma (IFN-gamma), which activates and primes these cells for enhanced inflammatory responses to LPS, was found to selectively activate lysophosphatidylcholine acyltransferase (LPCAT) (P < 0.05) but not lysophosphatidic acid acyltransferase (LPAAT) activity. When used to prime the human monocytic cell line MonoMac 6, the production of TNF-alpha and interleukin-6 (IL-6) was approximately five times greater in cells primed with IFN-gamma than unprimed cells. Two LPCAT inhibitors SK&F 98625 (diethyl 7-(3,4,5-triphenyl-2-oxo2,3-dihydro-imidazole-1-yl)heptane phosphonate) and YM 50201 (3-hydroxyethyl 5,3'-thiophenyl pyridine) strongly inhibited (up to 90%) TNF-alpha and IL-6 production in response to LPS in both unprimed MonoMac-6 cells and in cells primed with IFN-gamma. In similar experiments, these inhibitors also substantially decreased the response of both primed and unprimed peripheral blood mononuclear cells to LPS. Sequence-based amplification methods showed that SK&F 98625 inhibited TNF-alpha production by decreasing TNF-alpha mRNA levels in MonoMac-6 cells. Taken together, the data from these studies suggest that LPCAT is a key enzyme in both the pathways of activation (priming) and the inflammatory response to LPS in monocytes.  (+info)

Inhibition of a Golgi complex lysophospholipid acyltransferase induces membrane tubule formation and retrograde trafficking. (5/118)

Recent studies have suggested that formation of Golgi membrane tubules involves the generation of membrane-associated lysophospholipids by a cytoplasmic Ca2+-independent phospholipase A2 (PLA2). Herein, we provide additional support for this idea by showing that inhibition of lysophospholipid reacylation by a novel Golgi-associated lysophosphatidylcholine acyltransferase (LPAT) induces the rapid tubulation of Golgi membranes, leading in their retrograde movement to the endoplasmic reticulum. Inhibition of the Golgi LPAT was achieved by 2,2-dimethyl-N-(2,4,6-trimethoxyphenyl)dodecanamide (CI-976), a previously characterized antagonist of acyl-CoA cholesterol acyltransferase. The effect of CI-976 was similar to that of brefeldin A, except that the coatomer subunit beta-COP remained on Golgi-derived membrane tubules. CI-976 also enhanced the cytosol-dependent formation of tubules from Golgi complexes in vitro and increased the levels of lysophosphatidylcholine in Golgi membranes. Moreover, preincubation of cells with PLA2 antagonists inhibited the ability of CI-976 to induce tubules. These results suggest that Golgi membrane tubule formation can result from increasing the content of lysophospholipids in membranes, either by stimulation of a PLA2 or by inhibition of an LPAT. These two opposing enzyme activities may help to coordinately regulate Golgi membrane shape and tubule formation.  (+info)

The activities of acyl-CoA:1-acyl-lysophospholipid acyltransferase(s) in human platelets. (6/118)

The activities of acyl-CoA:1-acyl-lysophospholipid acyltransferases (EC have been studied in human platelet lysates by using endogenously formed [14C]acyl-CoA from [14C]fatty acid, ATP and CoA in the presence of 1-acyl-lysophosphatidyl-choline (lysoPC), -ethanolamine (lysoPE), -serine (lysoPS) or -inositol (lysoPI). Linoleic acid as fatty acid substrate had the highest affinity to acyl-CoA:1-acyl-lysophospholipid acyltransferase with lysoPC as variable substrate, followed by eicosapentaenoic acid (EPA) and arachidonic acid (AA). The activity at optimal conditions was 7.4, 7.3 and 7.2 nmol/min per 10(9) platelets with lysoPC as substrate, with linoleic acid, AA and EPA respectively. EPA and AA were incorporated into all lyso-forms. Linoleic acid was also incorporated into lysoPE at a high rate, but less into lysoPS and lysoPI. DHA was incorporated into lysoPC and lysoPE, but only slightly into lysoPI and lysoPS. Whereas incorporation of all fatty acids tested was maximal for lysoPC and lysoPI at 200 and 80 microM respectively, maximal incorporation needed over 500 microM for lysoPE and lysoPS. The optimal concentration for [14C]fatty acid substrates was in the range 15-150 microM for all lysophospholipids. Competition experiments with equimolar concentrations of either lysoPC and lysoPI or lysoPE resulted in formation of [14C]PC almost as if lysoPI or lysoPE were not added to the assay medium.  (+info)

Effect of apoprotein B conformation on the activation of lysolecithin acyltransferase and lecithin: cholesterol acyltransferase. Studies with subfractions of low density lipoproteins. (7/118)

In order to determine the role of apoprotein (apo) B conformation in the activation of the lysolecithin acyl-transferase reaction, we studied the activation of purified enzyme by various subfractions of low density lipoprotein (LDL), isolated by density gradient centrifugation. The activation of LAT correlated positively with the density of LDL and negatively with cholesterol/protein and triglyceride (TG)/protein ratios. The enzyme activation was also positively correlated with the number of trinitrobenzenesulfonic acid-reactive lysine amino groups, which increased with increasing density of LDL. The immunoaffinity of the LDL subfractions for B1B6, a monoclonal antibody directed to the receptor-binding region of apoB, increased with increasing density, while the affinity toward C1.4, a monoclonal antibody directed to the amino-terminal region of apoB, was not altered. Enrichment of normal whole LDL with TG resulted in a 45% reduction in enzyme activation, a 27% decrease in the number of trinitrobenzenesulfonic acid-reactive lysine groups, and a marked reduction in the immunoaffinity for B1B6. All these parameters reversed to normal when the TG-enriched LDL was treated with milk lipoprotein lipase, which specifically reduced the TG content of LDL. The LDL subfractions also supported cholesterol esterification by the purified enzyme, in parallel with lysolecithin esterification, indicating that apoB can also serve as an activator of the lecithin-cholesterol acyltransferase reaction. These results strongly suggest that the localized conformational change of apoB which occurs during the TG depletion of the precursor particle is critical for its activation of acyltransferase reactions, in a manner analogous to its interaction with the cellular receptors.  (+info)

Ypr140wp, 'the yeast tafazzin', displays a mitochondrial lysophosphatidylcholine (lyso-PC) acyltransferase activity related to triacylglycerol and mitochondrial lipid synthesis. (8/118)

When the yeast protein Ypr140w was expressed in Escherichia coli, a lyso-PC [lysophosphatidylcholine (1-acylglycerophosphorylcholine)] acyltransferase activity was found associated with the membranes of the bacteria. To our knowledge, this is the first identification of a protein capable of catalysing the acylation of lyso-PC molecules to form PC. Fluorescence microscopy analysis of living yeasts revealed that the fusion protein Ypr140w-green fluorescent protein is targeted to the mitochondria. Moreover, in contrast with wild-type cells, in the absence of acyl-CoA, the yeast mutant deleted for the YPR140w gene has no lyso-PC acyltransferase activity associated with the mitochondrial fraction. When yeast cells were grown in the presence of lactate, the mutant synthesized 2-fold more triacylglycerols when compared with the wild-type. Moreover, its mitochondrial membranes contained a lesser amount of PC and cardiolipin, and the fatty acid composition of these latter was greatly changed. These modifications were accompanied by a 2-fold increase in the respiration rates (states 3 and 4) of the mitochondria. The relationship between the deletion of the YPR140w gene and the lipid composition of the ypr140wDelta cells is discussed.  (+info)

Objective HCV is intimately linked with the liver lipid metabolism, devoted to the efflux of triacylglycerols stored in lipid droplets (LDs) in the form of triacylglycerol-rich very-low-density lipoproteins (VLDLs): (i) the most infectious HCV particles are those of lowest density due to association with triacylglycerol-rich lipoproteins and (ii) HCV-infected patients frequently develop hepatic steatosis (increased triacylglycerol storage). The recent identification of lysophosphatidylcholine acyltransferase 1 (LPCAT1) as an LD phospholipid-remodelling enzyme prompted us to investigate its role in liver lipid metabolism and HCV infectious cycle. ...
The budding yeast ALE1 gene encodes a lysophospholipid acyltransferase (LPLAT) with broad specificity. We show that yeast LPLAT (ScLPLAT) belongs to a distinct protein family that includes human MBOAT1, MBOAT2, MBOAT4, and several closely related proteins from other eukaryotes. We further show that two plant proteins within this family, the Arabidopsis proteins AtLPLAT1 and AtLPLAT2, possess lysophospholipid acyltransferase activities similar to ScLPLAT. We propose that other members of this protein family, which we refer to as the LPLAT family, also are likely to possess LPLAT activity. Finally, we show that ScLPLAT differs from the specific lysophosphatidic acid acyltransferase that is encoded by SLC1 in that it cannot efficiently use lysophosphatidic acid produced by acylation of glycerol-3-phosphate in vitro.. ...
Acyltransferase which contributes to the regulation of free arachidonic acid (AA) in the cell through the remodeling of phospholipids. Mediates the conversion of lysophosphatidylinositol (1-acylglycerophosphatidylinositol or LPI) into phosphatidylinositol (1,2-diacyl-sn-glycero-3-phosphoinositol or PI) (LPIAT activity). Prefers arachidonoyl-CoA as the acyl donor. Lysophospholipid acyltransferases (LPLATs) catalyze the reacylation step of the phospholipid remodeling pathway also known as the Lands cycle. Required for cortical lamination during brain development (By similarity).
In enzymology, a phosphatidylcholine---sterol O-acyltransferase (EC is an enzyme that catalyzes the chemical reaction phosphatidylcholine + a sterol ⇌ {\displaystyle \rightleftharpoons } 1-acylglycerophosphocholine + a sterol ester Thus, the two substrates of this enzyme are phosphatidylcholine and sterol, whereas its two products are 1-acylglycerophosphocholine and sterol ester. This enzyme belongs to the family of transferases, specifically those acyltransferases transferring groups other than aminoacyl groups. The systematic name of this enzyme class is phosphatidylcholine:sterol O-acyltransferase. Other names in common use include lecithin---cholesterol acyltransferase, phospholipid---cholesterol acyltransferase, LCAT (lecithin-cholesterol acyltransferase), lecithin:cholesterol acyltransferase, and lysolecithin acyltransferase. This enzyme participates in glycerophospholipid metabolism. Bartlett K, Keat MJ, Mercer EI (1974). Biosynthesis of sterol esters in Phycomyces ...
Displays acyl-CoA-dependent lysophospholipid acyltransferase activity with a subset of lysophospholipids as substrates; converts lysophosphatidylethanolamine to phosphatidylethanolamine, 1-alkenyl-lysophatidylethanolamine to 1-alkenyl-phosphatidylethanolamine, lysophosphatidylglycerol and alkyl-lysophosphatidylcholine to phosphatidylglycerol and alkyl-phosphatidylcholine, respectively. In contrast, has no lysophosphatidylinositol, glycerol-3-phosphate, diacylglycerol or lysophosphatidic acid acyltransferase activity. Prefers long chain acyl-CoAs (C16, C18) as acyl donors (By similarity). Converts lysophosphatidylcholine to phosphatidycholine.
Displays acyl-CoA-dependent lysophospholipid acyltransferase activity with a subset of lysophospholipids as substrates; converts lysophosphatidylethanolamine to phosphatidylethanolamine, lysophosphatidylcholine to phosphatidycholine, 1-alkenyl-lysophatidylethanolamine to 1-alkenyl-phosphatidylethanolamine, lysophosphatidylglycerol and alkyl-lysophosphatidylcholine to phosphatidylglycerol and alkyl-phosphatidylcholine, respectively. In contrast, has no lysophosphatidylinositol, glycerol-3-phosphate, diacylglycerol or lysophosphatidic acid acyltransferase activity. Prefers long chain acyl-CoAs (C16, C18) as acyl donors ...
PubMed Central Canada (PMC Canada) provides free access to a stable and permanent online digital archive of full-text, peer-reviewed health and life sciences research publications. It builds on PubMed Central (PMC), the U.S. National Institutes of Health (NIH) free digital archive of biomedical and life sciences journal literature and is a member of the broader PMC International (PMCI) network of e-repositories.
1. Abate W andJackson SK (2015). Lysophosphatidylcholine Acyltransferase (LPCAT)- 2 Co-localises withTLR4 and Regulates Macrophage Inflammatory Gene expression in Response to LPS.FASEB 22(1):888 2. Helley MP, AbateW, Jackson SK, Bennett JH & Thompson SWN 2015. THE EXPRESSION OFTOLL-LIKE RECEPTOR 4, 7 AND CO-RECEPTORS IN NEUROCHEMICAL SUB-POPULATIONS OFRAT TRIGEMINAL GANGLION SENSORY NEURONS NEUROSCIENCE 310, 686-698 3. Rawson FJ, HicksJ, Dodd N, Abate W, Garrett DJ, Yip N, Fejer G, Downard AJ, Baronian KHR &Jackson SK 2015. Fast, Ultrasensitive Detection of Reactive Oxygen Species Using aCarbon Nanotube Based-Electrocatalytic Intracellular Sensor ACS APPLIEDMATERIALS & INTERFACES 7, (42) 23527-23537 4. Alrammah H, Abate, W., Avent, N.,Jackson, S. K. (2015) Overexpression of lysophosphatidylcholine acyltransferase 2 (LPCAT2)up-regulated LPS-induced responses in a murine macrophage cell line. Immunology, 143. 5. Sattar A, Bradley G, Abate W, Fejer G, Jackson SK (2015)Evaluation of health ...
Sigma-Aldrich offers abstracts and full-text articles by [Tomomi Shida-Sakazume, Yosuke Endo-Sakamoto, Motoharu Unozawa, Chonji Fukumoto, Ken Shimada, Atsushi Kasamatsu, Katsunori Ogawara, Hidetaka Yokoe, Masashi Shiiba, Hideki Tanzawa, Katsuhiro Uzawa].
Plant Acyl-CoA:Lysophosphatidylcholine Acyltransferases (LPCATs) have different specificities in their forward and reverse reactions
In addition to the better characterized COPI-dependent retrograde Golgi-to-ER pathway, a second COPI-independent pathway has also been identified. This pathway is RAB6 dependent and transports cargo such as glycosylation enzymes and Shiga and Shiga-like toxin through tubular carriers rather than vesicles (White et al, 1999; Girod et al, 1999; reviewed in Heffernan and Simpson, 2014). In the absence of a COPI coat, the membrane curvature necessary to initiate tubulation may be provided through the action of phospholipase A, which hydrolyzes phospholipids at the sn2 position to yield lysophospholipids. This activity is countered by lysophospholipid acyltransferases, and the balance of these may influence whether transport tubules or transport vesicles form (de Figuiredo et al, 1998; reviewed in Bechler et al, 2012). RAB6-dependent tubules also depend on the dynein-dynactin motor complex and the hoomodimeric Bicaudal proteins (Matanis et al, 2002; Yamada et al, 2013; reviewed in Heffernan and ...
Background em Anopheles stephensi /em mitochondrial malic enzyme (Me personally) surfaced as having another part in the provision of pyruvate for the Krebs routine because inhibition of the enzyme leads to the entire abrogation of air uptake by mitochondria. em Homo sapiens /em . Measurements of Me personally activity in mosquito mitochondria isolated from ASE cells demonstrated that ( em i /em ) em Vmax /em with NAD+ was 3-fold greater than that with NADP+, ( em ii /em ) addition of Mg2+ or Mn2+ improved the em Vmax /em by 9- to 21-fold, with Mn2+ 2.3-fold far better than Mg2+, ( em iii /em ) succinate and fumarate increased the experience by 2- and 5-fold, 55750-53-3 supplier respectively, at sub-saturating concentrations of malate, ( em iv /em ) among the analogs of L-malate tested as inhibitors from the NAD+-reliant ME catalyzed response, little (2- to 3-carbons) organic diacids carrying a COL5A1 2-hydroxyl/keto group behaved as the utmost potent inhibitors of Me personally activity (e.g., ...
A lot of human diseases are due to chronic tissue injury with fibrosis possibly resulting in organ failure. also be a helpful immunomodulator EMR2 in MDC1A. This understanding is vital for the look of future restorative interventions for muscular dystrophies that goal at targeting swelling, specifically that osteopontin inhibition continues to be recommended for Duchenne muscular dystrophy therapy. Swelling is a robust regulator of both physiological and pathological procedures in cells. Swelling and fibrosis result in loss of muscle mass function in a variety of types of muscular dystrophy. Congenital muscular dystrophy due to mutations in the laminin 2 string gene (MDC1A) is among the most devastating types of muscular dystrophy (both in human beings and mice)1. Clinical Adenosine IC50 medical indications include serious muscle mass wasting, progressive muscle mass weakness, joint contractures, respiratory system and feeding troubles and numerous problems. Most patients shed ambulation in ...
PC(16:1(9Z)/22:1(9Z)) is a phosphatidylchloline (PC). It is a glycerophospholipid in which a phosphorylcholine moiety occupies a glycerol substitution site. As is the case with diacylglycerols, phosphatidylcholines can have many different combinations of fatty acids of varying lengths and saturation attached to the C-1 and C-2 positions. PC(16:1(9Z)/22:1(9Z)), in particular, consists of one 9Z-hexadecenoyl chain to the C-1 atom, and one 9Z-docosenoyl to the C-2 atom. In E. coli, PCs can be found in the integral component of the cell outer membrane. They are hydrolyzed by Phospholipases to a 2-acylglycerophosphocholine and a carboxylate ...
List of all the English words with 25 letters containing letter A. acrocephalopolysyndactyly, acylglycerophosphocholine, acylglycerophosphoglucose, acylglycerophosphoserines, alpha-methylphenethylamine, amygdalohippocampectomies, antiacetylcholinesterases
MBOAT7 - MBOAT7 (Myc-DDK-tagged)-Human membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 4 available for purchase from OriGene - Your Gene Company.
LPCAT2 Full-Length MS Protein Standard (NP_060309), Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine, was produced in human 293 cells (HEK293) with fully chemically defined cell culture medium to obtain incorporation efficiency at Creative-Proteomics. This gene encodes a member of the lysophospholipid acyltransferase family. The encoded enzyme may function in two ways: to catalyze the biosynthesis of platelet-activating factor (1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine) from 1-O-alkyl-sn-glycero-3-phosphocholine, and to catalyze the synthesis of glycerophospholipid precursors from arachidonyl-CoA and lysophosphatidylcholine. The encoded protein may function in membrane biogenesis and production of platelet-activating factor in inflammatory cells. The enzyme may localize to the endoplasmic reticulum and the Golgi.
TY - JOUR. T1 - rs641738C,T near MBOAT7 is associated with liver fat, ALT, and fibrosis in NAFLD: a meta-analysis. T2 - a meta-analysis. AU - Teo, Kevin. AU - Abeysekera, Kushala W M. AU - Hickman, Matthew. AU - Mann, Jake P. AU - al., et. PY - 2020/8/21. Y1 - 2020/8/21. N2 - Background & AimsA common genetic variant near MBOAT7 (rs641738C,T) has been previouslyassociated with hepatic fat and advanced histology in non-alcoholic fatty liverdisease (NAFLD), however, these findings have not been consistently replicated in the literature. We aimed to establish whether rs641738C,T is a risk factor across the spectrum of NAFLD and characterize its role in the regulation of related metabolic phenotypes through meta-analysis.MethodsWe performed meta-analysis of studies with data on the association betweenrs641738C,T genotype and: liver fat, NAFLD histology, and serum ALT, lipids, or insulin. These included directly genotyped studies and populationlevel data from genome-wide association studies (GWAS). ...
Pain lands is the term that typically refer to the land cycles first printed in Ice Age and Apocalypse. However, the term can be applied to every land, which deals "pain" damage to you every time you tap it for colored mana. The lands providing allied colors were printed originally in Ice Age...
Use Bio-Rads PrimePCR assays, controls, templates for your target gene. Every primer pair is optimized, experimentally validated, and performance guaranteed.
Use Bio-Rads PrimePCR assays, controls, templates for your target gene. Every primer pair is optimized, experimentally validated, and performance guaranteed.
MBOAT4 antibody (membrane bound O-acyltransferase domain containing 4) for IHC-P, WB. Anti-MBOAT4 pAb (GTX53651) is tested in Human, Mouse samples. 100% Ab-Assurance.
Schematic pathways for unusual fatty acid (UFA) incorporation into triacylglycerols (TAG) after synthesis in phosphatidylcholine (PC). The sn numbers on a pathway indicate the possible positions of vernoloyl groups in TAG. LPA, lysophosphatidate; PA, phosphatidate; PDAT, phospholipid:diacylglycerol acyltransferase; CPT, cholinephosphotransferase; DGAT, acyl-CoA:diacylglycerol acyltransferase; DGTA, diacylglycerol transacylase; LPCAT, lysophosphatidylcholine acyltransferase; GPAT, glycerol-3-phosphate acyltransferase; LPAT, lysophosphatidate acyltransferase; PAP, phosphatidate phosphatase; PL, phospholipase; ACS, acyl-CoA synthetase.. In order to induce large changes in oil composition, lysophosphatidic acid acyltransferase (LPAT) has been considered an important target enzyme because of its selective discrimination ability. High-erucic acid rapeseed (HEAR; Brassica napus) and meadowfoam (Limnanthes) have 60% and 90% erucic acid in their triacylglycerols. In meadowfoam, erucic acid is present in ...
Euonymus alatus diacylglycerol acetyltransferase (EaDAcT) synthesizes the unusually structured 3-acetyl-1,2-diacylglycerols (acetyl-TAG) found in the seeds of a few plant species. A member of the membrane-bound O-acyltransferase (MBOAT) family, EaDAcT transfers the acetyl group from acetyl-CoA to sn-1,2-diacylglycerol (DAG) to produce acetyl-TAG. In vitro assays demonstrated that the enzyme is also able to utilize butyryl-CoA and hexanoyl-CoA as acyl donors, though with much less efficiency compared with acetyl-CoA. Acyl-CoAs longer than eight carbons were not used by EaDAcT. This extreme substrate specificity of EaDAcT distinguishes it from all other MBOATs which typically catalyze the transfer of much longer acyl groups. In vitro selectivity experiments revealed that EaDAcT preferentially acetylated DAG molecules containing more double bonds over those with less. However, the enzyme was also able to acetylate saturated DAG containing medium chain fatty acids, albeit with less efficiency. ...
Expression of MBOAT2 (FLJ14415, FLJ90298, OACT2) in nasopharynx tissue. Antibody staining with HPA014836 in immunohistochemistry.
The worlds first wiki where authorship really matters. Due credit and reputation for authors. Imagine a global collaborative knowledge base for original thoughts.
Bacterial capsular polysaccharides (CPS) are produced by a multi-protein membrane layer complicated, in which a particular type of tyrosine-autokinases named BY-kinases, control their move and polymerization. is certainly defective recommending that CpsD autophosphorylation interferes with these procedures therefore producing in cell constriction problems and cell elongation. We display that CpsD stocks structural homology with ParA-like … Read more Bacterial capsular polysaccharides (CPS) are produced by a multi-protein membrane layer. Read More ...
Expression of HHATL (C3orf3, GUP1, KIAA1173, MBOAT3, MSTP002, OACT3) in cancer tissue. The cancer tissue page shows antibody staining of the protein in 20 different cancers.
Buy our Tafazzin / TAZ peptide (276-287). Ab45823 is a blocking peptide for ab40004 and has been validated in BL. Abcam provides free protocols, tips and…
A combination of site-directed and random mutagenesis generated sequence variants of a plastidial lysophosphatidic acid acyltransferase. Alanine substitutions of residues present within two conserved motifs including the putative catalytic histidine resulted in a loss of acyltransferase activity assessed as complementation competance. Substitutions at five sites within the central core resulted in reduced or loss of activity. Truncation mutants reveal that sequences in the C-terminal moiety are essential for function.. ...
Tafazzin knockdown causes hypertrophy of neonatal cardiac myocytes (34), and mutation of the tafazzin gene causes dilated cardiomyopathy in Barth syndrome (64). Our work with neonatal cardiac fibroblasts (NVFs) showed that tafazzin knockdown increased ROS production, activated MAPKs including p42/44 and p38, stimulated transcriptional and translational factors, which in turn activated cell cycle regulators, and increased DNA and protein synthesis. On the other hand, tafazzin knockdown also decreased intracellular ATP, activated AMPK, and halted the energy-consuming process (i.e., cell proliferation), ultimately resulting in multinucleation, hypertrophy, and enhanced collagen secretion.. Tafazzin plays an important role in de novo cardiolipin synthesis and remodeling in the mitochondria. Tafazzin knockdown leads to reduced cardiolipin, which is consistent with previous studies involving yeast (28), Drosophila (72), and human skin fibroblasts (68). To be consistent with what is reported in mice ...
Agpat2 - Agpat2 (untagged ORF) - Rat 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) (Agpat2), (10 ug) available for purchase from OriGene - Your Gene Company.
Definition of Sterol O-Acyltransferase in the Financial Dictionary - by Free online English dictionary and encyclopedia. What is Sterol O-Acyltransferase? Meaning of Sterol O-Acyltransferase as a finance term. What does Sterol O-Acyltransferase mean in finance?
(R)-Lisofylline ((R)-Lisophylline) is a (R)-enantiomer of the metabolite of Pentoxifylline with anti-inflammatory properties. (R)-Lisofylline is a lysophosphatidic acid acyltransferase inhibitor with an IC50 of 0.6 µM and interrupts IL-12 signaling-mediated STAT4 activation. (R)-Lisofylline has the potential for type 1 diabetes, autoimmune disorders research. - Mechanism of Action & Protocol.
Definition of Phosphatidylcholine-sterol o-acyltransferase with photos and pictures, translations, sample usage, and additional links for more information.
RPH629Hu01, MGAT2; DGAT2L5; DC5; 2-Acylglycerol O-Acyltransferase 2; Diacylglycerol O-acyltransferase candidate 5; Diacylglycerol acyltransferase 2-like protein 5 | Products for research use only!
Imagine corporala - Dictionar termeni medicali - Concept individual al dispozitiei membrelor si a identificarii diferitelor parti ale organismului propriu
One of the most popular Cooking Light chicken recipes, these sweet and spicy grilled chicken thighs are flavored with chili powder, cumin, garlic and cider vinegar.
Pharmaceuticals in the aquatic environment is an emerging issue and the risks they pose are mostly unknown. They are used in large amounts throughout the world and can enter the environment, as the active metabolite or unmetabolised, through excretion by people and improper disposal. As these drugs are designed to have specific biological effects in a specific organism (as well as sometimes having other non-specific side effects), their potential to cause effects within the environment is great. Clofibric acid (the major metabolite of the lipid lowering drug, Clofibrate) is non-biodegradable, highly motile, very persistent and frequently detected at μg/I levels in the environment. I studied possible effects of clofibric acid in fish, using different experimental approaches and endpoints. The studies involve two different species, and for one of these species, fish at different stages of development. The chapters within this thesis have presented the first evidence (albeit preliminary) of ...
ID Q4WDI5_ASPFU Unreviewed; 555 AA. AC Q4WDI5; DT 05-JUL-2005, integrated into UniProtKB/TrEMBL. DT 17-APR-2007, sequence version 2. DT 11-DEC-2019, entry version 74. DE SubName: Full=MBOAT family protein, putative {ECO:0000313,EMBL:EAL85553.2}; GN ORFNames=AFUA_6G04860 {ECO:0000313,EMBL:EAL85553.2}; OS Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC OS A1100) (Aspergillus fumigatus). OC Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes; OC Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus. OX NCBI_TaxID=330879 {ECO:0000313,EMBL:EAL85553.2, ECO:0000313,Proteomes:UP000002530}; RN [1] {ECO:0000313,EMBL:EAL85553.2, ECO:0000313,Proteomes:UP000002530} RP NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. RC STRAIN=ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100 RC {ECO:0000313,Proteomes:UP000002530}; RX PubMed=16372009; DOI=10.1038/nature04332; RA Nierman W.C., Pain A., Anderson M.J., Wortman J.R., Kim H.S., Arroyo J., RA Berriman M., Abe K., Archer ...
ale Definition, ale Best Plays of ale in Scrabble® and Words With Friends, Length tables of words in ale, Word growth of ale, Sequences of ale
Porkslap Pale Ale is a American Pale Ale (APA) style beer brewed by Butternuts Beer & Ale in Garrattsville, NY. 3.2 average with 889 ratings, reviews and opinions.
Old Jock Ale is a Scotch Ale / Wee Heavy style beer brewed by Broughton Ales Ltd in Broughton, Biggar, GB6, United Kingdom. 3.91 average with 150 ratings, reviews and opinions.
1.) Ahoj Aleš! Ako sa máš? Mám se pracovně. Zaplacené složenky na stromech nerostou. 2.) Musím Tebe aj kapele pogratulovať k novému CD. Veľmi sa mi páči. Ako si s ním spokojný? Děkujeme. Já osobně […]. ...
Tafazzin is a protein that in humans is encoded by the TAZ gene. Tafazzin is highly expressed in cardiac and skeletal muscle. It is involved in the metabolism of cardiolipin. Tafazzin functions as a phospholipid-lysophospholipid transacylase. The mutation of the tafazzin gene is associated with a number of clinical disorders including Barth syndrome (BTHS) (type II 3-Methylglutaconic aciduria), dilated cardiomyopathy (DCM), hypertrophic DCM, endocardial fibroelastosis, and left ventricular noncompaction (LVNC). Tafazzin is responsible for remodeling of a phospholipid cardiolipin (CL), the signature lipid of the mitochondrial inner membrane. As a result, BTHS patients exhibit defects in CL metabolism, including aberrant CL fatty acyl composition, accumulation of monolysocardiolipin (MLCL) and reduced total CL levels. The protein was identified by Italian scientists Silvia Bione et al. in 1996. Owing to the complex procedure required for the identification of tafazzin, the protein was named after ...
General Information. There are several laboratory tests that can be undertaken to confirm the diagnosis of Barth syndrome. Finding a tafazzin gene (TAZ, also called G4.5) mutation that clearly disables protein synthesis or function is the most definitive test for Xq28-linked Barth syndrome. In addition, the finding of a severely depressed level of tetralinoleoyl-cardiolipin [Schlame et al (2002)], [Vreken et al (2000)] in platelets, cultured cells, or muscle tissue appears to be specific for Barth syndrome caused by mutations in the tafazzin gene. However, because completion of these tests can take more time than desirable when a child has critical cardiac disease, other laboratory tests, as discussed below, in the appropriate clinical setting can be all but diagnostic of Barth syndrome. Although not all clinicians follow the regulations, it is important to recognize that diagnostic information that is given to a patient or patients family must be provided by a laboratory that has met that ...
Quantitative and qualitative alterations of mitochondrial cardiolipin have been implicated in the pathogenesis of Barth syndrome, an X-linked cardioskeletal myopathy caused by a deficiency in tafazzin, an enzyme in the cardiolipin remodeling pathway. A tafazzin-deficient Drosophila model of Barth syndrome that is characterized by low cardiolipin (CL) concentration, abnormal cardiolipin fatty acyl composition, abnormal mitochondria, and poor motor function has been generated earlier. This study shows that tafazzin deficiency in Drosophila disrupts the final stage of spermatogenesis, spermatid individualization, and causes male sterility. This phenotype can be genetically suppressed by inactivation of the gene encoding a calcium-independent phospholipase A2, iPLA2-VIA, which also prevents cardiolipin depletion/monolysocardiolipin accumulation, although in wild-type flies inactivation of the iPLA2-VIA does not affect the molecular composition of cardiolipin. Furthermore, it was shown that treatment ...
GT:ID BAD56558.1 GT:GENE BAD56558.1 GT:PRODUCT putative 1-acylglycerol-3-phosphate O-acyltransferase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1863574..1864296) GB:FROM 1863574 GB:TO 1864296 GB:DIRECTION - GB:PRODUCT putative 1-acylglycerol-3-phosphate O-acyltransferase GB:PROTEIN_ID BAD56558.1 LENGTH 240 SQ:AASEQ MFYWLLKFVLVGPFIRVYNRPTVEGVENIPSDGPAILAGNHLSIADWLFAPLLSPRRINYLAKAEYFTTPGIKGRLQKFFFSGTGQYPIDRSGADAAEDALNAARKLLDQGKLVGLYPEGTRSPDGRLYKGKTGMARLALETGVPVIPVAVIGTDKVAPPGPFRWRRHKVTVKFGAPIDFSRYEGMGGNRFVERAVTDEVMYELMRLSGQEYVDVYAHSLKGVPSGSKPEAPRIPDTAAS GT:EXON 1,1-240:0, BL:SWS:NREP 1 BL:SWS:REP 9-,161,LPAT1_ARATH,2e-17,35.7,143/356, SEG 94-,104,adaaedalnaa, RP:PFM:NREP 1 RP:PFM:REP 23-,152,PF01553,5e-18,42.4,125/132,Acyltransferase, HM:PFM:NREP 1 HM:PFM:REP 21-,151,PF01553,1.2e-31,45.2,126/135,Acyltransferase, GO:PFM:NREP 2 GO:PFM GO:0008152,GO:metabolic process,PF01553,IPR002123, GO:PFM GO:0008415,GO:acyltransferase activity,PF01553,IPR002123, ...
Title: Role of Lysophosphatidylcholine (LPC) in Atherosclerosis. VOLUME: 14 ISSUE: 30. Author(s):Takayuki Matsumoto, Tsuneo Kobayashi and Katsuo Kamata. Affiliation:Department of Physiology and Morphology,Institute of Medicinal Chemistry, Hoshi University, Shinagawa-ku, Tokyo 142-8501, Japan.. Keywords:Atherosclerosis, inflammatory, endothelial dysfunction, LPC, vascular tone, signal transduction. Abstract: Lysophosphatidylcholine (LPC) is a bioactive proinflammatory lipid generated by pathological activities. LPC is also a major phospholipid component of oxidized low-density lipoprotein (Ox-LDL) and is implicated as a critical factor in the atherogenic activity of Ox-LDL. LPC is believed to play an important role in atherosclerosis and inflammatory diseases by altering various functions in a number of cell-types, including endothelial cells, smooth muscle cells, monocytes, macrophages, and T-cells. LPC activates several second messengers -- including protein kinase C, ...
Acyl-CoA:lysocardiolipin acyltransferase. Possesses both lysophosphatidylinositol acyltransferase (LPIAT) and lysophosphatidylglycerol acyltransferase (LPGAT) activities. Recognizes both monolysocardiolipin and dilysocardiolipin as substrates with a preference for linoleoyl-CoA and oleoyl-CoA as acyl donors. Acts as a remodeling enzyme for cardiolipin, a major membrane polyglycerophospholipid. Converts lysophosphatidic acid (LPA) into phosphatidic acid (PA) with a relatively low activity. Required for establishment of the hematopoietic and endothelial lineages ...
Thabet K, Asimakopoulos A, Shojaei M, Romero-Gomez M, Mangia A, Irving WL, Berg T, Dore GJ, Gronbaek H, Sheridan D, Abate ML, Bugianesi E, Weltman M, Mollison L, Cheng W, Riordan S, Fischer J, Spengler U, Nattermann J, Wahid A, Rojas A, White R, Douglas MW, McLeod D, Powell E, Liddle C, Van Der Poorten D, George J, Eslam M, Gallego-Duran R, Applegate T, Bassendine M, Rosso C, Mezzabotta L, Leung R, Malik B, Matthews G, Grebely J, Fragomeli V, Jonsson JR, Santaro R. MBOAT7 rs641738 increases risk of liver inflammation and transition to fibrosis in chronic hepatitis C. Nature Communications 2016, 7, 12757 ...
FUNCTION: This gene encodes a member of the G-protein coupled receptor 1 family. The encoded protein is a receptor for the lysophospholipid sphingosine 1-phosphate. The gene product functions in endothelial cells and is involved in vascular and heart development. The gene product mediates HDL and HDL-associated lysophospholipid-induced vasorelaxation, and it coordinates with other lysophospholipid receptors in the process of angiogenesis. [provided by RefSeq, Jan 2010 ...
When Jackie Kennedy (then known as Jacqueline Bouvier, later known as Jackie O.) first met John F. Kennedy Jr. and his big, rambunctious family, she was coming to the table with a world of reservations, having broken off a previous engagement to John Husted when the constraints of that expected family life felt too overwhelming. […]
Universal BiGG reaction 2AGPA120tipp. 2-Acyl-sn-glycero-3-phosphatidate (n-C12:0) transporter via facilitated diffusion (periplasm).
Merrit Kennedy is a reporter for The Two-Way, NPR's breaking news blog. She covers a broad range of issues, from the latest developments out of the
Afectiuni ale intestinului - : Nikvorm 60ml HISHIMO PHARMACEUTICALS (BIO VITALITY), Tarate grau 250g PIRIFAN, Baton tranzit mix- prune cu tarate de ovaz si portocale omeg-3 40g PIRIFAN,
ЛОНДОН - Мы знаем, как искоренить полиомиелит. Действующая с 1980-х годов международная программа вакцинации под руководством Всемирной организации здравоохранения привела к почти полному исчезновению вируса полиомиелита. Болезнь, которая ежегодно убивала или парализовала полмиллиона людей на земле, поражает сегодня только несколько сот человек во всем мире.. Препятствие, стоящее сегодня на пути уничтожения вируса, не связано с медицинскими или техническими ограничениями, а вызвано политическим сопротивлением вакцинации. Действительно, ...
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.Ok ...
2-acylglycerophosphocholine O-acyltransferase, an enzyme purified in liver microsomes, catalyzes specifically the acylation of ... In contrast to these finding from rat liver microsomes, mammalian acyl transferase from dog lungs was found to exhibit no ... M. F. Frosolono; Slivka, S; Charms, BL (1971-01-01). "Acyl transferase activities in dog lung microsomes". Journal of Lipid ... Arthur, G. (Jul 1989). "Acylation of 2-acyl-glycerophosphocholine in guinea-pig heart microsomal fractions". Biochem J. 261 (2 ...
... diacylglycerol o-acyltransferase MeSH D08.811.913.050.425 - glycerol-3-phosphate O-acyltransferase MeSH D08.811.913.050.600 - ... phosphatidylcholine-sterol O-acyltransferase MeSH D08.811.913.050.646 - retinol O-fatty-acyltransferase MeSH D08.811.913.050. ... acetyl-CoA C-acyltransferase MeSH D08.811.913.050.134 - acetyltransferases MeSH D08.811.913.050.134.029 - acyl-carrier protein ... sterol O-acyltransferase MeSH D08.811.913.200.324 - acetolactate synthase MeSH D08.811.913.200.650 - transaldolase MeSH D08.811 ...
1] , et al. v. E.I. Du Pont De Nemours and Company Settlement ans Lubeck Public Service District at the Wayback Machine ( ... 40 (1): 4. Bibcode:2006EnST...40....4R. doi:10.1021/es062599u. Begley TH, White K, Honigfort P, Twaroski ML, Neches R, Walker ... 106 (1): 29-36. doi:10.1093/toxsci/kfn147. PMC 2563145. PMID 18648086. Bartell SM, Calafat AM, Lyu C, Kato K, Ryan PB, ... 40 (1): 32-44. Bibcode:2006EnST...40...32P. doi:10.1021/es0512475. PMID 16433330. Goss K. U. (July 2008). "The pKa values of ...
2-acylglycerophosphocholine O-acyltransferase EC 1-alkylglycerophosphocholine O-acyltransferase EC agmatine ... sphingosine N-acyltransferase EC plasmalogen synthase EC sterol O-acyltransferase EC cortisol O- ... retinol O-fatty-acyltransferase EC triacylglycerol-sterol O-acyltransferase EC heparan-a-glucosaminide N- ... tropine acyltransferase EC pseudotropine acyltransferase EC acetyl-S-ACP:malonate ACP transferase EC 2.3. ...
... may refer to: 1-acylglycerophosphocholine O-acyltransferase, an enzyme Phosphatidylcholine-sterol ... O-acyltransferase, an enzyme This set index page lists enzyme articles associated with the same name. If an internal link led ...
... lysophosphatide acyltransferase, and lysophosphatidylcholine acyltransferase. This enzyme participates in glycerophospholipid ... This enzyme belongs to the family of transferases, specifically those acyltransferases transferring groups other than aminoacyl ... Other names in common use include lysolecithin acyltransferase, 1-acyl-sn-glycero-3-phosphocholine acyltransferase, acyl ... In enzymology, a 1-acylglycerophosphocholine O-acyltransferase (EC is an enzyme that catalyzes the chemical reaction ...
This enzyme belongs to the family of transferases, specifically those acyltransferases transferring groups other than aminoacyl ... In enzymology, a 1-alkenylglycerophosphocholine O-acyltransferase (EC is an enzyme that catalyzes the chemical ... Arthur G, Choy PC (1986). "Acylation of 1-alkenyl-glycerophosphocholine and 1-acyl-glycerophosphocholine in guinea pig heart". ... The systematic name of this enzyme class is acyl-CoA:1-alkenylglycerophosphocholine O-acyltransferase. This enzyme participates ...
... lecithin-cholesterol acyltransferase), lecithin:cholesterol acyltransferase, and lysolecithin acyltransferase. This enzyme ... Other names in common use include lecithin---cholesterol acyltransferase, phospholipid---cholesterol acyltransferase, LCAT ( ... In enzymology, a phosphatidylcholine---sterol O-acyltransferase (EC is an enzyme that catalyzes the chemical reaction ... This enzyme belongs to the family of transferases, specifically those acyltransferases transferring groups other than aminoacyl ...
... lysophosphatide acyltransferase, and lysophosphatidylcholine acyltransferase. This enzyme participates in glycerophospholipid ... This enzyme belongs to the family of transferases, specifically those acyltransferases transferring groups other than aminoacyl ... Other names in common use include lysolecithin acyltransferase, 1-acyl-sn-glycero-3-phosphocholine acyltransferase, acyl ... In enzymology, a 1-acylglycerophosphocholine O-acyltransferase (EC is an enzyme that catalyzes the chemical reaction ...
Scientific Experts about Experts and Doctors on 1 acylglycerophosphocholine o acyltransferase in Tokyo, Japan ... Member of the membrane-bound O-acyltransferase (MBOAT) family encodes a lysophospholipid acyltransferase with broad substrate ... Shindou H. [Lysophospholipid acyltransferase and platelet-activating factor (PAF) biosynthetic enzyme]. Seikagaku. 2008;80:110- ... Hishikawa D, Shindou H, Kobayashi S, Nakanishi H, Taguchi R, Shimizu T. Discovery of a lysophospholipid acyltransferase family ...
Author manuscripts deposited to comply with open access mandates are made available in accordance with publisher policies. Please cite only the published version using the details provided on the item record or document. In the absence of an open licence (e.g. Creative Commons), permissions for further reuse of content should be sought from the publisher or author ...
Lysophospholipid acyltransferases (LPLATs) catalyze the reacylation step of the phospholipid remodeling pathway also known as ... Acyltransferase which mediates the conversion of lysophosphatidylcholine (1-acyl-sn-glycero-3-phosphocholine or LPC) into ... 1-acyl-2-hydroxy-sn-glycero-3-phospho-L-serine or LPS) into phosphatidylserine (1,2-diacyl-sn-glycero-3-phospho-L-serine or PS ... 1-acyl-sn-glycero-3-phosphoethanolamine or LPE) into phosphatidylethanolamine (1,2-diacyl-sn-glycero-3-phosphoethanolamine or ...
Fat-1 Transgene is Associated with Improved Reproductive Outcomes.. High intake of omega-3 polyunsaturated fatty acids (PUFAs) ... 1-acylglycerophosphocholine O-acyltransferase. An enzyme localized predominantly within the plasma membrane of lymphocytes. It ... to lysophosphatides with the formation of 1,2-diacylglycero-3-phosphocholine and CoA. EC ...
Displays acyl-CoA-dependent lysophospholipid acyltransferase activity with a subset of lysophospholipids as substrates. ... 1-LPE over 16:0-LPE as acceptor and palmitoyl-CoA (16:0-CoA) as acyl donor. Activity is calcium-independent. ... Lysophospholipid acyltransferase LPEAT2Add BLAST. 539. Proteomic databases. PaxDb, a database of protein abundance averages ... lysophosphatidylethanolamine acyltransferase activity Source: TAIR ,p>Inferred from Direct Assay,/p> ,p>Used to indicate a ...
This enzyme belongs to the family of transferases, specifically those acyltransferases transferring groups other than aminoacyl ... In enzymology, a 1-alkenylglycerophosphocholine O-acyltransferase (EC is an enzyme that catalyzes the chemical ... Arthur G, Choy PC (1986). "Acylation of 1-alkenyl-glycerophosphocholine and 1-acyl-glycerophosphocholine in guinea pig heart". ... The systematic name of this enzyme class is acyl-CoA:1-alkenylglycerophosphocholine O-acyltransferase. This enzyme participates ...
Next-day shipping cDNA ORF clones derived from Lpcat1 lysophosphatidylcholine acyltransferase 1 available at GenScript, ... Mus musculus lysophosphatidylcholine acyltransferase 1 (Lpcat1), mRNA.. pcDNA3.1+/C-(K)DYK or customized vector. TBD. $307.30. ... Mus musculus lysophosphatidylcholine acyltransferase 1 (Lpcat1), transcript variant 2, mRNA.. Target ORF information:. Epitope ... Mus musculus lysophosphatidylcholine acyltransferase 1 (Lpcat1), transcript variant 3, mRNA.. Target ORF information:. Epitope ...
Transferase(Phosphotransferase) domain 1. The name of this superfamily has been modified since the most recent official CATH+ ... 1-acylglycerophosphocholine O-acyltransferase. [EC:] Acyl-CoA + 1-acyl-sn-glycero-3-phosphocholine = CoA + 1,2-diacyl ... 1) (6R)-6-beta-hydroxy-1,4,5,6-tetrahydronicotinamide-adenine dinucleotide = (6S)-6-beta-hydroxy-1,4,5,6-tetrahydronicotinamide ... Inactive with cyclohex-2-en-1-one and 12-oxophytodienoic acid. * Involved in the detoxification of alpha,beta-unsaturated ...
Lyso-PS acyltransferase, MBOAT5OACT5, membrane bound O-acyltransferase domain containing 5, Membrane-bound O-acyltransferase ... Lyso-PC acyltransferase, Lyso-PC acyltransferase 3, Lysophosphatidylcholine acyltransferase, lysophosphatidylcholine ... domain-containing protein 5, nessy, O-acyltransferase (membrane bound) domain containing 5, O-acyltransferase domain-containing ... 1-acylglycerophosphocholine O-acyltransferase, 1-acylglycerophosphoserine O-acyltransferase, C3F, EC 2.3.1.-, EC, EC ...
Lecithin-cholesterol acyltransferase (Thr123----Ile) and lecithin-cholesterol acyltransferase (Thr347----Met). J Clin Invest. ... Skretting G, Prydz H: An amino acid exchange in exon I of the human lecithin: cholesterol acyltransferase (LCAT) gene is ... Wiebusch H, Cullen P, Owen JS, Collins D, Sharp PS, Funke H, Assmann G: Deficiency of lecithin:cholesterol acyltransferase due ... McLean J, Wion K, Drayna D, Fielding C, Lawn R: Human lecithin-cholesterol acyltransferase gene: complete gene sequence and ...
Phosphatidylcholine-sterol acyltransferase. General function:. Involved in phosphatidylcholine-sterol O-acyltransferase ... 2-acylglycerol O-acyltransferase 2. General function:. Involved in transferase activity, transferring acyl groups other than ... Lecithin retinol acyltransferase. General function:. Involved in phosphatidylcholine-retinol O-acyltransfera. Specific function ... Lysophospholipid acyltransferase 5. General function:. Involved in 1-acylglycerophosphocholine O-acyltransfera. Specific ...
... lysophosphatidylcholine acyltransferase [Lpcat] 1-4), basolateral bile acid excretion (ATP-binding cassette subfamily C member ... lysophosphatidylcholine acyltransferase [Lpcat] 1-4), basolateral bile acid excretion (ATP-binding cassette subfamily C member ... lysophosphatidylcholine acyltransferase [Lpcat] 1-4), basolateral bile acid excretion (ATP-binding cassette subfamily C member ... lysophosphatidylcholine acyltransferase [Lpcat] 1-4), basolateral bile acid excretion (ATP-binding cassette subfamily C member ...
Membrane Bound O-Acyltransferase Domain Containing 2, including: function, proteins, disorders, pathways, orthologs, and ... Membrane-Bound O-Acyltransferase Domain-Containing Protein 2 3 4 * 1-Acylglycerophosphoethanolamine MBOAT2 O-Acyltransferase 3 ... Lysophospholipid acyltransferases and arachidonate recycling in human neutrophils. (PMID: 18772128) Gijón MA … Voelker DR (The ... Acyltransferase which catalyzes the transfert of an acyl group from an acyl-CoA to a lysophospholipid leading to the production ...
The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the ... Possesses both acyltransferase and acetyltransferase activities. Activity is calcium-independent. Mediates the conversion of 1- ... Steroid receptor coactivators 1 and 2 mediate fetal-to-maternal signaling that initiates parturition.. J Clin Invest 125:2808- ... Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell ...
What is Phosphatidylcholine-sterol o-acyltransferase? Meaning of Phosphatidylcholine-sterol o-acyltransferase medical term. ... Looking for online definition of Phosphatidylcholine-sterol o-acyltransferase in the Medical Dictionary? Phosphatidylcholine- ... lecithin-cholesterol acyltransferase. (redirected from Phosphatidylcholine-sterol o-acyltransferase) lec·i·thin-cho·les·ter·ol ... Synonym(s): lecithin acyltransferase. lecithin-cholesterol acyltransferase. /lec·i·thin-cho·les·ter·ol ac·yl·trans·fer·ase/ ( ...
lysophosphatidylcholine acyltransferase 1 Gene Symbol:. lpcat1 Nomenclature History {{control.fieldName}} Edit ID:. {{control. ... Orthologous to human LPCAT1 (lysophosphatidylcholine acyltransferase 1). Genome Resources: Alliance (1), Gene:555969 (1), ... Predicted to have 1-acylglycerophosphocholine O-acyltransferase activity. Predicted to be involved in phospholipid biosynthetic ...
GLYAT ACGNAT CAT GAT Glycine N acyltransferase Acyl CoA glycine N acyltransferase Aralkyl acyl CoA N acyltransferase Aralkyl ... Gene targetGLYAT ACGNAT CAT GAT Glycine N-acyltransferase Acyl-CoA:glycine N-acyltransferase Aralkyl acyl-CoA N-acyltransferase ... GLYAT ACGNAT CAT GAT Glycine N acyltransferase Acyl CoA glycine N acyltransferase Aralkyl acyl CoA N acyltransferase Aralkyl ... GLYAT ACGNAT CAT GAT Glycine N acyltransferase Acyl CoA glycine N acyltransferase Aralkyl acyl CoA N acyltransferase Aralkyl ...
Lysolecithin acyltransferase Current Synonym true false Associated Value Sets No associated value sets.. ... 1-acylglycerophosphocholine acyltransferase Current Synonym true false 58973014 1-Acylglycerophosphocholine acyltransferase ... 1-acylglycerophosphocholine acyltransferase (substance). Code System Preferred Concept Name. 1-acylglycerophosphocholine ...
PCAT1 acyltransferase (LPCAT; EC catalyzes the conversion of LPC to hosphatidylcholine (PC) in the remodeling pathway ... Possesses both acyltransferase and acetyltransferase activities (PubMed:16864775, PubMed:21498505). Activity is calcium- ... LPC acyltransferase 1, LPCAT-1, LysoPC acyltransferase 1, 1-acylglycerophosphocholine O-acyltransferase, 1- ... Acyltransferase-like 2, Phosphonoformate immuno-associated protein 3, LPCAT1, AYTL2, PFAAP3. ...
Identification and characterization of a lysophosphatidylcholine acyltransferase in alveolar type II cells. Proc Natl Acad Sci ... Table 1 Biological significance of selected validated orphans. The extent and significance of published research associated ... Equation 1: sample size estimation. SE is the standard error associated with the survey, and is derived by dividing the ... 1.. Roberts RJ: Identifying protein function-a call for community action. PLoS Biol. 2004, 2 (3): E42-10.1371/journal.pbio. ...
Protein Name: Lysophosphatidylcholine acyltransferase 2 Alias: 1-acylglycerophosphocholine O-acyltransferase, 1- ... Protein Name: Lysophosphatidylcholine acyltransferase 2 Alias: 1-acylglycerophosphocholine O-acyltransferase, 1- ...
2-Acylglycerophosphocholine O-Acyltransferase Enzyme, Catalysis, Chemical reaction, Enzyme substrate (biology), Acyl-CoA, ...
Fingerprint Dive into the research topics of Changes in microsomal lysophospholipid acyltransferase activity are correlated ... Changes in microsomal lysophospholipid acyltransferase activity are correlated with rat parotid gland enlargement induced by ...
Acyltransferase, Lysolecithin Acyltransferase, Lysophosphatidylcholine Acyltransferase, Lysophosphatidylcholine-Palmitoyl CoA ... Acyltransferase, Lysophospholipid CoA Acyltransferase, Lysophosphatidylcholine-Palmitoyl Lysolecithin Acyltransferase ... Lysophosphatidylcholine-Palmitoyl CoA Acyltransferase Lysophospholipid Acyltransferase O-Acyltransferase, 1- ... Lysophosphatidylcholine-Palmitoyl CoA Acyltransferase. Lysophospholipid Acyltransferase. O-Acyltransferase, 1- ...
We also detail the pattern of expression and co-expression of two isoforms of lysophosphatidylcholine acyltransferase (LPCAT), ... Immunohistochemistry shows that both TLR4 and TLR7 preferentially co-localize with transient receptor potential vallinoid 1 ( ...
Zhang, S., Shen, Y., Wang, L., Chen, J. & Lu, Y., Apr 1 2019, In: Applied Energy. 239, p. 876-897 22 p.. Research output: ... Kantola, I. B., Masters, M. D., Beerling, D. J., Long, S. P. & DeLucia, E. H., Apr 1 2017, In: Biology Letters. 13, 4, 0714.. ... Marina, A., Apr 1 2010, In: Speculum. 85, 2, p. 435-436 2 p.. Research output: Contribution to journal › Review article › peer- ... Carns, P. M., Jan 1 2014, In: Sculpture Journal. 23, 1, p. 51-63 13 p.. Research output: Contribution to journal › Review ...
... mediated by acyltransferases. Interferon-gamma (IFN-gamma), which activates and primes these cells for enhanced inflammatory ... but not lysophosphatidic acid acyltransferase (LPAAT) activity. When used to prime the human monocytic cell line MonoMac 6, the ... 1. School of Biosciences, Cardiff University, UK.. Abstract. Mononuclear phagocytes play a pivotal role in the progression of ... Schmid B1, Finnen MJ, Harwood JL, Jackson SK.. Author information. ...
Correction: Novel lysophospholipid acyltransferase plat1 of aurantiochytrium limacinum f26-b responsible for generation of ... Kume, A., 1 1 2014, In: Japanese Journal of Ecology. 64, 3, p. 201-204 4 p.. 研究成果: Contribution to journal › Comment/debate › 査 ... Matsui, T., 1 17 2018, In: Journal of Agricultural and Food Chemistry. 66, 2, p. 393-394 2 p.. 研究成果: Contribution to journal › ... Tatsumi, D., 2017, In: Seni Gakkaishi. 73, 5, p. 206 1 p.. 研究成果: Contribution to journal › Comment/debate › 査読 ...
2-acylglycerophosphocholine O-acyltransferase 1-alkylglycerophosphocholine O-acyltransferase Agmatine N(4)- ... sterol O-acyltransferase Chalcone synthase Long-chain-alcohol O-fatty-acyltransferase Retinol O- ... Tropine acyltransferase Pseudotropine acyltransferase Acetyl-S-ACP:malonate ACP transferase Omega ... Sphingosine N-acyltransferase Plasmalogen synthase Sterol O-acyltransferase Cortisol O- ...
  • Other names in common use include lysolecithin acyltransferase, 1-acyl-sn-glycero-3-phosphocholine acyltransferase, acyl coenzyme A-monoacylphosphatidylcholine acyltransferase, acyl-CoA:1-acyl-glycero-3-phosphocholine transacylase, lysophosphatide acyltransferase, and lysophosphatidylcholine acyltransferase. (
  • Cloning and characterization of mouse lung-type acyl-CoA:lysophosphatidylcholine acyltransferase 1 (LPCAT1). (
  • Morimoto R, Shindou H, Oda Y, Shimizu T. Phosphorylation of lysophosphatidylcholine acyltransferase 2 at Ser34 enhances platelet-activating factor production in endotoxin-stimulated macrophages. (
  • Acyltransferase which mediates the conversion of lysophosphatidylcholine (1-acyl-sn-glycero-3-phosphocholine or LPC) into phosphatidylcholine (1,2-diacyl-sn-glycero-3-phosphocholine or PC) (LPCAT activity). (
  • Lysophosphatidylcholine acyltransferase 1 protects against cytotoxicity induced by polyunsaturated fatty acids. (
  • Title: Lysophosphatidylcholine Acyltransferase 1 (LPCAT1) Specifically Interacts with Phospholipid Transfer Protein StarD10 to Facilitate Surfactant Phospholipid Trafficking in Alveolar Type II Cells. (
  • Title: AAV-mediated lysophosphatidylcholine acyltransferase 1 (Lpcat1) gene replacement therapy rescues retinal degeneration in rd11 mice. (
  • In agreement with these metabolite changes, hepatic mRNAs encoding enzymes and proteins involved in LPC degradation (lysophosphatidylcholine acyltransferase [Lpcat] 1-4), basolateral bile acid excretion (ATP-binding cassette subfamily C member [Abcc] 1/4/5 and organic solute transporter β), and 12-HETE synthesis (arachidonate 12-lipoxygenase) were significantly up-regulated. (
  • Catalyzes preferentially the acylation of lysophosphatidylethanolamine (1-acyl-sn-glycero-3-phosphoethanolamine or LPE) and lysophosphatidic acid (LPA) and to a lesser extend lysophosphatidylcholine (LPC) and lysophosphatidylserine (LPS) (PubMed:18772128). (
  • Orthologous to human LPCAT1 (lysophosphatidylcholine acyltransferase 1). (
  • We also detail the pattern of expression and co-expression of two isoforms of lysophosphatidylcholine acyltransferase (LPCAT), a phospholipid remodeling enzyme previously shown to be involved in the lipopolysaccharide-dependent TLR4 response in monocytes, within sensory ganglia. (
  • Loss of lysophosphatidylcholine acyltransferase 1 leads to photoreceptor degeneration in rd11 mice. (
  • Lysophosphatidylcholine acyltransferase (LPCAT) is a critical phospholipid biosynthesis enzyme, which promotes the conversion of lysophosphatidylcholine into phosphatidylcholine in the remodeling pathway of PC biosynthesis. (
  • Two LPCAT inhibitors SK&F 98625 (diethyl 7-(3,4,5-triphenyl-2-oxo2,3-dihydro-imidazole-1-yl)heptane phosphonate) and YM 50201 (3-hydroxyethyl 5,3'-thiophenyl pyridine) strongly inhibited (up to 90%) TNF-alpha and IL-6 production in response to LPS in both unprimed MonoMac-6 cells and in cells primed with IFN-gamma. (
  • In enzymology, a 1-acylglycerophosphocholine O-acyltransferase (EC is an enzyme that catalyzes the chemical reaction acyl-CoA + 1-acyl-sn-glycero-3-phosphocholine ⇌ {\displaystyle \rightleftharpoons } CoA + 1,2-diacyl-sn-glycero-3-phosphocholine Thus, the two substrates of this enzyme are acyl-CoA and 1-acyl-sn-glycero-3-phosphocholine, whereas its two products are CoA and 1,2-diacyl-sn-glycero-3-phosphocholine. (
  • The main objective of this study was to investigate the effect of excess cobalt (Co) on gene expression of stearoyl-CoA desaturase (SCD), fatty acid synthase (FASN), diacylglycerol acyltransferase 1 (DGAT1) and diacylglycerol acyltransferase 2 (DGAT2) of lactating dairy cows in relation to milk fatty acid profile. (
  • Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family. (
  • 1-hexadec-9-enoyl-sn-glycerol 3-phosphate belongs to the class of Lysophosphatidic Acids. (
  • Acyl-CoA + sn-glycerol 3-phosphate = CoA + 1-acyl-sn-glycerol 3-phosphate. (
  • This enzyme belongs to the family of transferases, specifically those acyltransferases transferring groups other than aminoacyl groups. (
  • Displays acyl-CoA-dependent lysophospholipid acyltransferase activity with a subset of lysophospholipids as substrates. (
  • Lysophospholipid acyltransferases (LPLATs) catalyze the reacylation step of the phospholipid remodeling pathway also known as the Lands cycle. (
  • Acyltransferase which catalyzes the transfert of an acyl group from an acyl-CoA to a lysophospholipid leading to the production of a phospholipid and participates in the reacylation step of the phospholipid remodeling pathway also known as the Lands cycle (PubMed:18772128). (
  • Our previous studies have shown monocyte and macrophage activation correlate with changes in membrane phospholipid composition, mediated by acyltransferases. (
  • While most phospholipids have a saturated fatty acid on C-1 and an unsaturated fatty acid on C-2 of the glycerol backbone, the fatty acid distribution at the C-1 and C-2 positions of glycerol within phospholipids is continually in flux, owing to phospholipid degradation and the continuous phospholipid remodeling that occurs while these molecules are in membranes. (
  • MBOAT2 (Membrane Bound O-Acyltransferase Domain Containing 2) is a Protein Coding gene. (
  • Stix R, Lee CJ, Faraldo-Gómez JD, Banerjee A. Structure and Mechanism of DHHC Protein Acyltransferases. (
  • In animal tissues, the alkyl and alkenyl moieties in both non-polar and phospholipids tend to be rather simple in composition with 16:0, 18:0 and 18:1 (double bond in position 9) predominating. (
  • To a lesser extent, also catalyzes the acylation of lysophosphatidylethanolamine (1-acyl-sn-glycero-3-phosphoethanolamine or LPE) into phosphatidylethanolamine (1,2-diacyl-sn-glycero-3-phosphoethanolamine or PE) (LPEAT activity), and the conversion of lysophosphatidylserine (1-acyl-2-hydroxy-sn-glycero-3-phospho-L-serine or LPS) into phosphatidylserine (1,2-diacyl-sn-glycero-3-phospho-L-serine or PS) (LPSAT activity). (
  • PCs can also synthesized by the addition of choline to CDP-activated 1,2-diacylglycerol. (
  • Hishikawa D, Shindou H, Kobayashi S, Nakanishi H, Taguchi R, Shimizu T. Discovery of a lysophospholipid acyltransferase family essential for membrane asymmetry and diversity. (
  • In this review, we summarize recent studies on cloning and characterization of lysophospholipid acyltransferases that contribute to membrane asymmetry and diversity. (
  • Member of the membrane-bound O-acyltransferase (MBOAT) family encodes a lysophospholipid acyltransferase with broad substrate specificity. (
  • Treating Corona and respiratory viral effects through repair mitochondrial membrane by acylglycerophosphocholine O-acyltransferase, and by ATP drug "Remdesivir", and by -Methyl-guanosine-5'-(α-fluoro)- monophosphate as antiviral molecules in the presence of CoA phospho_ transferase and in presence of thrombin inhibitor 'or retinol active molecules. (
  • acylglycerophosphocholine O-acyltransferase is necessary for mitochondrial membrane repairs. (
  • Phosphatidylcholine + H(2)O = 2-acylglycerophosphocholine + a carboxylate. (
  • They are hydrolyzed by Phospholipases to a 2-acylglycerophosphocholine and a carboxylate. (
  • Possesses both acyltransferase and acetyltransferase activities. (
  • Acyltransferases and transacylases that determine the fatty acid composition of glycerolipids and the metabolism of bioactive lipid mediators in mammalian cells and model organisms. (
  • As is the case with diacylglycerols, glycerophosphocholines can have many different combinations of fatty acids of varying lengths and saturation attached at the C-1 and C-2 positions. (
  • Displays a clear preference for saturated fatty acyl-CoAs, and 1-myristoyl or 1-palmitoyl LPC as acyl donors and acceptors, respectively. (
  • It catalyzes the transfer of long-chain fatty acids, preferentially unsaturated fatty acids, to lysophosphatides with the formation of 1,2-diacylglycero-3-phosphocholine and CoA. (
  • In glycerophospholipids, two fatty acids are ester-linked to glycerol at C-1 and C-2, and a highly polar or charged (and therefore hydrophilic) head group is attached to C-3 through a phosphodiester bond. (
  • In general, glycerophospholipids contain a saturated fatty acid at C-1 and an unsaturated fatty acid at C-2, and, in general terms, the fatty acyl groups are generally 16 or 18 carbons long. (
  • As is the case with diacylglycerols, phosphatidylcholines can have many different combinations of fatty acids of varying lengths and saturation attached to the C-1 and C-2 positions. (
  • These results indicate that human MBOAT5 is a lysophospholipid acyltransferase acting preferentially on LPC, LPS and LPE. (
  • Immunohistochemistry shows that both TLR4 and TLR7 preferentially co-localize with transient receptor potential vallinoid 1 (TRPV1) and purinergic receptor P2X ligand-gated ion channel 3 (P2X3), markers of nociceptor populations, within both TG and DRG. (
  • Mediates the conversion of 1-acyl-sn-glycero-3-phosphocholine (LPC) into phosphatidylcholine (PC). (
  • Ether analogues of triacylglycerols, i.e. 1-alkyldiacyl-sn-glycerols, are present at trace levels only if at all in most animal tissues, but they can be major components of some marine lipids. (
  • 0.05) but not lysophosphatidic acid acyltransferase (LPAAT) activity. (
  • The ratio of isoform 2/isoform 1 mRNA is increased about 15-fold in the nonsense mRNA reducing factor mutant upf3-1. (
  • The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphocholine. (
  • Gene Ontology (GO) annotations related to this gene include 1-acylglycerol-3-phosphate O-acyltransferase activity . (
  • Predicted to have 1-acylglycerophosphocholine O-acyltransferase activity. (
  • In contrast, the expression of solute carrier family 10 member 1 (Slc10a1) and solute carrier organic anion transporter family member (Slco) 1a1 and 1b2, responsible for transporting bile acids into hepatocytes, were markedly suppressed. (
  • The increase in the expression of tyrosine hydroxylase or corresponding hydroxylase will increase NGF production from TGF?β1, which will increase inflammation and precipitation in vessels lead to failing in producing TXA2 subunits which through feedback will produce VEGF-A subunits for reproductions endothelin-1 and reactivate G_actin functions to stimulate the ET_1 productions and functions. (
  • All UniProtKB/Swiss-Prot entries corresponding to class 2.3.1. (
  • Plasmalogens contain a hydrocarbon chain linked to glycerol C-1 via vinyl ether linkage whereas alkylacylglycerophospholipids the alkyl substituent at glycerol C-1 is attached via an ether linkage. (
  • Shindou H. [Lysophospholipid acyltransferase and platelet-activating factor (PAF) biosynthetic enzyme]. (

No images available that match "1 acylglycerophosphocholine o acyltransferase"