1-Acylglycerophosphocholine O-Acyltransferase: An enzyme localized predominantly within the plasma membrane of lymphocytes. It catalyzes the transfer of long-chain fatty acids, preferentially unsaturated fatty acids, to lysophosphatides with the formation of 1,2-diacylglycero-3-phosphocholine and CoA. EC 2.3.1.23.Acyltransferases: Enzymes from the transferase class that catalyze the transfer of acyl groups from donor to acceptor, forming either esters or amides. (From Enzyme Nomenclature 1992) EC 2.3.Glycerol-3-Phosphate O-Acyltransferase: An enzyme that transfers acyl groups from acyl-CoA to glycerol-3-phosphate to form monoglyceride phosphates. It acts only with CoA derivatives of fatty acids of chain length above C-10. Also forms diglyceride phosphates. EC 2.3.1.15.Phosphatidylcholine-Sterol O-Acyltransferase: An enzyme secreted from the liver into the plasma of many mammalian species. It catalyzes the esterification of the hydroxyl group of lipoprotein cholesterol by the transfer of a fatty acid from the C-2 position of lecithin. In familial lecithin:cholesterol acyltransferase deficiency disease, the absence of the enzyme results in an excess of unesterified cholesterol in plasma. EC 2.3.1.43.Diacylglycerol O-Acyltransferase: An enzyme that catalyses the last step of the TRIACYLGLYCEROL synthesis reaction in which diacylglycerol is covalently joined to LONG-CHAIN ACYL COA to form triglyceride. It was formerly categorized as EC 2.3.1.124.Sterol O-Acyltransferase: An enzyme that catalyzes the formation of cholesterol esters by the direct transfer of the fatty acid group from a fatty acyl CoA derivative. This enzyme has been found in the adrenal gland, gonads, liver, intestinal mucosa, and aorta of many mammalian species. EC 2.3.1.26.Lecithin Acyltransferase Deficiency: An autosomal recessively inherited disorder caused by mutation of LECITHIN CHOLESTEROL ACYLTRANSFERASE that facilitates the esterification of lipoprotein cholesterol and subsequent removal from peripheral tissues to the liver. This defect results in low HDL-cholesterol level in blood and accumulation of free cholesterol in tissue leading to a triad of CORNEAL OPACITY, hemolytic anemia (ANEMIA, HEMOLYTIC), and PROTEINURIA.Metabolome: The dynamic collection of metabolites which represent a cell's or organism's net metabolic response to current conditions.Metabolomics: The systematic identification and quantitation of all the metabolic products of a cell, tissue, organ, or organism under varying conditions. The METABOLOME of a cell or organism is a dynamic collection of metabolites which represent its net response to current conditions.Docosahexaenoic Acids: C22-unsaturated fatty acids found predominantly in FISH OILS.Fatty Acids: Organic, monobasic acids derived from hydrocarbons by the equivalent of oxidation of a methyl group to an alcohol, aldehyde, and then acid. Fatty acids are saturated and unsaturated (FATTY ACIDS, UNSATURATED). (Grant & Hackh's Chemical Dictionary, 5th ed)Myristic Acid: A saturated 14-carbon fatty acid occurring in most animal and vegetable fats, particularly butterfat and coconut, palm, and nutmeg oils. It is used to synthesize flavor and as an ingredient in soaps and cosmetics. (From Dorland, 28th ed)Myristic Acids: 14-carbon saturated monocarboxylic acids.Fatty Acids, Unsaturated: FATTY ACIDS in which the carbon chain contains one or more double or triple carbon-carbon bonds.Echium: A plant genus of the family BORAGINACEAE. Members contain GAMMA-LINOLENIC ACID and PYRROLIZIDINE ALKALOIDS.Palmitic Acid: A common saturated fatty acid found in fats and waxes including olive oil, palm oil, and body lipids.Fatty Acids, Omega-3: A group of fatty acids, often of marine origin, which have the first unsaturated bond in the third position from the omega carbon. These fatty acids are believed to reduce serum triglycerides, prevent insulin resistance, improve lipid profile, prolong bleeding times, reduce platelet counts, and decrease platelet adhesiveness.Linoleic Acids: Eighteen-carbon essential fatty acids that contain two double bonds.Linoleic Acid: A doubly unsaturated fatty acid, occurring widely in plant glycosides. It is an essential fatty acid in mammalian nutrition and is used in the biosynthesis of prostaglandins and cell membranes. (From Stedman, 26th ed)Phospholipids: Lipids containing one or more phosphate groups, particularly those derived from either glycerol (phosphoglycerides see GLYCEROPHOSPHOLIPIDS) or sphingosine (SPHINGOLIPIDS). They are polar lipids that are of great importance for the structure and function of cell membranes and are the most abundant of membrane lipids, although not stored in large amounts in the system.Sesame Oil: The refined fixed oil obtained from the seed of one or more cultivated varieties of Sesamum indicum. It is used as a solvent and oleaginous vehicle for drugs and has been used internally as a laxative and externally as a skin softener. It is used also in the manufacture of margarine, soap, and cosmetics. (Dorland, 28th ed & Random House Unabridged Dictionary, 2d ed)Stearic Acids: A group of compounds that are derivatives of octadecanoic acid which is one of the most abundant fatty acids found in animal lipids. (Stedman, 25th ed)Cocos: A plant genus of the family ARECACEAE. It is a tropical palm tree that yields a large, edible hard-shelled fruit from which oil and fiber are also obtained.Plasmalogens: GLYCEROPHOSPHOLIPIDS in which one of the two acyl chains is attached to glycerol with an ether alkenyl linkage instead of an ester as with the other glycerophospholipids.PC12 Cells: A CELL LINE derived from a PHEOCHROMOCYTOMA of the rat ADRENAL MEDULLA. PC12 cells stop dividing and undergo terminal differentiation when treated with NERVE GROWTH FACTOR, making the line a useful model system for NERVE CELL differentiation.Phosphorylcholine: Calcium and magnesium salts used therapeutically in hepatobiliary dysfunction.Soybean Oil: Oil from soybean or soybean plant.Lysophosphatidylcholines: Derivatives of PHOSPHATIDYLCHOLINES obtained by their partial hydrolysis which removes one of the fatty acid moieties.Erucic Acids: cis-13-Docosenoic Acids. 22-Carbon monounsaturated, monocarboxylic acids.Praseodymium: Praseodymium. An element of the rare earth family of metals. It has the atomic symbol Pr, atomic number 59, and atomic weight 140.91.Phosphatidylcholines: Derivatives of phosphatidic acids in which the phosphoric acid is bound in ester linkage to a choline moiety. Complete hydrolysis yields 1 mole of glycerol, phosphoric acid and choline and 2 moles of fatty acids.Fatty Liver: Lipid infiltration of the hepatic parenchymal cells resulting in a yellow-colored liver. The abnormal lipid accumulation is usually in the form of TRIGLYCERIDES, either as a single large droplet or multiple small droplets. Fatty liver is caused by an imbalance in the metabolism of FATTY ACIDS.Bile Acids and Salts: Steroid acids and salts. The primary bile acids are derived from cholesterol in the liver and usually conjugated with glycine or taurine. The secondary bile acids are further modified by bacteria in the intestine. They play an important role in the digestion and absorption of fat. They have also been used pharmacologically, especially in the treatment of gallstones.Choline Deficiency: A condition produced by a deficiency of CHOLINE in animals. Choline is known as a lipotropic agent because it has been shown to promote the transport of excess fat from the liver under certain conditions in laboratory animals. Combined deficiency of choline (included in the B vitamin complex) and all other methyl group donors causes liver cirrhosis in some animals. Unlike compounds normally considered as vitamins, choline does not serve as a cofactor in enzymatic reactions. (From Saunders Dictionary & Encyclopedia of Laboratory Medicine and Technology, 1984)Spectrometry, Mass, Electrospray Ionization: A mass spectrometry technique used for analysis of nonvolatile compounds such as proteins and macromolecules. The technique involves preparing electrically charged droplets from analyte molecules dissolved in solvent. The electrically charged droplets enter a vacuum chamber where the solvent is evaporated. Evaporation of solvent reduces the droplet size, thereby increasing the coulombic repulsion within the droplet. As the charged droplets get smaller, the excess charge within them causes them to disintegrate and release analyte molecules. The volatilized analyte molecules are then analyzed by mass spectrometry.Metabolic Networks and Pathways: Complex sets of enzymatic reactions connected to each other via their product and substrate metabolites.Liver: A large lobed glandular organ in the abdomen of vertebrates that is responsible for detoxification, metabolism, synthesis and storage of various substances.Phycomyces: A genus of zygomycetous fungi in the family Mucoraceae, order MUCORALES, forming mycelia having a metallic sheen. It has been used for research on phototropism.Encyclopedias as Topic: Works containing information articles on subjects in every field of knowledge, usually arranged in alphabetical order, or a similar work limited to a special field or subject. (From The ALA Glossary of Library and Information Science, 1983)Sterols: Steroids with a hydroxyl group at C-3 and most of the skeleton of cholestane. Additional carbon atoms may be present in the side chain. (IUPAC Steroid Nomenclature, 1987)Enzymes: Biological molecules that possess catalytic activity. They may occur naturally or be synthetically created. Enzymes are usually proteins, however CATALYTIC RNA and CATALYTIC DNA molecules have also been identified.Terminology as Topic: The terms, expressions, designations, or symbols used in a particular science, discipline, or specialized subject area.Fingers: Four or five slender jointed digits in humans and primates, attached to each HAND.Oxidoreductases Acting on Aldehyde or Oxo Group Donors: A broad category of oxidoreductases that either reduce double bonds or oxidize single bonds between OXYGEN and CARBON in organic compounds.Glutathione Transferase: A transferase that catalyzes the addition of aliphatic, aromatic, or heterocyclic FREE RADICALS as well as EPOXIDES and arene oxides to GLUTATHIONE. Addition takes place at the SULFUR. It also catalyzes the reduction of polyol nitrate by glutathione to polyol and nitrite.Rhodobacter: A genus of gram-negative bacteria widely distributed in fresh water as well as marine and hypersaline habitats.Acyl-Carrier Protein S-Acetyltransferase: A enzyme that catalyzes the transfer of acetyl groups from ACETYL CoA to acyl-carrier protein to form COENZYME A and acetyl-acyl-carrier protein.Drosophila melanogaster: A species of fruit fly much used in genetics because of the large size of its chromosomes.Drosophila: A genus of small, two-winged flies containing approximately 900 described species. These organisms are the most extensively studied of all genera from the standpoint of genetics and cytology.Drosophila Proteins: Proteins that originate from insect species belonging to the genus DROSOPHILA. The proteins from the most intensely studied species of Drosophila, DROSOPHILA MELANOGASTER, are the subject of much interest in the area of MORPHOGENESIS and development.New YorkLarva: Wormlike or grublike stage, following the egg in the life cycle of insects, worms, and other metamorphosing animals.Genome, Insect: The genetic complement of an insect (INSECTS) as represented in its DNA.Animals, Genetically Modified: ANIMALS whose GENOME has been altered by GENETIC ENGINEERING, or their offspring.

Synthesis of azidophospholipids and labeling of lysophosphatidylcholine acyltransferase from developing soybean cotyledons. (1/118)

A photoreactive substrate analog of lysophosphatidylcholine (LPC), 1-([(4-azidosalicyl)-12-amino)]dodecanoyl-sn-glycerol-3-phospho cholin e (azido-LPC) was synthesized. Fast atom bombardment mass spectrometry was employed to confirm the structures of azido-LPC and its intermediates. Azido-LPC was used to label putative acyl-CoA:LPC acyltransferase from microsomal membranes of developing soybean cotyledons. The synthesized substrate analog acts as a substrate for the target acyltransferases and phospholipases in the dark. When the microsomal membranes were incubated with the acyl acceptor analog and immediately photolyzed, LPC acyltransferase was irreversibly inhibited. Photoinactivation of the enzyme by the photoprobe decreased in the presence of LPC. Microsomal membranes were photolyzed with 125I-labeled azido-LPC and analyzed by SDS-PAGE followed by autoradiography. These revealed that the analog preferentially labeled 54- and 114-kDa polypeptides. Substrate protected the labeling of both the polypeptides. In our earlier report, the same polypeptides were also labeled with photoreactive acyl-CoA analogs, suggesting that these polypeptides could be putative LPC acyltransferase(s). These results demonstrated that the photoreactive phospholipid analog could be a powerful tool to label acyltransferases involved in lipid biosynthesis.  (+info)

Effects of inhibitors of arachidonic acid turnover on the production of prostaglandins by the guinea-pig uterus. (2/118)

The supply of free arachidonic acid from phospholipids is generally regarded as the rate-limiting step for prostaglandin (PG) synthesis by tissues. Two enzymes involved in arachidonic acid uptake into, and release from, phospholipids are acyl-CoA:lysophospholipid acyltransferase (ACLAT) and phospholipase A2 (PLA2), respectively. PGF2 alpha produced by the endometrium induces luteolysis in several species including guinea-pigs. Thimerosal, an inhibitor of ACLAT, and aristolochic acid, an inhibitor of PLA2, both reduced, in a concentration-dependent manner, the output of PGF2 alpha from guinea-pig endometrium cultured for 24 h on days 7 and 15 of the oestrous cycle. This study showed that the continual production of PGF 2 alpha by guinea-pig endometrium is not only dependent upon the activity of PLA2 for releasing free arachidonic acid for PGF2 alpha synthesis, but also on the incorporation of arachidonic acid into the phospholipid pool by the activity of ACLAT. The inhibitory effects of thimerosal and aristolochic acid on the outputs of PGE2 and 6-keto-PGF1 alpha were less marked, particularly on day 7 when the low output of PGE2 was unaffected and the output of 6-keto-PGF1 alpha was increased at the lower concentrations of thimerosal. This finding indicates that there are different pools of arachidonic acid bound as phospholipid for the syntheses of PGF2 alpha and 6-keto-PGF1 alpha by guinea-pig endometrium.  (+info)

Inhibition of the plastidial phosphatidylcholine synthesis by silver, copper, lead and mercury induced by formation of mercaptides with the lyso-PC acyltransferase. (3/118)

Plastids greatly rely on the import of extraplastidial precursors for the synthesis of their own lipids, and several studies have shown that a lyso-PC acyltransferase located in the envelope may be involved in the import process. Because the presence of heavy metals in soil or in nutrient solutions induces changes in the lipid composition of plastid membranes (and therefore greatly reduces the photosynthetic capability of plants), we analysed the effect of several metal salts on plastidial lyso-PC acyltransferase activity. Among the 12 heavy metals studied, silver, copper, mercury and lead inhibited this activity. Metal bound to the enzyme was not - or only very slightly - released from the protein except when thiol-reducing agents (and not imidazole) were added. The results strongly suggest that the inhibitory effect is due to a formation of mercaptide between metal and cysteine(s). The relationship between the inhibition of the plastidial lyso-PC acyltransferase activity and the in vivo effects of metal salts on the plastid membranes is discussed.  (+info)

Acylation of lysophosphatidylcholine plays a key role in the response of monocytes to lipopolysaccharide. (4/118)

Mononuclear phagocytes play a pivotal role in the progression of septic shock by producing tumor necrosis factor-alpha (TNF-alpha) and other inflammatory mediators in response to lipopolysaccharide (LPS) from Gram-negative bacteria. Our previous studies have shown monocyte and macrophage activation correlate with changes in membrane phospholipid composition, mediated by acyltransferases. Interferon-gamma (IFN-gamma), which activates and primes these cells for enhanced inflammatory responses to LPS, was found to selectively activate lysophosphatidylcholine acyltransferase (LPCAT) (P < 0.05) but not lysophosphatidic acid acyltransferase (LPAAT) activity. When used to prime the human monocytic cell line MonoMac 6, the production of TNF-alpha and interleukin-6 (IL-6) was approximately five times greater in cells primed with IFN-gamma than unprimed cells. Two LPCAT inhibitors SK&F 98625 (diethyl 7-(3,4,5-triphenyl-2-oxo2,3-dihydro-imidazole-1-yl)heptane phosphonate) and YM 50201 (3-hydroxyethyl 5,3'-thiophenyl pyridine) strongly inhibited (up to 90%) TNF-alpha and IL-6 production in response to LPS in both unprimed MonoMac-6 cells and in cells primed with IFN-gamma. In similar experiments, these inhibitors also substantially decreased the response of both primed and unprimed peripheral blood mononuclear cells to LPS. Sequence-based amplification methods showed that SK&F 98625 inhibited TNF-alpha production by decreasing TNF-alpha mRNA levels in MonoMac-6 cells. Taken together, the data from these studies suggest that LPCAT is a key enzyme in both the pathways of activation (priming) and the inflammatory response to LPS in monocytes.  (+info)

Inhibition of a Golgi complex lysophospholipid acyltransferase induces membrane tubule formation and retrograde trafficking. (5/118)

Recent studies have suggested that formation of Golgi membrane tubules involves the generation of membrane-associated lysophospholipids by a cytoplasmic Ca2+-independent phospholipase A2 (PLA2). Herein, we provide additional support for this idea by showing that inhibition of lysophospholipid reacylation by a novel Golgi-associated lysophosphatidylcholine acyltransferase (LPAT) induces the rapid tubulation of Golgi membranes, leading in their retrograde movement to the endoplasmic reticulum. Inhibition of the Golgi LPAT was achieved by 2,2-dimethyl-N-(2,4,6-trimethoxyphenyl)dodecanamide (CI-976), a previously characterized antagonist of acyl-CoA cholesterol acyltransferase. The effect of CI-976 was similar to that of brefeldin A, except that the coatomer subunit beta-COP remained on Golgi-derived membrane tubules. CI-976 also enhanced the cytosol-dependent formation of tubules from Golgi complexes in vitro and increased the levels of lysophosphatidylcholine in Golgi membranes. Moreover, preincubation of cells with PLA2 antagonists inhibited the ability of CI-976 to induce tubules. These results suggest that Golgi membrane tubule formation can result from increasing the content of lysophospholipids in membranes, either by stimulation of a PLA2 or by inhibition of an LPAT. These two opposing enzyme activities may help to coordinately regulate Golgi membrane shape and tubule formation.  (+info)

The activities of acyl-CoA:1-acyl-lysophospholipid acyltransferase(s) in human platelets. (6/118)

The activities of acyl-CoA:1-acyl-lysophospholipid acyltransferases (EC 2.3.1.23) have been studied in human platelet lysates by using endogenously formed [14C]acyl-CoA from [14C]fatty acid, ATP and CoA in the presence of 1-acyl-lysophosphatidyl-choline (lysoPC), -ethanolamine (lysoPE), -serine (lysoPS) or -inositol (lysoPI). Linoleic acid as fatty acid substrate had the highest affinity to acyl-CoA:1-acyl-lysophospholipid acyltransferase with lysoPC as variable substrate, followed by eicosapentaenoic acid (EPA) and arachidonic acid (AA). The activity at optimal conditions was 7.4, 7.3 and 7.2 nmol/min per 10(9) platelets with lysoPC as substrate, with linoleic acid, AA and EPA respectively. EPA and AA were incorporated into all lyso-forms. Linoleic acid was also incorporated into lysoPE at a high rate, but less into lysoPS and lysoPI. DHA was incorporated into lysoPC and lysoPE, but only slightly into lysoPI and lysoPS. Whereas incorporation of all fatty acids tested was maximal for lysoPC and lysoPI at 200 and 80 microM respectively, maximal incorporation needed over 500 microM for lysoPE and lysoPS. The optimal concentration for [14C]fatty acid substrates was in the range 15-150 microM for all lysophospholipids. Competition experiments with equimolar concentrations of either lysoPC and lysoPI or lysoPE resulted in formation of [14C]PC almost as if lysoPI or lysoPE were not added to the assay medium.  (+info)

Effect of apoprotein B conformation on the activation of lysolecithin acyltransferase and lecithin: cholesterol acyltransferase. Studies with subfractions of low density lipoproteins. (7/118)

In order to determine the role of apoprotein (apo) B conformation in the activation of the lysolecithin acyl-transferase reaction, we studied the activation of purified enzyme by various subfractions of low density lipoprotein (LDL), isolated by density gradient centrifugation. The activation of LAT correlated positively with the density of LDL and negatively with cholesterol/protein and triglyceride (TG)/protein ratios. The enzyme activation was also positively correlated with the number of trinitrobenzenesulfonic acid-reactive lysine amino groups, which increased with increasing density of LDL. The immunoaffinity of the LDL subfractions for B1B6, a monoclonal antibody directed to the receptor-binding region of apoB, increased with increasing density, while the affinity toward C1.4, a monoclonal antibody directed to the amino-terminal region of apoB, was not altered. Enrichment of normal whole LDL with TG resulted in a 45% reduction in enzyme activation, a 27% decrease in the number of trinitrobenzenesulfonic acid-reactive lysine groups, and a marked reduction in the immunoaffinity for B1B6. All these parameters reversed to normal when the TG-enriched LDL was treated with milk lipoprotein lipase, which specifically reduced the TG content of LDL. The LDL subfractions also supported cholesterol esterification by the purified enzyme, in parallel with lysolecithin esterification, indicating that apoB can also serve as an activator of the lecithin-cholesterol acyltransferase reaction. These results strongly suggest that the localized conformational change of apoB which occurs during the TG depletion of the precursor particle is critical for its activation of acyltransferase reactions, in a manner analogous to its interaction with the cellular receptors.  (+info)

Ypr140wp, 'the yeast tafazzin', displays a mitochondrial lysophosphatidylcholine (lyso-PC) acyltransferase activity related to triacylglycerol and mitochondrial lipid synthesis. (8/118)

When the yeast protein Ypr140w was expressed in Escherichia coli, a lyso-PC [lysophosphatidylcholine (1-acylglycerophosphorylcholine)] acyltransferase activity was found associated with the membranes of the bacteria. To our knowledge, this is the first identification of a protein capable of catalysing the acylation of lyso-PC molecules to form PC. Fluorescence microscopy analysis of living yeasts revealed that the fusion protein Ypr140w-green fluorescent protein is targeted to the mitochondria. Moreover, in contrast with wild-type cells, in the absence of acyl-CoA, the yeast mutant deleted for the YPR140w gene has no lyso-PC acyltransferase activity associated with the mitochondrial fraction. When yeast cells were grown in the presence of lactate, the mutant synthesized 2-fold more triacylglycerols when compared with the wild-type. Moreover, its mitochondrial membranes contained a lesser amount of PC and cardiolipin, and the fatty acid composition of these latter was greatly changed. These modifications were accompanied by a 2-fold increase in the respiration rates (states 3 and 4) of the mitochondria. The relationship between the deletion of the YPR140w gene and the lipid composition of the ypr140wDelta cells is discussed.  (+info)

Objective HCV is intimately linked with the liver lipid metabolism, devoted to the efflux of triacylglycerols stored in lipid droplets (LDs) in the form of triacylglycerol-rich very-low-density lipoproteins (VLDLs): (i) the most infectious HCV particles are those of lowest density due to association with triacylglycerol-rich lipoproteins and (ii) HCV-infected patients frequently develop hepatic steatosis (increased triacylglycerol storage). The recent identification of lysophosphatidylcholine acyltransferase 1 (LPCAT1) as an LD phospholipid-remodelling enzyme prompted us to investigate its role in liver lipid metabolism and HCV infectious cycle. ...
The budding yeast ALE1 gene encodes a lysophospholipid acyltransferase (LPLAT) with broad specificity. We show that yeast LPLAT (ScLPLAT) belongs to a distinct protein family that includes human MBOAT1, MBOAT2, MBOAT4, and several closely related proteins from other eukaryotes. We further show that two plant proteins within this family, the Arabidopsis proteins AtLPLAT1 and AtLPLAT2, possess lysophospholipid acyltransferase activities similar to ScLPLAT. We propose that other members of this protein family, which we refer to as the LPLAT family, also are likely to possess LPLAT activity. Finally, we show that ScLPLAT differs from the specific lysophosphatidic acid acyltransferase that is encoded by SLC1 in that it cannot efficiently use lysophosphatidic acid produced by acylation of glycerol-3-phosphate in vitro.. ...
Acyltransferase which contributes to the regulation of free arachidonic acid (AA) in the cell through the remodeling of phospholipids. Mediates the conversion of lysophosphatidylinositol (1-acylglycerophosphatidylinositol or LPI) into phosphatidylinositol (1,2-diacyl-sn-glycero-3-phosphoinositol or PI) (LPIAT activity). Prefers arachidonoyl-CoA as the acyl donor. Lysophospholipid acyltransferases (LPLATs) catalyze the reacylation step of the phospholipid remodeling pathway also known as the Lands cycle. Required for cortical lamination during brain development (By similarity).
In enzymology, a phosphatidylcholine---sterol O-acyltransferase (EC 2.3.1.43) is an enzyme that catalyzes the chemical reaction phosphatidylcholine + a sterol ⇌ {\displaystyle \rightleftharpoons } 1-acylglycerophosphocholine + a sterol ester Thus, the two substrates of this enzyme are phosphatidylcholine and sterol, whereas its two products are 1-acylglycerophosphocholine and sterol ester. This enzyme belongs to the family of transferases, specifically those acyltransferases transferring groups other than aminoacyl groups. The systematic name of this enzyme class is phosphatidylcholine:sterol O-acyltransferase. Other names in common use include lecithin---cholesterol acyltransferase, phospholipid---cholesterol acyltransferase, LCAT (lecithin-cholesterol acyltransferase), lecithin:cholesterol acyltransferase, and lysolecithin acyltransferase. This enzyme participates in glycerophospholipid metabolism. Bartlett K, Keat MJ, Mercer EI (1974). "Biosynthesis of sterol esters in Phycomyces ...
Displays acyl-CoA-dependent lysophospholipid acyltransferase activity with a subset of lysophospholipids as substrates; converts lysophosphatidylethanolamine to phosphatidylethanolamine, lysophosphatidylcholine to phosphatidycholine, 1-alkenyl-lysophatidylethanolamine to 1-alkenyl-phosphatidylethanolamine, lysophosphatidylglycerol and alkyl-lysophosphatidylcholine to phosphatidylglycerol and alkyl-phosphatidylcholine, respectively. In contrast, has no lysophosphatidylinositol, glycerol-3-phosphate, diacylglycerol or lysophosphatidic acid acyltransferase activity. Prefers long chain acyl-CoAs (C16, C18) as acyl donors ...
Displays acyl-CoA-dependent lysophospholipid acyltransferase activity with a subset of lysophospholipids as substrates; converts lysophosphatidylethanolamine to phosphatidylethanolamine, 1-alkenyl-lysophatidylethanolamine to 1-alkenyl-phosphatidylethanolamine, lysophosphatidylglycerol and alkyl-lysophosphatidylcholine to phosphatidylglycerol and alkyl-phosphatidylcholine, respectively. In contrast, has no lysophosphatidylinositol, glycerol-3-phosphate, diacylglycerol or lysophosphatidic acid acyltransferase activity. Prefers long chain acyl-CoAs (C16, C18) as acyl donors (By similarity). Converts lysophosphatidylcholine to phosphatidycholine.
PubMed Central Canada (PMC Canada) provides free access to a stable and permanent online digital archive of full-text, peer-reviewed health and life sciences research publications. It builds on PubMed Central (PMC), the U.S. National Institutes of Health (NIH) free digital archive of biomedical and life sciences journal literature and is a member of the broader PMC International (PMCI) network of e-repositories.
1. Abate W andJackson SK (2015). Lysophosphatidylcholine Acyltransferase (LPCAT)- 2 Co-localises withTLR4 and Regulates Macrophage Inflammatory Gene expression in Response to LPS.FASEB 22(1):888 2. Helley MP, AbateW, Jackson SK, Bennett JH & Thompson SWN 2015. THE EXPRESSION OFTOLL-LIKE RECEPTOR 4, 7 AND CO-RECEPTORS IN NEUROCHEMICAL SUB-POPULATIONS OFRAT TRIGEMINAL GANGLION SENSORY NEURONS NEUROSCIENCE 310, 686-698 3. Rawson FJ, HicksJ, Dodd N, Abate W, Garrett DJ, Yip N, Fejer G, Downard AJ, Baronian KHR &Jackson SK 2015. Fast, Ultrasensitive Detection of Reactive Oxygen Species Using aCarbon Nanotube Based-Electrocatalytic Intracellular Sensor ACS APPLIEDMATERIALS & INTERFACES 7, (42) 23527-23537 4. Alrammah H, Abate, W., Avent, N.,Jackson, S. K. (2015) Overexpression of lysophosphatidylcholine acyltransferase 2 (LPCAT2)up-regulated LPS-induced responses in a murine macrophage cell line. Immunology, 143. 5. Sattar A, Bradley G, Abate W, Fejer G, Jackson SK (2015)Evaluation of health ...
Sigma-Aldrich offers abstracts and full-text articles by [Tomomi Shida-Sakazume, Yosuke Endo-Sakamoto, Motoharu Unozawa, Chonji Fukumoto, Ken Shimada, Atsushi Kasamatsu, Katsunori Ogawara, Hidetaka Yokoe, Masashi Shiiba, Hideki Tanzawa, Katsuhiro Uzawa].
Plant Acyl-CoA:Lysophosphatidylcholine Acyltransferases (LPCATs) have different specificities in their forward and reverse reactions
Background em Anopheles stephensi /em mitochondrial malic enzyme (Me personally) surfaced as having another part in the provision of pyruvate for the Krebs routine because inhibition of the enzyme leads to the entire abrogation of air uptake by mitochondria. em Homo sapiens /em . Measurements of Me personally activity in mosquito mitochondria isolated from ASE cells demonstrated that ( em i /em ) em Vmax /em with NAD+ was 3-fold greater than that with NADP+, ( em ii /em ) addition of Mg2+ or Mn2+ improved the em Vmax /em by 9- to 21-fold, with Mn2+ 2.3-fold far better than Mg2+, ( em iii /em ) succinate and fumarate increased the experience by 2- and 5-fold, 55750-53-3 supplier respectively, at sub-saturating concentrations of malate, ( em iv /em ) among the analogs of L-malate tested as inhibitors from the NAD+-reliant ME catalyzed response, little (2- to 3-carbons) organic diacids carrying a COL5A1 2-hydroxyl/keto group behaved as the utmost potent inhibitors of Me personally activity (e.g., ...
A lot of human diseases are due to chronic tissue injury with fibrosis possibly resulting in organ failure. also be a helpful immunomodulator EMR2 in MDC1A. This understanding is vital for the look of future restorative interventions for muscular dystrophies that goal at targeting swelling, specifically that osteopontin inhibition continues to be recommended for Duchenne muscular dystrophy therapy. Swelling is a robust regulator of both physiological and pathological procedures in cells. Swelling and fibrosis result in loss of muscle mass function in a variety of types of muscular dystrophy. Congenital muscular dystrophy due to mutations in the laminin 2 string gene (MDC1A) is among the most devastating types of muscular dystrophy (both in human beings and mice)1. Clinical Adenosine IC50 medical indications include serious muscle mass wasting, progressive muscle mass weakness, joint contractures, respiratory system and feeding troubles and numerous problems. Most patients shed ambulation in ...
List of all the English words with 25 letters containing letter A. acrocephalopolysyndactyly, acylglycerophosphocholine, acylglycerophosphoglucose, acylglycerophosphoserines, alpha-methylphenethylamine, amygdalohippocampectomies, antiacetylcholinesterases
MBOAT7 - MBOAT7 (Myc-DDK-tagged)-Human membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 4 available for purchase from OriGene - Your Gene Company.
LPCAT2 Full-Length MS Protein Standard (NP_060309), Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine, was produced in human 293 cells (HEK293) with fully chemically defined cell culture medium to obtain incorporation efficiency at Creative-Proteomics. This gene encodes a member of the lysophospholipid acyltransferase family. The encoded enzyme may function in two ways: to catalyze the biosynthesis of platelet-activating factor (1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine) from 1-O-alkyl-sn-glycero-3-phosphocholine, and to catalyze the synthesis of glycerophospholipid precursors from arachidonyl-CoA and lysophosphatidylcholine. The encoded protein may function in membrane biogenesis and production of platelet-activating factor in inflammatory cells. The enzyme may localize to the endoplasmic reticulum and the Golgi.
Use Bio-Rads PrimePCR assays, controls, templates for your target gene. Every primer pair is optimized, experimentally validated, and performance guaranteed.
Use Bio-Rads PrimePCR assays, controls, templates for your target gene. Every primer pair is optimized, experimentally validated, and performance guaranteed.
MBOAT4 antibody (membrane bound O-acyltransferase domain containing 4) for IHC-P, WB. Anti-MBOAT4 pAb (GTX53651) is tested in Human, Mouse samples. 100% Ab-Assurance.
Schematic pathways for unusual fatty acid (UFA) incorporation into triacylglycerols (TAG) after synthesis in phosphatidylcholine (PC). The sn numbers on a pathway indicate the possible positions of vernoloyl groups in TAG. LPA, lysophosphatidate; PA, phosphatidate; PDAT, phospholipid:diacylglycerol acyltransferase; CPT, cholinephosphotransferase; DGAT, acyl-CoA:diacylglycerol acyltransferase; DGTA, diacylglycerol transacylase; LPCAT, lysophosphatidylcholine acyltransferase; GPAT, glycerol-3-phosphate acyltransferase; LPAT, lysophosphatidate acyltransferase; PAP, phosphatidate phosphatase; PL, phospholipase; ACS, acyl-CoA synthetase.. In order to induce large changes in oil composition, lysophosphatidic acid acyltransferase (LPAT) has been considered an important target enzyme because of its selective discrimination ability. High-erucic acid rapeseed (HEAR; Brassica napus) and meadowfoam (Limnanthes) have 60% and 90% erucic acid in their triacylglycerols. In meadowfoam, erucic acid is present in ...
Euonymus alatus diacylglycerol acetyltransferase (EaDAcT) synthesizes the unusually structured 3-acetyl-1,2-diacylglycerols (acetyl-TAG) found in the seeds of a few plant species. A member of the membrane-bound O-acyltransferase (MBOAT) family, EaDAcT transfers the acetyl group from acetyl-CoA to sn-1,2-diacylglycerol (DAG) to produce acetyl-TAG. In vitro assays demonstrated that the enzyme is also able to utilize butyryl-CoA and hexanoyl-CoA as acyl donors, though with much less efficiency compared with acetyl-CoA. Acyl-CoAs longer than eight carbons were not used by EaDAcT. This extreme substrate specificity of EaDAcT distinguishes it from all other MBOATs which typically catalyze the transfer of much longer acyl groups. In vitro selectivity experiments revealed that EaDAcT preferentially acetylated DAG molecules containing more double bonds over those with less. However, the enzyme was also able to acetylate saturated DAG containing medium chain fatty acids, albeit with less efficiency. ...
Expression of MBOAT2 (FLJ14415, FLJ90298, OACT2) in nasopharynx tissue. Antibody staining with HPA014836 in immunohistochemistry.
The worlds first wiki where authorship really matters. Due credit and reputation for authors. Imagine a global collaborative knowledge base for original thoughts.
Bacterial capsular polysaccharides (CPS) are produced by a multi-protein membrane layer complicated, in which a particular type of tyrosine-autokinases named BY-kinases, control their move and polymerization. is certainly defective recommending that CpsD autophosphorylation interferes with these procedures therefore producing in cell constriction problems and cell elongation. We display that CpsD stocks structural homology with ParA-like … Read more Bacterial capsular polysaccharides (CPS) are produced by a multi-protein membrane layer. Read More ...
Expression of HHATL (C3orf3, GUP1, KIAA1173, MBOAT3, MSTP002, OACT3) in cancer tissue. The cancer tissue page shows antibody staining of the protein in 20 different cancers.
Buy our Tafazzin / TAZ peptide (276-287). Ab45823 is a blocking peptide for ab40004 and has been validated in BL. Abcam provides free protocols, tips and…
A combination of site-directed and random mutagenesis generated sequence variants of a plastidial lysophosphatidic acid acyltransferase. Alanine substitutions of residues present within two conserved motifs including the putative catalytic histidine resulted in a loss of acyltransferase activity assessed as complementation competance. Substitutions at five sites within the central core resulted in reduced or loss of activity. Truncation mutants reveal that sequences in the C-terminal moiety are essential for function.. ...
Tafazzin knockdown causes hypertrophy of neonatal cardiac myocytes (34), and mutation of the tafazzin gene causes dilated cardiomyopathy in Barth syndrome (64). Our work with neonatal cardiac fibroblasts (NVFs) showed that tafazzin knockdown increased ROS production, activated MAPKs including p42/44 and p38, stimulated transcriptional and translational factors, which in turn activated cell cycle regulators, and increased DNA and protein synthesis. On the other hand, tafazzin knockdown also decreased intracellular ATP, activated AMPK, and halted the energy-consuming process (i.e., cell proliferation), ultimately resulting in multinucleation, hypertrophy, and enhanced collagen secretion.. Tafazzin plays an important role in de novo cardiolipin synthesis and remodeling in the mitochondria. Tafazzin knockdown leads to reduced cardiolipin, which is consistent with previous studies involving yeast (28), Drosophila (72), and human skin fibroblasts (68). To be consistent with what is reported in mice ...
Agpat2 - Agpat2 (untagged ORF) - Rat 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) (Agpat2), (10 ug) available for purchase from OriGene - Your Gene Company.
Definition of Sterol O-Acyltransferase in the Financial Dictionary - by Free online English dictionary and encyclopedia. What is Sterol O-Acyltransferase? Meaning of Sterol O-Acyltransferase as a finance term. What does Sterol O-Acyltransferase mean in finance?
(R)-Lisofylline ((R)-Lisophylline) is a (R)-enantiomer of the metabolite of Pentoxifylline with anti-inflammatory properties. (R)-Lisofylline is a lysophosphatidic acid acyltransferase inhibitor with an IC50 of 0.6 µM and interrupts IL-12 signaling-mediated STAT4 activation. (R)-Lisofylline has the potential for type 1 diabetes, autoimmune disorders research. - Mechanism of Action & Protocol.
Definition of Phosphatidylcholine-sterol o-acyltransferase with photos and pictures, translations, sample usage, and additional links for more information.
RPH629Hu01, MGAT2; DGAT2L5; DC5; 2-Acylglycerol O-Acyltransferase 2; Diacylglycerol O-acyltransferase candidate 5; Diacylglycerol acyltransferase 2-like protein 5 | Products for research use only!
... - Dictionar termeni medicali - Concept individual al dispozitiei membrelor si a identificarii diferitelor parti ale organismului propriu
Pharmaceuticals in the aquatic environment is an emerging issue and the risks they pose are mostly unknown. They are used in large amounts throughout the world and can enter the environment, as the active metabolite or unmetabolised, through excretion by people and improper disposal. As these drugs are designed to have specific biological effects in a specific organism (as well as sometimes having other non-specific side effects), their potential to cause effects within the environment is great. Clofibric acid (the major metabolite of the lipid lowering drug, Clofibrate) is non-biodegradable, highly motile, very persistent and frequently detected at μg/I levels in the environment. I studied possible effects of clofibric acid in fish, using different experimental approaches and endpoints. The studies involve two different species, and for one of these species, fish at different stages of development. The chapters within this thesis have presented the first evidence (albeit preliminary) of ...
ale Definition, ale Best Plays of ale in Scrabble® and Words With Friends, Length tables of words in ale, Word growth of ale, Sequences of ale
Porkslap Pale Ale is a American Pale Ale (APA) style beer brewed by Butternuts Beer & Ale in Garrattsville, NY. 3.2 average with 889 ratings, reviews and opinions.
Old Jock Ale is a Scotch Ale / Wee Heavy style beer brewed by Broughton Ales Ltd in Broughton, Biggar, GB6, United Kingdom. 3.91 average with 150 ratings, reviews and opinions.
1.) Ahoj Aleš! Ako sa máš? Mám se pracovně. Zaplacené složenky na stromech nerostou. 2.) Musím Tebe aj kapele pogratulovať k novému CD. Veľmi sa mi páči. Ako si s ním spokojný? Děkujeme. Já osobně […]. ...
Tafazzin is a protein that in humans is encoded by the TAZ gene. Tafazzin is highly expressed in cardiac and skeletal muscle. It is involved in the metabolism of cardiolipin. Tafazzin functions as a phospholipid-lysophospholipid transacylase. The mutation of the tafazzin gene is associated with a number of clinical disorders including Barth syndrome (BTHS) (type II 3-Methylglutaconic aciduria), dilated cardiomyopathy (DCM), hypertrophic DCM, endocardial fibroelastosis, and left ventricular noncompaction (LVNC). Tafazzin is responsible for remodeling of a phospholipid cardiolipin (CL), the signature lipid of the mitochondrial inner membrane. As a result, BTHS patients exhibit defects in CL metabolism, including aberrant CL fatty acyl composition, accumulation of monolysocardiolipin (MLCL) and reduced total CL levels. The protein was identified by Italian scientists Silvia Bione et al. in 1996. Owing to the complex procedure required for the identification of tafazzin, the protein was named after ...
Quantitative and qualitative alterations of mitochondrial cardiolipin have been implicated in the pathogenesis of Barth syndrome, an X-linked cardioskeletal myopathy caused by a deficiency in tafazzin, an enzyme in the cardiolipin remodeling pathway. A tafazzin-deficient Drosophila model of Barth syndrome that is characterized by low cardiolipin (CL) concentration, abnormal cardiolipin fatty acyl composition, abnormal mitochondria, and poor motor function has been generated earlier. This study shows that tafazzin deficiency in Drosophila disrupts the final stage of spermatogenesis, spermatid individualization, and causes male sterility. This phenotype can be genetically suppressed by inactivation of the gene encoding a calcium-independent phospholipase A2, iPLA2-VIA, which also prevents cardiolipin depletion/monolysocardiolipin accumulation, although in wild-type flies inactivation of the iPLA2-VIA does not affect the molecular composition of cardiolipin. Furthermore, it was shown that treatment ...
GT:ID BAD56558.1 GT:GENE BAD56558.1 GT:PRODUCT putative 1-acylglycerol-3-phosphate O-acyltransferase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1863574..1864296) GB:FROM 1863574 GB:TO 1864296 GB:DIRECTION - GB:PRODUCT putative 1-acylglycerol-3-phosphate O-acyltransferase GB:PROTEIN_ID BAD56558.1 LENGTH 240 SQ:AASEQ MFYWLLKFVLVGPFIRVYNRPTVEGVENIPSDGPAILAGNHLSIADWLFAPLLSPRRINYLAKAEYFTTPGIKGRLQKFFFSGTGQYPIDRSGADAAEDALNAARKLLDQGKLVGLYPEGTRSPDGRLYKGKTGMARLALETGVPVIPVAVIGTDKVAPPGPFRWRRHKVTVKFGAPIDFSRYEGMGGNRFVERAVTDEVMYELMRLSGQEYVDVYAHSLKGVPSGSKPEAPRIPDTAAS GT:EXON 1,1-240:0, BL:SWS:NREP 1 BL:SWS:REP 9-,161,LPAT1_ARATH,2e-17,35.7,143/356, SEG 94-,104,adaaedalnaa, RP:PFM:NREP 1 RP:PFM:REP 23-,152,PF01553,5e-18,42.4,125/132,Acyltransferase, HM:PFM:NREP 1 HM:PFM:REP 21-,151,PF01553,1.2e-31,45.2,126/135,Acyltransferase, GO:PFM:NREP 2 GO:PFM GO:0008152,GO:metabolic process,PF01553,IPR002123, GO:PFM GO:0008415,GO:acyltransferase activity,PF01553,IPR002123, ...
Acyl-CoA:lysocardiolipin acyltransferase. Possesses both lysophosphatidylinositol acyltransferase (LPIAT) and lysophosphatidylglycerol acyltransferase (LPGAT) activities. Recognizes both monolysocardiolipin and dilysocardiolipin as substrates with a preference for linoleoyl-CoA and oleoyl-CoA as acyl donors. Acts as a remodeling enzyme for cardiolipin, a major membrane polyglycerophospholipid. Converts lysophosphatidic acid (LPA) into phosphatidic acid (PA) with a relatively low activity. Required for establishment of the hematopoietic and endothelial lineages ...
Thabet K, Asimakopoulos A, Shojaei M, Romero-Gomez M, Mangia A, Irving WL, Berg T, Dore GJ, Gronbaek H, Sheridan D, Abate ML, Bugianesi E, Weltman M, Mollison L, Cheng W, Riordan S, Fischer J, Spengler U, Nattermann J, Wahid A, Rojas A, White R, Douglas MW, McLeod D, Powell E, Liddle C, Van Der Poorten D, George J, Eslam M, Gallego-Duran R, Applegate T, Bassendine M, Rosso C, Mezzabotta L, Leung R, Malik B, Matthews G, Grebely J, Fragomeli V, Jonsson JR, Santaro R. MBOAT7 rs641738 increases risk of liver inflammation and transition to fibrosis in chronic hepatitis C. Nature Communications 2016, 7, 12757 ...
Merrit Kennedy is a reporter for The Two-Way, NPR's breaking news blog. She covers a broad range of issues, from the latest developments out of the
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.Ok ...
ЛОНДОН - Мы знаем, как искоренить полиомиелит. Действующая с 1980-х годов международная программа вакцинации под руководством Всемирной организации здравоохранения привела к почти полному исчезновению вируса полиомиелита. Болезнь, которая ежегодно убивала или парализовала полмиллиона людей на земле, поражает сегодня только несколько сот человек во всем мире.. Препятствие, стоящее сегодня на пути уничтожения вируса, не связано с медицинскими или техническими ограничениями, а вызвано политическим сопротивлением вакцинации. Действительно, ...
Barth syndrome (BTHS) is an X-linked genetic condition, usually transmitted from mother to son (although there is a relatively high incidence of new mutations in Barth syndrome and one confirmed case report of a female Barth syndrome patient). A mother who is a carrier of a Barth syndrome mutation (the gene is named tafazzin - also called TAZ or G4.5) shows no signs or symptoms of this disorder herself, probably due to skewed X-chromosome inactivation.. There is a 50% chance that a boy born to a female carrier will have Barth syndrome, whereas girls born to a carrier have a 50% risk of being carriers themselves. All daughters of a male with Barth syndrome will be carriers, however no sons will be affected. Because there are proven non-carrier mothers, all mothers of Barth syndrome children should be tested in order to define the genetic risk in each family.. Any male child related through the female line to a Barth syndrome individual should be tested for the disorder, as there can be great ...
Creative Biostructure now can provide advanced custom Mempro™ CoA-dependent acyltransferases production using virus-like particles for both academic and industry applications.
Creative Biostructure offers advanced custom Mempro™ CoA-Dependent acyltransferases production services using cell-free expression system.
First metabolomics studies have indicated that metabolic fingerprints from accessible tissues might be useful to better understand the etiological links between metabolism and cancer. However, there is still a lack of prospective metabolomics studies on pre-diagnostic metabolic alterations and cancer risk. Associations between pre-diagnostic levels of 120 circulating metabolites (acylcarnitines, amino acids, biogenic amines, phosphatidylcholines, sphingolipids, and hexoses) and the risks of breast, prostate, and colorectal cancer were evaluated by Cox regression analyses using data of a prospective case-cohort study including 835 incident cancer cases. The median follow-up duration was 8.3 years among non-cases and 6.5 years among incident cases of cancer. Higher levels of lysophosphatidylcholines (lysoPCs), and especially lysoPC a C18:0, were consistently related to lower risks of breast, prostate, and colorectal cancer, independent of background factors. In contrast, higher levels of
I posted a picture of Kennedy, kat (his mom), Elton and me under the photo section and Joyce had asked about Kennedys MVD. I would like to say thank you to all of those that have offered help and guidence for my friend here at Cavalier Talk but I want to say just how helpful it was that I wrote some of this down and how that has led to where he is now. Just a recap, Kennedys main problem was that he would wake up scared and not able to breath. His vet said he had grade 3 and the MVD was
Duncan Kennedy News. Find breaking news, commentary, and archival information about Duncan Kennedy From The tribunedigital-chicagotribune
Carly Simon was surprised to learn that her pal, Jackie Kennedy Onassis, was willing to open up about some of the heartaches she endured with her first husband, President John F. Kennedy.
Kennedy family said in a statement, "Weve lost the irreplaceable center of our family and joyous light in our lives, but the inspiration of his faith, optimism, and perseverance will live on in our hearts forever. He loved this country and devoted his life to serving it ...
See what Alexandra Ale (alexandraborlod) has discovered on Pinterest, the worlds biggest collection of everybodys favorite things.
A unique approach to connecting people and ideas in the life sciences, creating a space for probing conversations and deep insight into the topics and trends shaping our future.
medicina generala Recuperarea medicala a bolnavilor respiratori Tudor Sbenghe 90.00 Medicala ,Endocrinologie clinica St. -m. Milcu 50.00 Medicala ,Tratamentul sechelelor motorii ale encefalopatiilor infantile N. Robanescu 70.00 MEDICALA ,Kinetoterapia in recuperarea algiilor si a tulburarilor de statica vertebrala Laurian Sdic 50.00 MEDICALA
TY - JOUR. T1 - Lysophosphatidylcholine is a regulator of tyrosine kinase activity and intracellular Ca2+ level in Jurkat T cell line. AU - Légrádi, Ádám. AU - Chitu, Violeta. AU - Szukacsov, Valéria. AU - Fajka-Boja, Roberta. AU - Szücs, Kinga Székely. AU - Monostori, Éva. PY - 2004/1/30. Y1 - 2004/1/30. N2 - Lysophospholipids, particularly lysophosphatidylcholine (lyso-PC), have been implicated in modulating T cell functions at the sites of inflammation and atherosclerosis. Although the chemotactic and immunomodulatory effects are well documented, the exact signaling pathway of lyso-PC action is poorly defined. In this work, we studied the earliest biochemical events in T cells triggered by lyso-PC. A marked and immediate tyrosine phosphorylation was induced in the leukemic T cell line, Jurkat. Phosphorylation of cellular substrates included src family kinase, p56lck and syk family kinase, ZAP70. The lyso-PC induced tyrosine phosphorylation was largely dependent on the presence of ...
casSAR Dugability of Q8RFU2 | lpxA | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase - Also known as LPXA_FUSNN, lpxA. Involved in the biosynthesis of lipid A, a phosphorylated glycolipid that anchors the lipopolysaccharide to the outer membrane of the cell. Homotrimer.
Catalyzes the formation of fatty acid-cholesterol esters, which are less soluble in membranes than cholesterol. Plays a role in lipoprotein assembly and dietary cholesterol absorption. In addition to its acyltransferase activity, it may act as a ligase.
Like many genetic disorders, Barth syndrome is quite variable among different families and sometimes even within a single sibship. Whereas at least 80% of known patients with Barth syndrome manifest all four principal diagnostic criteria at some time during childhood, any or possibly even all of the cardinal findings may be absent in a boy with a proven mutation in the Barth gene. This variability in presentation of symptoms and severity in phenotype makes Barth syndrome a difficult disorder to diagnose. In absence of a family history of related illnesses, the clinician is presented with the challenge to diagnose a child who inherits the disorder through a spontaneous mutation. The diagnosis of Barth syndrome should be considered for any child or adult found to have any one of its four cardinal clinical characteristics, and evaluation for the other diagnostic criteria should be undertaken by obtaining the following studies:. ...
A Perry, Florida mom is featured in this months edition of Readers Digest for promoting awareness of Barth Syndrome. Her son suffers from the disease that attacks young children.
The EDG (endothelial differentiation gene) family of G protein coupled receptors consists of eight family members that bind lysophospholipid (LPL)…
Former First Lady of the United States, late Jacqueline Kennedy Onnasis, was so worried about her first daughter Caroline Kennedy s weight.
Every city has its celebrated malcontents, and among San Franciscos finest were the Dead Kennedys. Led by the articulately confrontational…
You know the game has forever changed when Patrick Kennedy volunteers to leave the stage. Lee Siegel on the sea change in how personal our politics have become.
The McCurdy Family (clockwise from left): Steve, Will, Kate, andEliza (photo courtesy of the McCurdy family) For more on the McCurdys and the Barth Syndrome Foundation, tune in to NBCs TODAY show onMonday, February 16. From the day he was born in 1986, Will McCurdy was a bright, engaging, and alert child. Butwhen he [...]
Proprietatile vindecatoare ale plantelor | Ekilibrium.ro - tratamente si remedii naturiste, sfaturi si practici homeopate de calitate, nutritie si multe alte stiri medicale pe Ekilibrium.ro.
pizza jest the best. A z tuńczykiem to mniam! Ale ja mogę zapomnieć o takim jedzonku. Dziś odebrałem wyniki badania krwi i.... jeszcze powtórzę to badanie, ale to chyba niemożliwe, żeby trójglicerydy skoczyły z 300 na 500... bo jeśli tak, to wkrótce zamieniam się w królika ...
At UC San Francisco, we encourage our students to approach health care issues with critical thinking and a spirit of inquiry. As tomorrows health and science leaders in training, UCSF students embody our passion for improving the human condition and pushing health care forward.. ...
Lipid A, the hydrophobic anchor of lipopolysaccharide, is an essential component in the outer membrane of most Gram-negative bacteria. Food-borne pathogen Cronobacter sakazakii synthesizes two lipid A species, differing by the length of the secondary acyl chain. In this work, we identified three genes ESA02293, ESA02951 and ESA01386 encoding for the late acyltransferases of lipid A biosynthesis pathway in C. sakazakii. Based on the sequence alignment, proteins YP_001438378.1 encoded by ESA02293, YP_001439016.1 encoded by ESA02951, and YP_001437482.1 encoded by ESA01386 are homologous to E. coli LpxL, LpxP and LpxM, respectively. Functions of the three acyltransferases were confirmed by overexpressing the genes in E. coli, isolating lipid As and analyzing their structures using an ESI/MS. C. sakazakii LpxL and LpxM transfer a C14:0 secondary acyl chain to the 2′- and 3′-position of lipid A, respectively. C. sakazakii LpxP can transfer either a C16:1 or a C14:0 secondary acyl chains to the 2′
Title: Polyketide bio-derivatization using thepromiscuous acyltransferase KirCIIAuthor: Musiol-Kroll, E.M., Zubeil, F., Schafhauser, T.,Hartner, T., Kulik, A., McArthur, J., Koryakina, I., Wohlleben, W., Grond, S.,Williams, G.J., Lee, S.Y., and Weber,
Title: Polyketide bio-derivatization using thepromiscuous acyltransferase KirCIIAuthor: Musiol-Kroll, E.M., Zubeil, F., Schafhauser, T.,Hartner, T., Kulik, A., McArthur, J., Koryakina, I., Wohlleben, W., Grond, S.,Williams, G.J., Lee, S.Y., and Weber,
RecName: Full=Sphingosine 1-phosphate receptor 3; Short=S1P receptor 3; Short=S1P3;AltName: Full=Endothelial differentiation G-protein coupled receptor 3;AltName: Full=Lysophospholipid receptor B3;AltName: Full=Sphingosine 1-phosphate rece ...
Listen to 2 Bad by Dom Kennedy Dom Kennedy releases the first official single from his upcoming album, By Dom Kennedy which drops on June 2nd. The record
WLP060 American Ale Yeast Blend White Labs most popular yeast strain is WLP001, Cal Ale. This blend celebrates the strengths of California-clean, neutral fe...
Get address of FL Personal Trainer St Barth, submit your review or ask any question about FL Personal Trainer St Barth, search nearby places on map.
este sme z toho trosku s mm vyvaleni, ale potichucky sa tesime, v piatok som mala dusika, ktoreho ale moj manzel nevidel a hovoril mi, ze si to nahovaram, ale ta dnesna ho uz presvedcila i ked je este slaba, ale je tam.... snazime sa od jula 2009 ale zo zaciatku len tak light, merat som zacala az v juni tohto roku....a vyzera, ze by to mohlo vyjst, tento mesiac som pouzila gel Conceive plus neviem ci to bolo tym....mrsku by som mala mat az zajtra, ale mavam dva dni pred spinenie a to sa mi neobjavilo tak dufam, dost ma bolia prsia a posledne styri dni mavam vecer kyselinu a trosku ma pobolieva podbrusko, inak na 21.12. som objednana k lekarovi, tento termin uz mam dva mesiace, chcela som zmenit doktora, lebo ten moj chcel cakat do jari a ze potom zacneme riesit vysetrenia.....ale neviem, ci uz nieco bude vidiet......lauritka DAKUJEM ZA TVOJE TESTY, NAOZAJ PRINASAJU STASTIE a posielam vam vsetkym virusiky ...
The prognosis and treatment for Edward Kennedy are uncertain, doctors say. The 76-year-old senator was diagnosed today with brain tumor known as a malignant glioma-the same diagnosis some 9,000... Politics News Summaries. | Newser
Visit Healthgrades for information on Dr. Willard Kennedy, MD Find Phone & Address information, medical practice history, affiliated hospitals and more.
We may start our morning off with a fermented kombucha drink, but back in the Middle Ages, the main source of hydration was ale. Thats right: beer!
Virtutile terapeutice ale verzei - acest aliment atit de comun pentru noi - sint cunoscute inca din antichitate, ea fiind considerata la un moment dat un adevar
Magazin virtual cu produse naturiste la preturi super accesibile! Toate produsele sunt naturale si de calitate superioara. De aceea am ales sa va oferim o gama de suplimente alimentare, produse cosmetice si de curatenie ce imbina esentele naturii cu principiile stiintifice moderne
Imunitatea scazuta este cauzata de slabirea principalelor organe de protejare ale corpului: pielea, ficatul, rinichii si fluxul sanguin.
... - Ce este Amoxicilina si pentru ce se utilizeazaIndicatiiTratamentul infectiilor produse de microorganisme sensibile la amoxicilina:bronsite acute si acutizari ale bronsitei cronice;- pneumopa
I co prawda nie mam jakiś strasznych pomysłów na tego bloga, ale spróbuję, może ktoś to jeszcze odwiedza od czasu do czas ...
2-acylglycerophosphocholine O-acyltransferase, an enzyme purified in liver microsomes, catalyzes specifically the acylation of ... In contrast to these finding from rat liver microsomes, mammalian acyl transferase from dog lungs was found to exhibit no ... M. F. Frosolono; Slivka, S; Charms, BL (1971-01-01). "Acyl transferase activities in dog lung microsomes". Journal of Lipid ... Arthur, G. (Jul 1989). "Acylation of 2-acyl-glycerophosphocholine in guinea-pig heart microsomal fractions". Biochem J. 261 (2 ...
2-acylglycerophosphocholine O-acyltransferase EC 2.3.1.63: 1-alkylglycerophosphocholine O-acyltransferase EC 2.3.1.64: agmatine ... sphingosine N-acyltransferase EC 2.3.1.25: plasmalogen synthase EC 2.3.1.26: sterol O-acyltransferase EC 2.3.1.27: cortisol O- ... retinol O-fatty-acyltransferase EC 2.3.1.77: triacylglycerol-sterol O-acyltransferase EC 2.3.1.78: heparan-a-glucosaminide N- ... tropine acyltransferase EC 2.3.1.186: pseudotropine acyltransferase EC 2.3.1.187: acetyl-S-ACP:malonate ACP transferase EC 2.3. ...
... phosphatidylcholine-sterol O-acyltransferase MeSH D08.811.913.050.646 --- retinol O-fatty-acyltransferase MeSH D08.811.913.050. ... diacylglycerol o-acyltransferase MeSH D08.811.913.050.425 --- glycerol-3-phosphate O-acyltransferase MeSH D08.811.913.050.600 ... acetyl-CoA C-acyltransferase MeSH D08.811.913.050.134 --- acetyltransferases MeSH D08.811.913.050.134.029 --- acyl-carrier ... sterol O-acyltransferase MeSH D08.811.913.200.324 --- acetolactate synthase MeSH D08.811.913.200.650 --- transaldolase MeSH ...
... may refer to: 1-acylglycerophosphocholine O-acyltransferase, an enzyme Phosphatidylcholine-sterol ...
This enzyme belongs to the family of transferases, specifically those acyltransferases transferring groups other than aminoacyl ... In enzymology, a 1-alkenylglycerophosphocholine O-acyltransferase (EC 2.3.1.104) is an enzyme that catalyzes the chemical ... Arthur G, Choy PC (1986). "Acylation of 1-alkenyl-glycerophosphocholine and 1-acyl-glycerophosphocholine in guinea pig heart". ... The systematic name of this enzyme class is acyl-CoA:1-alkenylglycerophosphocholine O-acyltransferase. This enzyme participates ...
... lecithin-cholesterol acyltransferase), lecithin:cholesterol acyltransferase, and lysolecithin acyltransferase. This enzyme ... Other names in common use include lecithin---cholesterol acyltransferase, phospholipid---cholesterol acyltransferase, LCAT ( ... In enzymology, a phosphatidylcholine---sterol O-acyltransferase (EC 2.3.1.43) is an enzyme that catalyzes the chemical reaction ... This enzyme belongs to the family of transferases, specifically those acyltransferases transferring groups other than aminoacyl ...
Fat-1 Transgene is Associated with Improved Reproductive Outcomes.. High intake of omega-3 polyunsaturated fatty acids (PUFAs) ... 1-acylglycerophosphocholine O-acyltransferase. An enzyme localized predominantly within the plasma membrane of lymphocytes. It ... to lysophosphatides with the formation of 1,2-diacylglycero-3-phosphocholine and CoA. EC 2.3.1.23. ...
Lysophospholipid acyltransferases (LPLATs) catalyze the reacylation step of the phospholipid remodeling pathway also known as ... Acyltransferase which mediates the conversion of lysophosphatidylcholine (1-acyl-sn-glycero-3-phosphocholine or LPC) into ... 1-acyl-2-hydroxy-sn-glycero-3-phospho-L-serine or LPS) into phosphatidylserine (1,2-diacyl-sn-glycero-3-phospho-L-serine or PS ... 1-acyl-sn-glycero-3-phosphoethanolamine or LPE) into phosphatidylethanolamine (1,2-diacyl-sn-glycero-3-phosphoethanolamine or ...
Transferase(Phosphotransferase) domain 1. The name of this superfamily has been modified since the most recent official CATH+ ... 1-acylglycerophosphocholine O-acyltransferase. [EC: 2.3.1.23] Acyl-CoA + 1-acyl-sn-glycero-3-phosphocholine = CoA + 1,2-diacyl ... 1) (6R)-6-beta-hydroxy-1,4,5,6-tetrahydronicotinamide-adenine dinucleotide = (6S)-6-beta-hydroxy-1,4,5,6-tetrahydronicotinamide ... Inactive with cyclohex-2-en-1-one and 12-oxophytodienoic acid. * Involved in the detoxification of alpha,beta-unsaturated ...
Phosphatidylcholine-sterol acyltransferase. General function:. Involved in phosphatidylcholine-sterol O-acyltransferase ... 2-acylglycerol O-acyltransferase 2. General function:. Involved in transferase activity, transferring acyl groups other than ... Lecithin retinol acyltransferase. General function:. Involved in phosphatidylcholine-retinol O-acyltransfera. Specific function ... Lysophospholipid acyltransferase 5. General function:. Involved in 1-acylglycerophosphocholine O-acyltransfera. Specific ...
Phosphatidylcholine-sterol acyltransferase. General function:. Involved in phosphatidylcholine-sterol O-acyltransferase ... 2-acylglycerol O-acyltransferase 2. General function:. Involved in transferase activity, transferring acyl groups other than ... Lecithin retinol acyltransferase. General function:. Involved in phosphatidylcholine-retinol O-acyltransfera. Specific function ... Lysophospholipid acyltransferase 5. General function:. Involved in 1-acylglycerophosphocholine O-acyltransfera. Specific ...
Phosphatidylcholine-sterol acyltransferase. General function:. Involved in phosphatidylcholine-sterol O-acyltransferase ... 2-acylglycerol O-acyltransferase 2. General function:. Involved in transferase activity, transferring acyl groups other than ... Lecithin retinol acyltransferase. General function:. Involved in phosphatidylcholine-retinol O-acyltransfera. Specific function ... Lysophospholipid acyltransferase 5. General function:. Involved in 1-acylglycerophosphocholine O-acyltransfera. Specific ...
Phosphatidylcholine-sterol acyltransferase. General function:. Involved in phosphatidylcholine-sterol O-acyltransferase ... 2-acylglycerol O-acyltransferase 2. General function:. Involved in transferase activity, transferring acyl groups other than ... Lecithin retinol acyltransferase. General function:. Involved in phosphatidylcholine-retinol O-acyltransfera. Specific function ... Lysophospholipid acyltransferase 5. General function:. Involved in 1-acylglycerophosphocholine O-acyltransfera. Specific ...
This enzyme belongs to the family of transferases, specifically those acyltransferases transferring groups other than aminoacyl ... In enzymology, a 1-alkenylglycerophosphocholine O-acyltransferase (EC 2.3.1.104) is an enzyme that catalyzes the chemical ... Arthur G, Choy PC (1986). "Acylation of 1-alkenyl-glycerophosphocholine and 1-acyl-glycerophosphocholine in guinea pig heart". ... The systematic name of this enzyme class is acyl-CoA:1-alkenylglycerophosphocholine O-acyltransferase. This enzyme participates ...
Lecithin-cholesterol acyltransferase (Thr123----Ile) and lecithin-cholesterol acyltransferase (Thr347----Met). J Clin Invest. ... Skretting G, Prydz H: An amino acid exchange in exon I of the human lecithin: cholesterol acyltransferase (LCAT) gene is ... Wiebusch H, Cullen P, Owen JS, Collins D, Sharp PS, Funke H, Assmann G: Deficiency of lecithin:cholesterol acyltransferase due ... McLean J, Wion K, Drayna D, Fielding C, Lawn R: Human lecithin-cholesterol acyltransferase gene: complete gene sequence and ...
Lysophosphatidylcholine acyltransferase 2. General function:. Involved in acyltransferase activity. Specific function:. ... Involved in acyltransferase activity. Specific function:. Possesses both acyltransferase and acetyltransferase activities. ... 8. Phosphatidylcholine-sterol acyltransferase. General function:. Involved in phosphatidylcholine-sterol O-acyltransferase ... Lecithin retinol acyltransferase. General function:. Involved in phosphatidylcholine-retinol O-acyltransfera. Specific function ...
Lysophosphatidylcholine acyltransferase 2. General function:. Involved in acyltransferase activity. Specific function:. ... 2-acyl-glycerophosphocholine. *Phosphocholine. *Glycerol vinyl ether. *Fatty acid ester ... Involved in acyltransferase activity. Specific function:. Possesses both acyltransferase and acetyltransferase activities. ... 9. Phosphatidylcholine-sterol acyltransferase. General function:. Involved in phosphatidylcholine-sterol O-acyltransferase ...
Lysophosphatidylcholine acyltransferase 2. General function:. Involved in acyltransferase activity. Specific function:. ... 2-acyl-glycerophosphocholine. *Phosphocholine. *Glycerol vinyl ether. *Fatty acid ester ... Involved in acyltransferase activity. Specific function:. Possesses both acyltransferase and acetyltransferase activities. ... 9. Phosphatidylcholine-sterol acyltransferase. General function:. Involved in phosphatidylcholine-sterol O-acyltransferase ...
Lysophosphatidylcholine acyltransferase 2. General function:. Involved in acyltransferase activity. Specific function:. ... Phosphatidylcholine-sterol acyltransferase. General function:. Involved in phosphatidylcholine-sterol O-acyltransferase ... Involved in acyltransferase activity. Specific function:. Possesses both acyltransferase and acetyltransferase activities. ... Lysophospholipid acyltransferase 5. General function:. Involved in 1-acylglycerophosphocholine O-acyltransfera. Specific ...
9. Lysophosphatidylcholine acyltransferase 2. General function:. Involved in acyltransferase activity. Specific function:. ... Involved in acyltransferase activity. Specific function:. Possesses both acyltransferase and acetyltransferase activities. ... 7. Lysophospholipid acyltransferase 5. General function:. Involved in 1-acylglycerophosphocholine O-acyltransfera. Specific ... Acyltransferase which mediates the conversion of lysophosphatidylcholine (1-acyl-sn-glycero-3-phosphocholine or LPC) into ...
Lysolecithin acyltransferase may refer to: 1-acylglycerophosphocholine O-acyltransferase, an enzyme Phosphatidylcholine-sterol ...
... lysophosphatidylcholine acyltransferase [Lpcat] 1-4), basolateral bile acid excretion (ATP-binding cassette subfamily C member ... lysophosphatidylcholine acyltransferase [Lpcat] 1-4), basolateral bile acid excretion (ATP-binding cassette subfamily C member ... lysophosphatidylcholine acyltransferase [Lpcat] 1-4), basolateral bile acid excretion (ATP-binding cassette subfamily C member ... lysophosphatidylcholine acyltransferase [Lpcat] 1-4), basolateral bile acid excretion (ATP-binding cassette subfamily C member ...
2-acylglycerophosphocholine O-acyltransferase, an enzyme purified in liver microsomes, catalyzes specifically the acylation of ... In contrast to these finding from rat liver microsomes, mammalian acyl transferase from dog lungs was found to exhibit no ... M. F. Frosolono; Slivka, S; Charms, BL (1971-01-01). "Acyl transferase activities in dog lung microsomes". Journal of Lipid ... Arthur, G. (Jul 1989). "Acylation of 2-acyl-glycerophosphocholine in guinea-pig heart microsomal fractions". Biochem J. 261 (2 ...
The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the ... Possesses both acyltransferase and acetyltransferase activities. Activity is calcium-independent. Mediates the conversion of 1- ... Steroid receptor coactivators 1 and 2 mediate fetal-to-maternal signaling that initiates parturition.. J Clin Invest 125:2808- ... Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell ...
lysophosphatidylcholine acyltransferase 1 Gene Symbol:. lpcat1 Nomenclature History {{control.fieldName}} Edit ID:. {{control. ... Orthologous to human LPCAT1 (lysophosphatidylcholine acyltransferase 1). Genome Resources: Alliance (1), Gene:555969 (1), ... Predicted to have 1-acylglycerophosphocholine O-acyltransferase activity. Predicted to be involved in phospholipid biosynthetic ...
Lysophosphatidylcholine acyltransferase 2. General function:. Involved in acyltransferase activity. Specific function:. ... Phosphatidylcholine-sterol acyltransferase. General function:. Involved in phosphatidylcholine-sterol O-acyltransferase ... Involved in acyltransferase activity. Specific function:. Possesses both acyltransferase and acetyltransferase activities. ... Lecithin retinol acyltransferase. General function:. Involved in phosphatidylcholine-retinol O-acyltransfera. Specific function ...
2-acylglycerophosphocholine O-acyltransferase EC 2.3.1.63: 1-alkylglycerophosphocholine O-acyltransferase EC 2.3.1.64: agmatine ... sphingosine N-acyltransferase EC 2.3.1.25: plasmalogen synthase EC 2.3.1.26: sterol O-acyltransferase EC 2.3.1.27: cortisol O- ... retinol O-fatty-acyltransferase EC 2.3.1.77: triacylglycerol-sterol O-acyltransferase EC 2.3.1.78: heparan-a-glucosaminide N- ... tropine acyltransferase EC 2.3.1.186: pseudotropine acyltransferase EC 2.3.1.187: acetyl-S-ACP:malonate ACP transferase EC 2.3. ...
... phosphatidylcholine-sterol O-acyltransferase MeSH D08.811.913.050.646 --- retinol O-fatty-acyltransferase MeSH D08.811.913.050. ... diacylglycerol o-acyltransferase MeSH D08.811.913.050.425 --- glycerol-3-phosphate O-acyltransferase MeSH D08.811.913.050.600 ... acetyl-CoA C-acyltransferase MeSH D08.811.913.050.134 --- acetyltransferases MeSH D08.811.913.050.134.029 --- acyl-carrier ... sterol O-acyltransferase MeSH D08.811.913.200.324 --- acetolactate synthase MeSH D08.811.913.200.650 --- transaldolase MeSH ...
... lecithin-cholesterol acyltransferase), lecithin:cholesterol acyltransferase, and lysolecithin acyltransferase. This enzyme ... Other names in common use include lecithin---cholesterol acyltransferase, phospholipid---cholesterol acyltransferase, LCAT ( ... In enzymology, a phosphatidylcholine---sterol O-acyltransferase (EC 2.3.1.43) is an enzyme that catalyzes the chemical reaction ... This enzyme belongs to the family of transferases, specifically those acyltransferases transferring groups other than aminoacyl ...
What is Phosphatidylcholine-sterol o-acyltransferase? Meaning of Phosphatidylcholine-sterol o-acyltransferase medical term. ... Looking for online definition of Phosphatidylcholine-sterol o-acyltransferase in the Medical Dictionary? Phosphatidylcholine- ... lecithin-cholesterol acyltransferase. (redirected from Phosphatidylcholine-sterol o-acyltransferase) lec·i·thin-cho·les·ter·ol ... Synonym(s): lecithin acyltransferase. lecithin-cholesterol acyltransferase. /lec·i·thin-cho·les·ter·ol ac·yl·trans·fer·ase/ ( ...
Lysolecithin acyltransferase Current Synonym true false Associated Value Sets No associated value sets.. ... 1-acylglycerophosphocholine acyltransferase Current Synonym true false 58973014 1-Acylglycerophosphocholine acyltransferase ... 1-acylglycerophosphocholine acyltransferase (substance). Code System Preferred Concept Name. 1-acylglycerophosphocholine ...
  • Acyltransferase which mediates the conversion of lysophosphatidylcholine (1-acyl-sn-glycero-3-phosphocholine or LPC) into phosphatidylcholine (1,2-diacyl-sn-glycero-3-phosphocholine or PC) (LPCAT activity). (uniprot.org)
  • Two LPCAT inhibitors SK&F 98625 (diethyl 7-(3,4,5-triphenyl-2-oxo2,3-dihydro-imidazole-1-yl)heptane phosphonate) and YM 50201 (3-hydroxyethyl 5,3'-thiophenyl pyridine) strongly inhibited (up to 90%) TNF-alpha and IL-6 production in response to LPS in both unprimed MonoMac-6 cells and in cells primed with IFN-gamma. (nih.gov)
  • In humans, 1-lysoPC can be hydrolyzed by ten different enzymes: calcium-independent phospholipase A2-gamma (coded by the gene PNPLA8), neuropathy target esterase (PNPLA6), lysophospholipase (PLB1), eosinophil lysophospholipase (CLC), galactoside-binding soluble lectin 13 (LGALS13), Group XV phospholipase A2 (PLA2G15), acyl-protein thioesterase 1 (LYPLA1), lysophospholipase (PLA2G4A), acyl-protein thioesterase 2 (LYPLA2) and PNPLA7 (Some of these enzymes also have phospholipase A2 activity). (wikipedia.org)
  • To a lesser extent, also catalyzes the acylation of lysophosphatidylethanolamine (1-acyl-sn-glycero-3-phosphoethanolamine or LPE) into phosphatidylethanolamine (1,2-diacyl-sn-glycero-3-phosphoethanolamine or PE) (LPEAT activity), and the conversion of lysophosphatidylserine (1-acyl-2-hydroxy-sn-glycero-3-phospho-L-serine or LPS) into phosphatidylserine (1,2-diacyl-sn-glycero-3-phospho-L-serine or PS) (LPSAT activity). (uniprot.org)
  • LysoPC(22:1(13Z)) is a lysophospholipid (LyP). (hmdb.ca)
  • LysoPC(22:1(13Z)), in particular, consists of one chain of erucic acid at the C-1 position. (hmdb.ca)
  • The synthesis of phosphatidylcholines with specific fatty acids occurs through the synthesis of 1-lysoPC. (wikipedia.org)
  • The formation of various other lipids generates 1-lysoPC as a by-product. (wikipedia.org)
  • 1-LysoPC can convert to the structurally similar 2-lysoPC. (wikipedia.org)
  • Starting from either 1-lysoPC or 2-lysoPC, an equilibrium mixture of 90% 2-lysoPC and 10% 1-lysoPC is obtained with a half-time of about 10 minutes under physiological conditions and about 1 hour under typical laboratory conditions. (wikipedia.org)
  • Because 1-lysoPC has a relatively short half-life (see above), it is primarily a metabolic intermediate or side-product in the formation or breakdown of other lipids. (wikipedia.org)
  • 1-LysoPC is also a by-product of the reaction in which N-arachidonoyl-1,2-diacyl-glycerol 3-phosphoethanolamine (NAPE) is produced. (wikipedia.org)
  • 1-lysoPC can be hydrolyzed further by lysophospholipases to lose the remaining fatty acid and yield L-1-glycero-3-phosphocholine. (wikipedia.org)
  • Ether analogues of triacylglycerols, i.e. 1-alkyldiacyl-sn-glycerols, are present at trace levels only if at all in most animal tissues, but they can be major components of some marine lipids. (hmdb.ca)
  • In general, glycerophospholipids contain a saturated fatty acid at C-1 and an unsaturated fatty acid at C-2, and, in general terms, the fatty acyl groups are generally 16 or 18 carbons long. (wikipathways.org)
  • This compound belongs to the class of chemical entities known as 1-acyl-sn-glycero-3-phosphocholines. (hmdb.ca)
  • This compound belongs to the class of chemical entities known as 1-(1z-alkenyl),2-acyl-glycerophosphocholines. (hmdb.ca)
  • All UniProtKB/Swiss-Prot entries corresponding to class 2.3.1. (expasy.org)
  • Plasmalogens contain a hydrocarbon chain linked to glycerol C-1 via vinyl ether linkage whereas alkylacylglycerophospholipids the alkyl substituent at glycerol C-1 is attached via an ether linkage. (wikipathways.org)
  • Members of the 1-acylglycerol-3-phosphate O-acyltransferase (EC 2.3.1.51) family, such as AGPAT7, catalyze the conversion of lysophosphatidic acid (LPA) to phosphatidic acid (PA), a precursor in the biosynthesis of all glycerolipids. (nih.gov)
  • In response, proposals have been put forth for the bioinformatics analysis of bacterial genomes to identify genes with high likelihood of scoring true in confirmatory laboratory assays of their respective function [ 1 , 2 ]. (biomedcentral.com)
  • These are glycerophosphocholines in which the glycerol is esterified with a fatty acid at O-1 position, and linked at position 3 to a phosphocholine. (hmdb.ca)
  • Acyltransferases and transacylases that determine the fatty acid composition of glycerolipids and the metabolism of bioactive lipid mediators in mammalian cells and model organisms. (semanticscholar.org)
  • In animal tissues, the alkyl and alkenyl moieties in both non-polar and phospholipids tend to be rather simple in composition with 16:0, 18:0 and 18:1 (double bond in position 9) predominating. (hmdb.ca)
  • In contrast, the expression of solute carrier family 10 member 1 (Slc10a1) and solute carrier organic anion transporter family member (Slco) 1a1 and 1b2, responsible for transporting bile acids into hepatocytes, were markedly suppressed. (elsevier.com)