MembraneCytoplasmSubunitTransientProteins formSubcellular localizationPhosphorylationTransientlyMacromolecularMediatesEnzymeSplicing-dependentGeneration of stable cell linesGeneIsotopeFacilitateTranslation elongationCellularInteractionsMulti-protein complexReceptorUbiquitinStructuralFormJunctionsInflammasomeTargetsMoleculesBindsMRNALargeSignaling pathwaySignalosomeInteractionRegulatesMammalianRecruitmentRegulatoryHistoneProtein complexCellsCellUnderstandingSequencesFoundNuclearApproachesStructuresAssemblyTranscriptionDsDNADevelopment
Membrane7
- Cellular receptors are often multi-protein complexes, the function of which requires the stable or transient interaction of membrane and intracellular proteins alike to form signaling complexes. (nih.gov)
- Moreover, hemidesmosomes are multiprotein complexes that facilitate stable adhesion of basal epithelial cells to the underlying basement membrane, while desmosomes are made up of distinct, cadherin- and plaque-associated complexes forming in the cytoplasm and delivered into the regions of cell-cell contact for the final assembly. (pediaa.com)
- Here, we report the computational design of protein pores formed by two concentric rings of ɑ-helices that are stable and mono-disperse in both water-soluble and membrane protein forms. (tjbrunette.org)
- By immunocytochemistry, it was shown that podocalyxin and the actin binding protein ezrin are co-expressed in podocytes and co-localize along the apical plasma membrane, where they form a co-immunoprecipitable complex. (embl-heidelberg.de)
- Upon Wnt ligand binding to FZD and LRP6, a multiprotein signaling complex-the Wnt signalosome-is assembled at the membrane, immobilizing the β-catenin destruction complex. (nature.com)
- We are involved in several collaborative applications in various fields including immunological protein complexes, viral proteins, membrane receptor complexes, and eye lens crystallins. (nih.gov)
- The whole biochemical machinery is hosted by the inner mitochondrial membrane (mtIM) where the protonmotive force built by respiratory complexes, dynamically assembled as super-complexes, allows the F1FO-ATP synthase to make ATP from ADP + Pi. (researchgate.net)
Cytoplasm3
- SMN is part of a stable multiprotein complex that is found in all metazoan cells in the cytoplasm and in nuclear Gems. (nih.gov)
- The resultant 2 encoded von Hippel-Lindau protein (pVHL) products, a 30-kD full-length form (p30) and a 19-kD form (p19), shuttle between the nucleus and the cytoplasm, where they form complexes with other proteins. (medscape.com)
- The ternary complex containing UFD1L, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. (nih.gov)
Subunit7
- Warfarin is thought to interfere with clotting factor synthesis by inhibition of the C1 subunit of the vitamin K epoxide reductase (VKORC1) enzyme complex, thereby reducing the regeneration of vitamin K1 epoxide. (nih.gov)
- In this study, we characterized the Trypanosoma cruzi ( T. cruzi) NatC and NatA protein complexes, each consisting of one catalytic subunit and predicted auxiliary subunits. (hindawi.com)
- The human NatA protein complex is composed of a catalytic subunit (hNaa10) and an auxiliary subunit (hNaa15) and the human NatC consists of a catalytic (hNaa30) subunit and two auxiliary (hNaa35 and hNaa38) subunits [ 7 , 8 ]. (hindawi.com)
- We previously characterized a novel acetyltransferase, the catalytic subunit of the NatC complex in T. cruzi [ 19 ], thought to belong to the NatC subgroup. (hindawi.com)
- 7. BRG1, the ATPase subunit of SWI/SNF chromatin remodeling complex, interacts with HDAC2 to modulate telomerase expression in human cancer cells. (nih.gov)
- For example, the complex of PP1 with its myosin-targeting subunit. (silverchair.com)
- 13] who first isolated from mitochondria four enzyme multi-subunit complexes that concur on the oxidation of NADH and succinate, namely NADH-Coenzyme Q reductase (Complex I, CI), succinate-Coenzyme Q reductase (Complex II, CII), ubiquinol-cytochrome c reductase (Complex III, CIII or cytochrome bc 1 Complex) and cytochrome c oxidase (Complex IV, CIV) [14] . (researchgate.net)
Transient1
- MultiLabel allows the modular assembly of independent expression units in a single plasmid which can be used for transient and stable modification of cells. (researchsquare.com)
Proteins form2
- The proteins form stable complexes in vivo and cosediment with the ribosome [ 8 , 9 ]. (hindawi.com)
- together these regulatory proteins form complex regulatory networks for precise control over gene expression in cells and organisms. (keydifference.in)
Subcellular localization2
- It determines the functional fate of many proteins including their stability, complex formation, and subcellular localization. (hindawi.com)
- In place of single proteins, proteomics examines biological systems by collective analyses of proteins by measuring changes in abundance, subcellular localization, interactions in multi-protein complexes, and post-translationally modified (PTM) forms. (quantbiology.org)
Phosphorylation2
- With the continued development of high throughput proteomics technology, dissection of the intricate mechanisms of cellular control, including protein stability, post-translational modifications such as phosphorylation, and the formation/dissociation of multi-protein complexes (subcellular machines), which may change with age, disease, and environmental conditions becomes a possibility. (nih.gov)
- Phosphorylation of H2AX by ATM results in the direct recruitment of Mdc1 and forms a complex with H2AX to recruit additional ATM molecules, forming a positive feedback loop. (oncohemakey.com)
Transiently2
- The topics will cover regulatory protein:protein and protein:RNA complexes that are formed transiently, as well as large, stable multiprotein assemblies. (nih.gov)
- The EJC is a dynamic structure consisting of core proteins and several peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. (nih.gov)
Macromolecular4
- The structural analysis of macromolecular complexes and assemblies is one of the major frontiers of structural biology, and an area where NIH intramural scientists are making important contributions. (nih.gov)
- The Laoratory of Dynamics of Macromolecular Assembly develops biophysical methods to study protein interactions and the assembly of multi-protein complexes. (nih.gov)
- Therefore, our focus is on the development of approaches for multi-component systems where several different macromolecular components interact to allow association and dissociation of different co-existing complexes in different states. (nih.gov)
- Edward A. Lemke Nucleoporins (Nups) represent a range of proteins most known for composing the macromolecular assembly of the nuclear pore complex (NPC). (silverchair.com)
Mediates4
- These data indicate that in podocytes, podocalyxin is complexed with ezrin, which mediates its link to the actin cytoskeleton. (embl-heidelberg.de)
- 6. BAF60A mediates interactions between the microphthalmia-associated transcription factor and the BRG1-containing SWI/SNF complex during melanocyte differentiation. (nih.gov)
- Catalytic component of the RAG complex, a multiprotein complex that mediates the DNA cleavage phase during V(D)J recombination. (nih.gov)
- In the RAG complex, RAG1 mediates the DNA-binding to the conserved recombination signal sequences (RSS) and catalyzes the DNA cleavage activities by introducing a double-strand break between the RSS and the adjacent coding segment. (nih.gov)
Enzyme2
- Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4. (nih.gov)
- The connection among these enzyme complexes is ensured by two mobile transporters of electrons, i.e. (researchgate.net)
Splicing-dependent1
- Core component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junctions on mRNAs. (nih.gov)
Generation of stable cell lines2
- These vectors have minimal backbone size to maximize transfection efficiency and they contain elements for the generation of stable cell lines (Supplementary Fig. 1). (researchsquare.com)
- Mammalian cells tissue culture, including transfections, generation of stable cell lines using lentiviral systems and/or genome editing techniques. (imagingcoe.org)
Gene6
- These AETFC components stabilize the complex through multivalent interactions, provide multiple DNA-binding domains for diverse target genes, co-localize genome wide, cooperatively regulate gene expression, and contribute to leukaemogenesis. (cornell.edu)
- We have therefore used gene editing methods, such as CRISPR, to generate embryonic stem (ES) cell lines in which we can specifically 'switch off' HDAC1 and HDAC2, or components of specific complexes e.g. (le.ac.uk)
- 2. mSin3A/histone deacetylase 2- and PRMT5-containing Brg1 complex is involved in transcriptional repression of the Myc target gene cad. (nih.gov)
- 19. Mammalian chromatin remodeling complex SWI/SNF is essential for enhanced expression of the albumin gene during liver development. (nih.gov)
- Within this intricate mechanism of gene regulation are two classes of proteins with separate roles in this complex machinery: regulatory proteins and repressor proteins. (keydifference.in)
- Gene expression regulation by regulatory proteins is a complex and subtle process, enabling organisms to respond and adapt to changing environmental conditions, developmental stages, and cell requirements. (keydifference.in)
Isotope3
- We used precise stable isotope dilution assays to quantify protein stoichiometry in the ASK signalosome complex and identified ASK2 at a 1:1 stoichiometric ratio with ASK1 and 14-3-3 proteins (YWHAQ, YWHAB, YWHAH, and YWHAE) collectively at a 0.5:1 ratio with ASK1 as the main components. (nih.gov)
- Ong SE, Kratchmarova I, Mann M. Properties of 13C-substituted arginine in stable isotope labeling by amino acids in cell culture (SILAC). (quantbiology.org)
- Comparing SILAC- and stable isotope dimethyl-labeling approaches for quantitative proteomics. (quantbiology.org)
Facilitate1
- Our data represents the first example of a DNA bound multi-protein complex which can slide along another DNA to facilitate target search. (elifesciences.org)
Translation elongation1
- The components of translation elongation complex eEF1H (eEF1A, eEF1Bα, eEF1Bß, eEF1Bγ) were found overexpressed in different cancers. (bvsalud.org)
Cellular4
- Based on its ability to interact with several other protein and RNA components of cellular RNPs, it is likely that the SMN complex functions as an assemblyosome in the formation of diverse RNP particles, some of which may be of particular importance to the motor neuron. (nih.gov)
- A detailed understanding of the cellular roles of the SMN complex may help the development of therapeutic strategies for this neurodegenerative disease. (nih.gov)
- In complex protein systems execution of a cellular function can be shared between several proteins. (elifesciences.org)
- Shao-En is the first author on the SILAC paper describing the approach to quantify protein and peptides, published in Molecular and Cellular Proteomics in 2002 (Refs 1 and 2). (quantbiology.org)
Interactions5
- Interactions between cells can be stable such as those made through cell junctions. (wikipedia.org)
- Stable cell-cell interactions are required for cell adhesion within a tissue and controlling the shape and function of cells. (wikipedia.org)
- These stable interactions involve cell junctions which are multiprotein complexes that provide contact between neighboring cells. (wikipedia.org)
- Hallmarks of multi-protein complexes are multi-valent interactions and cooperativity. (nih.gov)
- context-dependence fuzzy complexes fuzzy logic intrinsically disordered proteins protein-protein interactions Traditionally, we consider a statement either true or false (0 or 1, Boolean logic). (silverchair.com)
Multi-protein complex2
- Its activity is regulated by a multi-protein complex known as the inflammasome. (invivogen.com)
- disulfide-linked .Belongs to the lipopolysaccharide (LPS) receptor, a multi-protein complex containing at least CD14, LY96 and TLR4. (bomiprot.org)
Receptor1
- For instance, the biogenesis and maturation of the glycosylated immune receptor EFR -a pattern recognition receptor (PRR) that recognises the bacterial elongation factor EF-Tu to confer pattern-triggered immunity (PTI)- requires the ER-QC complex BiP/ERdj3/SDF2 [ 15 ]. (biomedcentral.com)
Ubiquitin2
- Proteolysis Targeting Chimaeras (PROTAC) are hetero-bifunctional molecules which incorporate a known binding moiety to the protein of interest (POI, e.g. an inhibitor), coupled to a ligand for an E3 ubiquitin ligase complex. (le.ac.uk)
- Study identified B-Myb as a substrate of the pVHL ubiquitin ligase complex, which targets it for degradation via the ubiquitin-proteasome pathway. (cusabio.com)
Structural5
- the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors (By similarity). (nih.gov)
- Finally, the molecular and structural analysis of multiprotein complexes needs the heterologeous expression of proteins in an appropriate host. (researchsquare.com)
- We previously used Cre/LoxP-mediated recombination to assemble multiple independent expression units in a single plasmid for production of protein complexes in Sf21 and E.coli cells for structural analyses 6 7 . (researchsquare.com)
- This will include, but not limited to, the expression, reconstitution and purification of large multi-protein and nucleic acids complexes that will be studied using structural biology, biochemistry and biophysical techniques. (imagingcoe.org)
- a member of the MRN complex , composed of Mre11, Rad50, and Nbs1), BRCA1, and SMC1 (structural maintenance of chromosomes), and these proteins coordinate repair with the cell cycle. (oncohemakey.com)
Form5
- Meanwhile, integrin α6β4 and P1a form the core of the hemidesmosome complex. (pediaa.com)
- now report evidence from experiments on Escherichia coli that support a model in which the protein catalyst (RecA in the case of E. coli ) combines with a single strand of DNA to form a filamentous DNA-protein complex (RecA filament) that can then slide along a double-stranded DNA molecule to search for a complementary sequence of base pairs. (elifesciences.org)
- Oxidized low-density lipoprotein binds β2-glycoprotein I to form circulating complexes found in both autoimmune and non-autoimmune atherosclerosis. (biomedcentral.com)
- OxLDL may interact with C-reactive protein (CRP) to form pro-atherogenic oxLDL/CRP complexes that may not only perpetuate vascular inflammation but also trigger autoimmune responses, accelerating the development of atherosclerosis [ 9 ]. (biomedcentral.com)
- Kinesins and ribosomes are examples of molecular machines, and they often take the form of multi-protein complexes . (reelpotassiu1.sbs)
Junctions1
- Tight junctions are multi-protein complexes that hold cells of a same tissue together and prevent movement of water and water-soluble molecules between cells. (wikipedia.org)
Inflammasome1
- It is likely that β2-glycoprotein I and/or these complexes contribute to early atherogenesis by stimulating pro-inflammatory innate immunity through endogenous sensors and inflammasome/interleukin-1 pathways. (biomedcentral.com)
Targets2
- Even specific HDACi, such as Entinostat (MS-275) which target predominantly HDAC1/2, results in many of the same problems, presumably because it still targets all four HDAC1/2 containing complexes non-specifically. (le.ac.uk)
- 14. MyoD targets chromatin remodeling complexes to the myogenin locus prior to forming a stable DNA-bound complex. (nih.gov)
Molecules2
- Progress in genomics and microarray technologies have led to the concept that, while individual molecules might not be adequate markers for complex traits such as aging or age-related disease, panels of markers consisting of a defined subset of the molecules might serve as valuable predictors of these traits. (nih.gov)
- We recently published the first PROTACs to target HDAC1/2 specifically in cancer cells and are currently optimising additional molecules that target specific complexes. (le.ac.uk)
Binds2
- P61959.1 MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY 1367453_at NP_446195 6.42 hsp90 co-chaperone Cdc37 Cdc37 Rattus norvegicus " Co-chaperone that binds to numerous kinases and promotes their interaction with the Hsp90 complex, resulting in stabilization and promotion of their activity. (nih.gov)
- The CERM contains a variant E2F-recognition element, and binds a complex (termed CERC) consisting of E2F4, DP1, and either p130 or p107, as well as an unidentified necessary component. (nih.gov)
MRNA2
- The MAGOH-RBM8A heterodimer inhibits the ATPase activity of EIF4A3, thereby trapping the ATP-bound EJC core onto spliced mRNA in a stable conformation. (nih.gov)
- Furthermore, ALYREF, together with other components of the TREX complex, enhances histone mRNA export. (omicsdi.org)
Large3
- ASK1 is regulated by a large, dynamic multiprotein signalosome complex, potentially including over 90 reported ASK1-interacting proteins. (nih.gov)
- A new algorithm to slice large proteins into stable mini proteins. (tjbrunette.org)
- These numbers are perhaps greater than was expected, but could reflect the capture of a number of large multiprotein complexes and/or reflect the knowledge that both proteins display chaperone-like activities. (medscape.com)
Signaling pathway1
Signalosome2
- These data support an ASK signalosome comprising a multimeric core complex of ASK1, ASK2, and 14-3-3 proteins, which dynamically engages other binding partners needed to mediate diverse stress-response signaling events. (nih.gov)
- We localized the molecular function of CD44 at the Wnt signalosome, and identified novel DVL/CD44 and AXIN/CD44 complexes. (nature.com)
Interaction3
- Within the AETFC complex, AML1-ETO oligomerization is required for a specific interaction between the oligomerized NHR2 domain and a novel NHR2-binding (N2B) motif in E proteins. (cornell.edu)
- Crystallographic analysis of the NHR2-N2B complex reveals a unique interaction pattern in which an N2B peptide makes direct contact with side chains of two NHR2 domains as a dimer, providing a novel model of how dimeric/oligomeric transcription factors create a new protein-binding interface through dimerization/oligomerization. (cornell.edu)
- Complementary to crystallographic techniques, such solution interaction studies can provide information on the assembly principles of structurally polymorph multi-protein complexes. (nih.gov)
Regulates2
- BiP is the central player of the multiprotein complex BiP/ERdj3/SDF2, while ERdj3 co-chaperone provides the BiP chaperone with unfolded polypeptides and regulates its activity [ 6 ]. (biomedcentral.com)
- The NPLOC4-UFD1L-VCP complex regulates spindle disassembly at the end of mitosis and is necessary for the formation of a closed nuclear envelope. (nih.gov)
Mammalian2
- Here we describe the necessary steps to generate stable cell lines including cloning of the genes of interest in a MultiLabel vector backbone (Fig. 1A, steps 1 - 3), Cre/LoxP-mediated assembly of these vectors (Fig. 1B, steps 4 - 6), and transfection and selection of mammalian cell lines (Fig. 1C, steps 7 - 13). (researchsquare.com)
- The NatA complex from T. brucei has been found to be essential for cell viability in both the mammalian and insect stages [ 18 ]. (hindawi.com)
Recruitment1
- 1. Recruitment of the SWI/SNF protein Brg1 by a multiprotein complex effects transcriptional repression in murine erythroid progenitors. (nih.gov)
Regulatory1
- BACKGROUND: The constituents of stable multiprotein complexes are known to dissociate from the complex to play independent regulatory roles. (bvsalud.org)
Histone1
- A multiprotein occupancy map of the mRNP on the 3' end of histone mRNAs. (omicsdi.org)
Protein complex1
- By showing that a DNA-protein complex can slide along another DNA molecule to search for a target, these results could lead to new insights into other systems in which it is necessary for protein-nucleic acid complexes to locate a particular sequence of bases. (elifesciences.org)
Cells4
- Stable transduction of bovine TLR4 and bovine MD-2 into LPS-nonresponsive cells and soluble CD14 promote the ability to respond to LPS. (bomiprot.org)
- Here we show that, in human leukaemic cells, AML1-ETO resides in and functions through a stable AML1-ETO-containing transcription factor complex (AETFC) that contains several haematopoietic transcription (co)factors. (cornell.edu)
- 11. SWI/SNF chromatin remodeling complex is critical for the expression of microphthalmia-associated transcription factor in melanoma cells. (nih.gov)
- The MuvB multiprotein complex, together with B-MYB and FOXM1 (MMB-FOXM1) regulate the expression of mitotic kinesins in breast cancer cells. (cusabio.com)
Cell4
- They are also multiprotein complexes made up of proteins called integrins , which are transmembrane receptors facilitating cell-cell adhesion. (pediaa.com)
- In addition, we describe how such plasmids are used to generate stable cell lines. (researchsquare.com)
- Cloning and assembling of up to three plasmids is possible within two weeks, the insertion of a fourth and fifth expression cassette within another two weeks, and the generation of a stable cell line takes one to two months. (researchsquare.com)
- The currently available acceptor vectors contain different resistance genes for the selection of stable cell lines. (researchsquare.com)
Understanding3
- The talks represent the two most prominent technologies for understanding these complexes, x-ray crystallography and cryo electron microscopy. (nih.gov)
- This valuable study advances our understanding of the evolution of protein complexes and their functions. (elifesciences.org)
- [4] [5] The advent of conformational analysis, or the study of conformers to analyze complex chemical structures, in the 1950s gave rise to the idea of understanding and controlling relative motion within molecular components for further applications. (reelpotassiu1.sbs)
Sequences1
- Through its binding to specific sequences in the snRNAs, the SMN complex surveys the correct identity of the target RNAs and facilitates snRNP assembly. (nih.gov)
Found1
- The proteins were found to be expressed in the three main life cycle stages of the parasite, formed stable complexes in vivo , and partially cosedimented with the ribosome in agreement with a cotranslational function. (hindawi.com)
Nuclear2
- The SMN complex contains, in addition to SMN, at least six other proteins, named Gemins2-7, and plays an essential role in the assembly of the spliceosomal small nuclear ribonucleoproteins (snRNPs). (nih.gov)
- Unexpectedly, in the A549 nuclear fraction eEF1A lost the ability to interact with the eEF1B complex. (bvsalud.org)
Approaches1
- Studying protein-nucleic acid complexes using biochemistry and/or biophysics approaches in vitro. (imagingcoe.org)
Structures1
- Syroegin, E. A. , Aleksandrova, E. V. , and Polikanov, Y. S. (2022) Insights into the ribosome function from the structures of non-arrested ribosome-nascent chain complexes . (cornell.edu)
Assembly1
- The SMN complex: an assembly machine for RNPs. (nih.gov)
Transcription1
- A stable transcription factor complex nucleated by oligomeric AML1-ETO controls leukaemogenesis. (cornell.edu)
DsDNA1
- Using single molecule fluorescence imaging tools with high spatiotemporal resolution we characterized the encounter complex between the RecA filament and dsDNA. (elifesciences.org)
Development1
- HDAC1/2 complexes are essential for embryonic development. (le.ac.uk)