Quaternary structureBioinformaticsSecondary structurePeptideHomologyMoleculesHigh similarityPrimaryMolecularInteractionsHomologous proteinsGlobularAmino acid seqResiduesComputationalSequencesHelicesPeptidesComplexesFeatures of proteinsFunctionalCatalytic domainViralAbstractFunctionallyPolypeptide chainOrphan proteinsQuantitativeFoldPolypeptidesMethodsRibosomeInteractEvolutionaryCellularGenesRotavirusMembraneSynthesisTransmembraneSubstructuresSpecific three-dimensionalMicrotubulesDifferencesMechanismsMacromolecularBackboneAlignmentInteraction dataStableEnzymesRetrievalRibosomalPathwaysIsoformsBiological functionHemolymphDataFunction predictionEnzymeKinasesEncodes
Quaternary structure5
- Such structure is termed Quaternary structure . (biochemden.com)
- When a protein possesses several polypeptide chains, then the manner in which they are sequenced is called the quaternary structure. (vedantu.com)
- And lastly, quaternary structure is the arrangement of tertiary structures into more functionally complex molecular machinery. (darwinscollapse.com)
- The result is in contrast to the pentameric assembly of the equivalent GABA A receptor fragment, indicating that sequence similarity does not necessarily imply quaternary structure similarity. (edu.hk)
- If the protein contains more than one polypeptide, the structure is referred to as quaternary structure. (customuniversitypapers.com)
Bioinformatics6
- High-Performance Computational Solutions in Protein Bioinformatics Parallel CUDA-Based Protein 3D Structure Similarity Searching %22&body=%0AI%20found%20an%20article%20you%20might%20be%20interested%20in. (sagepub.com)
- Objective】 This study was aimed to clone the Toll-like receptor 4 (TLR4) gene in Cygnus olor and analyze its encoded protein by bioinformatics,so as to provide an important reference basis for further exploring the immune mechanism of TLR4 protein against pathogenic microorganisms in Cygnus olor . (chvm.net)
- Computational protein structure prediction remains one of the most challenging problems in structural bioinformatics. (biomedcentral.com)
- The study aimed to explore the protein coding ability of the pri-miR156a in Brassicaceae plants using bioinformatics analysis of the available proteomes and translatomes reported for Arabidopsis thaliana. (fortunepublish.com)
- Bioinformatics approaches were used to predict the tertiary structure and cellular localization along with phylogenetic analysis of TPD52. (biomedcentral.com)
- [2] And third from the National Human Genome Research Institute, "Bioinformatics is the branch of biology that is concerned with the acquisition storage, display, and analysis of the information found in nucleic acid and protein sequence data. (darwinscollapse.com)
Secondary structure10
- CD spectra in pure water showed that it only possesses a small content of alpha-helical secondary structure, which from the NMR data, consists of a short unstable helix between Gln-16 and Leu-24 with the rest of the peptide in an essentially unstructured state. (uni-regensburg.de)
- On adding 50% TFE (v/v) there was a considerable increase in stable secondary structure, without any evidence of stable tertiary structure. (uni-regensburg.de)
- The secondary structure is the tendency of the polypeptide to coil or pleat due to H-bonding between R-groups. (biochemden.com)
- If the observation-to-parameter ratio is small, for example when diffraction data only extend to low resolution, the Bayesian framework implemented in REFMAC 5 uses external restraints to inject additional information extracted from structures of homologous proteins, prior knowledge about secondary-structure formation and even data obtained using different experimental methods, for example NMR. (iucr.org)
- When it is the secondary structure, then it is the shape of the peptide chain. (vedantu.com)
- Secondary structure is the arrangement of primary amino acids into motifs such as helices, sheets, coils or loops. (darwinscollapse.com)
- Tertiary structure is the three-dimensional arrangement created by packing secondary structure elements into globular domains. (darwinscollapse.com)
- The recombinant fragment was found to have stable β-rich secondary structure, and ordered tertiary packing, suggesting a stable structural domain. (edu.hk)
- The folding of the polypeptide into the secondary structure of the protein backbone such as an -helix or a -pleated sheet involves the formation of weak hydrogen bonds. (customuniversitypapers.com)
- A new method that relies on secondary structure information to align homolog RNA sequences was also recently developed [ 49 ]. (biomedcentral.com)
Peptide7
- While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. (embl.de)
- These proteins show similar domain architectures as known organelle-targeted expression regulators of the octotrico peptide repeat type in algae and plants. (frontiersin.org)
- The oldest theory is that of molecular mimicry, in which an autoimmune response initially is mounted against a peptide from an infectious agent and is subsequently directed against HLA-B27 itself due to epitopic similarities. (medscape.com)
- Peptide bond, phi, psi and chi torsion angles, ramachandran map, anatomy of proteins - Hierarchical organization of protein structure - Primary. (entrance.net.in)
- Purified CyHV-2 ORF55 protein was obtained by prokaryotic expression, and the interacting peptide was screened out using phage display. (biomedcentral.com)
- Protein and peptide interaction prediction and dot-blot overlay assay confirmed that peptides identified by phage display could interact with the ORF55 protein. (biomedcentral.com)
- Constructing glucagon like peptide-1 receptor fused with derivatives of GFP for visualizing protein-protein interaction in living cells. (leibniz-fli.de)
Homology3
- Template-based modeling, including protein threading and homology modeling, is a popular method for protein tertiary structure prediction. (biomedcentral.com)
- These results demonstrate that with the help of deep learning, ThreaderAI can significantly improve the accuracy of template-based structure prediction, especially for distant-homology proteins. (biomedcentral.com)
- The computational analysis here presented quantitatively describes the relationship between sequence and structure for RNA molecules and defines a twilight zone region for detecting RNA homology. (biomedcentral.com)
Molecules7
- There is a strong emphasis on the structure of molecules, particularly proteins, which are the nanoscale machines that carry out most processes in living organisms. (bbk.ac.uk)
- Although PPL is present in the bloodstream, no information is found on the interaction between PPL and rat serum albumin (RSA), the most abundant protein with the function of transporting endo/exogenous molecules. (nature.com)
- The nature of the chemical bond and the structure of molecules and crystals. (uni-marburg.de)
- Class I and class II molecules allow antigen presentation to the specific T-cell receptor via a specific structural groove in its tertiary structure. (medscape.com)
- Class III MHC molecules include several proteins with other immune functions, such as cytokines, heat shock proteins, and parts of complement system. (medscape.com)
- Similar to proteins, functional RNA molecules fold into specific three-dimensional conformations essential for performing their biological activity. (biomedcentral.com)
- However, to date no general large-scale study has systematically addressed the quantitative analysis of the relationship between sequence and structure conservation in RNA molecules. (biomedcentral.com)
High similarity2
- Despite low sequence similarity, the catalytic domain of SHP-1 shows high similarity in secondary and tertiary structures with other protein-tyrosine phosphatases (PTPs). (umassmed.edu)
- The whole genome of the isolates also showed high similarity to type 2 infectious forms of IHHNV. (cdc.gov)
Primary11
- Amino acids are linked together into a polypeptide, the primary structure in the organization of proteins. (biochemden.com)
- The primary structure of a protein is the sequence of amino acids, which is directly related to the sequence of information in the RNA molecule, which in turn is a copy of the information in the DNA molecule. (biochemden.com)
- Changes in the primary structure can alter the proper functioning of the protein. (biochemden.com)
- The primary structure is the sequence of amino acids in a polypeptide. (biochemden.com)
- Structural proteins, such as collagen, have regular repeated primary structures. (biochemden.com)
- PrPSC accumulates in compact, protease-resistant aggregates within neural tissue and has a different secondary and tertiary structure from PrPC, but an identical primary sequence. (biolegend.com)
- Analyzing primary structure of protein sequence revealed basic nature, instability, and low hydrophilicity of the proteins. (mdm2-inhibitors.com)
- The primary structure of a protein is its arrangement of amino acids. (vedantu.com)
- Proteins have primary, secondary, and tertiary structures. (crimsonpublishers.com)
- The function of a protein depends on its three-dimensional shape, which in turn depends on the protein's primary structure = its amino acid sequence. (customuniversitypapers.com)
- Finally, with the aim of characterizing RNA structure diversity, Abraham and co-workers recently studied the RNA conservation at three levels: primary, secondary, and tertiary structure. (biomedcentral.com)
Molecular11
- Mrozek, Dariusz 2014-06-05 00:00:00 [Finding common molecular substructures in complex 3D protein structures is still challenging. (sagepub.com)
- Finding common molecular substructures in complex 3D protein structures is still challenging. (sagepub.com)
- By employing this information, molecule libraries can be filtered for subsequent affinity assays and molecular structures can be refined with regard to affinity and selectivity. (uni-marburg.de)
- Conclusions: The extensive analysis of the protein with essential roles hasn't been easy, and in case there is E2 envelope glycoprotein of HGV, there is absolutely no very much data on its immunological and molecular features, clinical significance and its own pathogenic potential in hepatitis or any various other GBV-C related illnesses. (mdm2-inhibitors.com)
- Reverse transcription quantitative PCR results demonstrated high expression of an actin-binding Rho-activating protein in the latter stages of virus-infected cells, and molecular docking, cell transfection and coimmunoprecipitation experiments confirmed that it interacted with the ORF55 protein. (biomedcentral.com)
- Its molecular interactions were determined through KEGG analysis, and real-time PCR-based expression analysis was performed to assess its co-expression with another oncogenic cellular pathway (miR-223, KLF9, and PKCε) proteins in ovarian cancer. (biomedcentral.com)
- The aim of this study is to predict the tertiary structure of TPD52 for the first time to provide a deep insight towards a better understanding regarding the functional structure as well as the molecular basis of TPD52 as well as other members of the TPD family. (biomedcentral.com)
- In 1958 Francis Crick formulated the central dogma of molecular biology that states biological information travels in one direction-DNA is transcribed into RNA then translated into protein. (darwinscollapse.com)
- Countless proteins are the molecular machines that create the anatomy and function as the physiology of the human body. (darwinscollapse.com)
- Based on the frequency of occurrence of molecular fragments (CH3, CH2, CH, C, C¼C, H, benzene ring and H in benzene ring structure) and exposure conditions, the available QSAR-PBPK models facilitate the simulation of tissue and blood concentrations for some inhaled volatile organic chemicals. (cdc.gov)
- Molecular structure-based prediction of the temporal change in the concentration of environmental chemicals or their metabolites in blood and organs of exposed organisms is a challenge. (cdc.gov)
Interactions11
- Protein-protein interactions (PPIs) play essential roles in many biological processes. (nature.com)
- Identification of protein-protein interactions (PPIs) is important for understanding how proteins work together in a coordinated fashion in a cell to perform cellular functions. (nature.com)
- Even for Arabidopsis , known PPI data cover interactions with only about 34.55% of proteins. (nature.com)
- Currently, several approaches for protein interaction prediction for non-model species incorporate only small fractions of the entire proteomes and their interactions. (biomedcentral.com)
- The predicted interactions were obtained from a meta-approach, applying rigid body docking tests and template-based docking on protein structures predicted by different comparative modeling techniques. (biomedcentral.com)
- Using this approach, it was possible to confidently predict 681 protein structures and 6198 protein interactions for L. braziliensis , and 708 protein structures and 7391 protein interactions for L. infantum . (biomedcentral.com)
- The present study allowed to demonstrate the importance of integrating different methodologies of interaction prediction to increase the coverage of the protein interaction of the studied protocols, besides it made available protein structures and interactions not previously reported. (biomedcentral.com)
- During viral infection, the ORF55 protein exerts its biological function through interactions with host proteins. (biomedcentral.com)
- Secondary proteins are local folded structures within a polypeptide due to the interactions between atoms of the backbone. (crimsonpublishers.com)
- Our understanding of the atomic level interactions that define specific biological mechanisms have led to the development of applications for drug repositioning and tools for the synthetic design of nucleic acid self-assembling structures. (ukm.my)
- Tertiary structure is formed by interactions among amino acid side chains and involves weak interactions including hydrophobic / hydrophilic interactions and hydrogen bonds, ionic bonds, and covalent bonds such as disulfide bridges formed between two cysteine residues. (customuniversitypapers.com)
Homologous proteins2
- Their work concluded that the overall structural changes between two homologous proteins were proportional to their sequence differences. (biomedcentral.com)
- It was then estimated that homologous proteins aligning with less than 20% sequence identity could have large structural differences [ 14 ]. (biomedcentral.com)
Globular6
- There are three ordered layers to destrin which is a globular protein. (wikipedia.org)
- Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. (embl.de)
- Microtubules , important in cell division and structures of flagella and cilia (among other things), are composed of globular structural proteins. (biochemden.com)
- The human protein structure consists of a globular domain with three α-helices and a two-strand antiparallel β-sheet, an NH2-terminal tail, and a short COOH-terminal tail. (biolegend.com)
- Domains with globular structures are usually compact and by generalization for domains, these are also considered to fold individually, and form superfamilies with numerous similar members. (crimsonpublishers.com)
- It is evident that not all domains with a globular structure are the sole composing units that are functional for a protein. (crimsonpublishers.com)
Amino acid seq2
- The structural comparison of binding sites is especially useful when applied on distantly related proteins as a comparison solely based on the amino acid sequence is not sufficient in such cases. (uni-marburg.de)
- Prion (PrP) is highly conserved through mammals and comparison between primates ranges from 92.9-99.6% similarity in amino acid sequence. (biolegend.com)
Residues4
- These proteins have 87 to 128 amino-acid residues. (embl.de)
- Sequence alignment and structural analysis suggest that the residues in the WPD loop, especially the amino acid following Asp421, are critical for the movement of WPD loop on binding substrates and the specific activity of protein-tyrosine phosphatases. (umassmed.edu)
- Results: Based on the entropy plot, 3 hypervariable regions (HVR) observed along E2 protein located in residues 133-135, 256-260 and 279-281. (mdm2-inhibitors.com)
- Substitutional mutations of Cys and Trp residues in the MPBR domain suggest that these residues collectively, but not individually, contribute to the protein structure and, indirectly, to ligand binding. (edu.hk)
Computational3
- Based on this perspective, this study presents an integration of computational methodologies, protein network predictions and comparative analysis of the protozoan species Leishmania braziliensis and Leishmania infantum . (biomedcentral.com)
- Many computational studies are made to obtain structural information pertaining to the function of proteins. (crimsonpublishers.com)
- In these studies, a meaningful evolutionary relation can be obtained by computational study of the protein structures. (crimsonpublishers.com)
Sequences6
- Our method considers a variety of features including protein sequences, gene co-expression, functional association, and phylogenetic profiles. (nature.com)
- Students will be introduced to biological sequence data (DNA and protein sequences, whole genomes, learn to access major sequence databases and use a variety of web-based services. (uit.no)
- basic concepts of sequence alignment: local and global alignments, Needleman and Wunsch, Smith and Waterman algorithms for pairwise alignments, gap penalties, use of pairwise alignments for analysis of Nucleic acid and protein sequences and interpretation of results Multiple sequence alignments (MSA): the need for MSA, basic concepts of various approaches for MSA (e.g. progressive, hierarchical etc. (entrance.net.in)
- Nucleotide sequences of PCR amplicons showed 99%-100% similarity to IHHNV isolates from Latin America and Asia. (cdc.gov)
- We source our data from public repositories such as GenBank and the Protein Data Bank as well as by generating internal data such as genome sequences, transcriptome sequences and methylome sequences from specific experiments. (ukm.my)
- Figure 1: The amino acid sequences for three small proteins. (customuniversitypapers.com)
Helices2
- The subsequent structure calculations showed the presence of two well defined helices, from Ser-3 to Gly-12 and from Asp-17 to Thr-33, connected by a flexible linker. (uni-regensburg.de)
- Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. (embl.de)
Peptides4
- Conclusion】 TLR4 gene in Cygnus olor was closely related to Anser anser and Anser cygnoides ,with obvious codon species selectivity,and contained 6 consecutive rare codons.TLR4 protein had transmembrane domains and signal peptides,and was closely related to innate immune response,signal transduction and stress response. (chvm.net)
- Generally, peptides tend to be linear though lariat structures are observed. (vedantu.com)
- Due to their large surface area and ability to interact with proteins and peptides, graphene oxides offer valuable physiochemical and biological features for biomedical applications and have been successfully employed for optimizing scaffold architectures for a wide range of organs, from the skin to cardiac tissue. (mdpi.com)
- Comparing the peptides to the National Center for Biotechnology Information database revealed four potential interacting proteins. (biomedcentral.com)
Complexes4
- Furthermore, chromatophore-localized biosynthetic pathways as well as multiprotein complexes include proteins of dual genetic origin, suggesting that mechanisms evolved that coordinate gene expression levels between chromatophore and nucleus. (frontiersin.org)
- MMDB and VAST+: tracking structural similarities between macromolecular complexes. (nih.gov)
- The non-structural protein NSP2 of rotavirus, which exhibits nucleoside triphosphatase, single-stranded RNA binding, and nucleic-acid helix-destabilizing activities, is a major component of viral replicase complexes. (nih.gov)
- Systematic characterization of the protein interaction network and protein complexes in Saccharomyces cerevisiae using tandem affinity purification and mass spectrometry. (leibniz-fli.de)
Features of proteins1
- Many key features of proteins can be found in these compact units. (crimsonpublishers.com)
Functional6
- Moreover, binding site comparisons are used as an idea generator for bioisosteric replacements of individual functional groups of the newly developed drug and to unravel the function of hitherto orphan proteins. (uni-marburg.de)
- We present here the X-ray structure of the functional octamer of NSP2 determined to a resolution of 2.6 A. The NSP2 monomer has two distinct domains. (nih.gov)
- The structure provides evidence that this protein is functional as a dimer and that the dual specificity for MTA and AdoHcy results from the truncation of a helix. (elsevierpure.com)
- Proteins are composed of functional units and carry out their functions primarily through their constituent domains which are the independent folding groups. (crimsonpublishers.com)
- The data based on the sequence and three-dimensional surface information are used to categorize proteins in various functional conservation sub-types [5]. (crimsonpublishers.com)
- According to Pevsner, "Functional genomics is the genome-wide study of the function of DNA (including genes and nongenic elements) as well as the nucleic acid and protein products encoded by DNA. (darwinscollapse.com)
Catalytic domain3
- The crystal structures of the protein-tyrosine phosphatase SHP-1 catalytic domain and the complex it forms with the substrate analogue tungstate have been determined and refined to crystallographic R values of 0.209 at 2.5 A resolution and 0.207 at 2.8 A resolution, respectively. (umassmed.edu)
- In contrast to the conformational changes observed in the crystal structures of PTP1B and Yersinia PTP, the WPD loop (Trp419-Pro428) in the catalytic domain of SHP-1 moves away from the substrate binding pocket after binding the tungstate ion. (umassmed.edu)
- This entry represents the catalytic domain of UCH proteins of the UBP1 group. (embl.de)
Viral4
- We discovered that just half from the contaminated monocytes express viral proteins on the RG14620 surface area [2]. (conferencedequebec.org)
- In the cells that perform exhibit viral proteins, these proteins are internalised upon antibody addition through an extremely effective and fast procedure leading to FIPV-infected cells without aesthetically detectable viral proteins on the plasma membrane [3]. (conferencedequebec.org)
- The 3rd dynamin-independent internalisation pathway was provided in our prior work and may be the pathway by which viral surface area portrayed proteins in FIPV contaminated monocytes are internalised. (conferencedequebec.org)
- Rotavirus viral protein (VP) 7 (G) and VP4 (P) were admitted and prospectively until hospital discharge. (cdc.gov)
Abstract1
- abstract = "L75F-TrpR is a temperature-sensitive mutant of the tryptophan repressor protein of Escherichia coli in which surface-exposed residue leucine 75 in the DNA binding domain is replaced with phenylalanine. (princeton.edu)
Functionally1
- The possibility of persistent folds present in different domains can be observed in similar or even dissimilar proteins, structurally or functionally [2]. (crimsonpublishers.com)
Polypeptide chain1
- The tertiary structure is considered the 3-dimensional structure of a polypeptide chain. (vedantu.com)
Orphan proteins1
- Instead we identified several expanded groups of short chromatophore-targeted orphan proteins. (frontiersin.org)
Quantitative1
- Email: [email protected] yPresented at the 14th International Workshop on Quantitative Structure-Activity Relationships in Environmental and Health Sciences (QSAR2010), 24-28 May 2010, Montreal, Canada. (cdc.gov)
Fold7
- Cysteine peptidases can be grouped into fourteen different clans, with members of each clan possessing a tertiary fold unique to the clan. (embl.de)
- Clan CA includes proteins with a papain-like fold. (embl.de)
- Clan CE includes proteins with an adenain-like fold. (embl.de)
- In particular, in terms of alignment accuracy measured with TM-score, ThreaderAI outperforms HHpred, CNFpred, and CEthreader by 56, 13, and 11%, respectively, on template-query pairs at the similarity of fold level from SCOPe data. (biomedcentral.com)
- The third and most remarkable level of proteins is the 3rd fold. (crimsonpublishers.com)
- Controversies over the structure-function relation exist among biologists but this claim is more accepted that most domains that share the same fold are associated with a single function [4]. (crimsonpublishers.com)
- In particular, the residue pairs C166 and C261, C166 and W198, and C180 and W198 were found to be essential for the structure fold and consequent ligand binding. (edu.hk)
Polypeptides3
- Many proteins, such as haemoglobin, are formed from one or more polypeptides. (biochemden.com)
- When two or more polypeptides bond, then proteins are formed. (vedantu.com)
- Polypeptides and their specific amino acid groups have similarities in structure, but they are linked by electron-sharing bonds or covalent bonds. (vedantu.com)
Methods9
- In the present work, accelerated methods for the comparison of protein binding sites as well as an extended procedure for the assessment of ligand poses in protein binding sites are presented. (uni-marburg.de)
- Methods for the assessment of ligand poses in protein binding sites are also used in the early phase of drug development within docking programs. (uni-marburg.de)
- Each of these experimental methods produces imperfect data that are insufficient to elucidate a three-dimensional structure with complete certainty. (iucr.org)
- We evaluated our methods both in generating accurate template-query alignment and protein threading. (biomedcentral.com)
- Experimental results show that ThreaderAI outperforms currently popular template-based modelling methods HHpred, CNFpred, and the latest contact-assisted method CEthreader, especially on the proteins that do not have close homologs with known structures. (biomedcentral.com)
- Inspired by the success of non-linear models in TBM methods, we would like to study if we can improve TBM methods' model accuracy using more advanced neural network architecture such as deep residual network which has proven very successful in protein residue-residue contacts prediction. (biomedcentral.com)
- 2021). Graph Theoretical Methods And Workflows For Searching And Annotation Of Rna Tertiary Base Motifs And Substructures. (ukm.my)
- Methods A prospective observational study was conducted from April 1, 2019, to December 31, 2019, in the Pulmonology department of a tertiary care hospital in Pakistan. (preprints.org)
- Similarly to the studies carried out two decades ago for proteins, which gave the fundamental grounds for developing comparative protein structure prediction methods, we are now able to quantify the relationship between sequence and structure conservation in RNA. (biomedcentral.com)
Ribosome2
Interact1
Evolutionary2
- Explain how this method may be used to determine structural relatedness of a protein in different species, and perhaps evolutionary relationships among species. (customuniversitypapers.com)
- It was back in the eighties when Chothia and Lesk first quantified such evolutionary relationship for proteins [ 12 - 14 ]. (biomedcentral.com)
Cellular2
- PPIs are essential for individual protein functions, forming various cellular pathways, and are also involved in the development of diseases. (nature.com)
- This pathway may be utilized by cellular prion proteins [13] also. (conferencedequebec.org)
Genes3
- These protein kinases correspond to alternatively spliced isoforms derived from the JNK1, JNK2 and JNK3 genes. (umassmed.edu)
- Conclusion】 The expression trends of ADAMTS 1, PI 3 K and A k t genes and proteins were consistent and showed a positive correlation in ovary and granulosa cells of Mongolian sheep,suggested that ADAMTS 1 gene played an important role in twin birth of Mongolian sheep mediated by PI3K/Akt signaling pathway. (chvm.net)
- This group of genes code for proteins found on the surfaces of cells that help the immune system recognize foreign substances. (medscape.com)
Rotavirus1
Membrane6
- Here we show by mass spectrometric analyses of enriched insoluble protein fractions that, unexpectedly, nucleus-encoded transporters are not inserted into the chromatophore inner envelope membrane. (frontiersin.org)
- We hypothesize that these proteins are involved in modulating membrane permeability. (frontiersin.org)
- Endocytic trafficking dynamically regulates neuronal plasma membrane protein presentation and activity, and plays a central role in excitability and plasticity. (umassmed.edu)
- Over the course of my dissertation research I investigated endocytic mechanisms regulating two neuronal membrane proteins: the anesthetic-activated potassium leak channel, KCNK3, as well as the psychostimulant-sensitive dopamine transporter (DAT). (umassmed.edu)
- Taken together, these results demonstrate that novel, non-classical endocytic mechanisms dynamically control the plasma membrane presentation of these two important neuronal proteins. (umassmed.edu)
- Deciphering soluble and membrane protein function using yeast systems. (leibniz-fli.de)
Synthesis1
- Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. (embl.de)
Transmembrane1
- Comparative evaluation for consensus B-cell epitopes relating to transmembrane topology, predicated on physico-chemical and machine learning strategies uncovered that residue 231- 296 (NH2- EARLVPLILLLLWWWVNQLAVLGLPAVEAAVAGEVFAGPALSWCLGLPVVSMILGLANLVLYFRWL-COOH) is certainly most reliable and possible B cell epitope for E2 proteins. (mdm2-inhibitors.com)
Substructures1
- A Geometric Algorithm to Find Small but Highly Similar 3D Substructures in Proteins. (uni-marburg.de)
Specific three-dimensional1
- Transferring information from genotype to phenotype occurs through the creation of amino acids which are linearly sequenced in a physicochemical manner that produces specific three-dimensional structures. (darwinscollapse.com)
Microtubules1
- Long-range transportation to get in the cell periphery towards the cell center works over microtubules and it is mediated with the electric motor proteins dynein and kinesin. (conferencedequebec.org)
Differences3
- Despite their many similarities, wild-type and mutant proteins display significant chemical shift differences, one cluster of which is in the B-C turn, too distant to be ascribed solely to ring current effects from Phe75. (princeton.edu)
- To accomplish this, my research group studies the structure, function and evolution of biological macromolecules to compare how the atomic level differences can result in different functions by effecting regulatory or mechanistic changes. (ukm.my)
- This article looks at the similarities and differences between Parkinson's disease and Huntington's disease and considers how both compare with Alzheimer's disease . (medicalnewstoday.com)
Mechanisms2
- It makes possible to elucidate disease mechanisms, to predict protein functions and to select promising targets for drug development. (biomedcentral.com)
- 2022). Functions And Mechanisms Of Protein Disulfide Isomerase Family In Cancer Emergence. (ukm.my)
Macromolecular1
- Here, the refinement of macromolecular structures using REFMAC 5 and related tools distributed as part of the CCP 4 suite is discussed. (iucr.org)
Backbone1
- bond is the backbone of the proteins. (biochemden.com)
Alignment2
- However, accurate template-query alignment and template selection are still very challenging, especially for the proteins with only distant homologs available. (biomedcentral.com)
- TBM method predicts the structure of query protein by modifying the structural framework of its homologous protein with known structure in accordance with template-query alignment. (biomedcentral.com)
Interaction data3
- In addition, we trained a machine-learning algorithm (Gradient Boosting) using docking information performed on a curated set of positive and negative protein interaction data. (biomedcentral.com)
- The predicted networks were integrated to protein interaction data already available, analyzed using several topological features and used to classify proteins as essential for network stability. (biomedcentral.com)
- Several methodologies, capable of handling and generating large-scale protein interaction data, have been employed, such as the experimental techniques of yeast two-hybrid and affinity purification coupled with mass spectrometry [ 17 ]. (biomedcentral.com)
Stable1
- Fault tolerance in protein interaction networks: stable bipartite subgraphs and redundant pathways. (leibniz-fli.de)
Enzymes2
Retrieval1
- Efficient Similarity Retrieval for Protein Binding Sites based on Histogram Comparison. (uni-marburg.de)
Ribosomal2
- A number of eukaryotic and archaebacterial large subunit ribosomal proteins can be grouped on the basis of sequence similarities. (embl.de)
- Ribosomal protein L31e, which is present in archaea and eukaryotes, binds the 23S rRNA and is one of six protein components encircling the polypeptide exit tunnel. (embl.de)
Pathways1
- A PPI network provides crucial information on how biological pathways are structured and coordinated from individual protein functions. (nature.com)
Isoforms2
- The protein kinase activity of these JNK isoforms was measured using the transcription factors ATF2, Elk-1 and members of the Jun family as substrates. (umassmed.edu)
- Comparison of the binding activity of the JNK isoforms demonstrated that the JNK proteins differ in their interaction with ATF2, Elk-1 and Jun transcription factors. (umassmed.edu)
Biological function1
- Accurate prediction of protein structure is fundamentally important to understand biological function of proteins. (biomedcentral.com)
Hemolymph2
- As one such antiapoptotic component in silkworm hemolymph, the 30 K protein has been studied widely [ 6 , 7 ]. (hindawi.com)
- A recent study showed that another protein in silkworm hemolymph, storage protein 2 (SP2), can also inhibit staurosporine-induced HeLa cell apoptosis and ROS generation [ 8 ]. (hindawi.com)
Data7
- The similarity in behaviour of hPTHrP(1-34) and the N-terminal fragments of PTH under various solution conditions is shown from the 1H NMR data presented here and an extensive review of the literature data. (uni-regensburg.de)
- To achieve this, the refinement procedure optimizes a posterior conditional probability distribution of model parameters, including atomic coordinates, atomic displacement parameters ( B factors), scale factors, parameters of the solvent model and twin fractions in the case of twinned crystals, given observed data such as observed amplitudes or intensities of structure factors. (iucr.org)
- The data provide evidence that this point mutation exerts local effects on structure and stability in the DNA binding domain, and propagates long-range effects through the tertiary structure. (princeton.edu)
- We collected sequence data of the therapeutic proteins from Drug Bank and KEGG databases, then grouped different mechanistic and therapeutic classes. (crimsonpublishers.com)
- By increasing protein data generation, it is shown that some similar protein groups may further present diversity among themselves. (crimsonpublishers.com)
- In building such structure-function correlations, the sequence data alone is not enough, and the scientists have to look into three-dimensional information as well. (crimsonpublishers.com)
- PPI spider: a tool for the interpretation of proteomics data in the context of protein-protein interaction networks. (leibniz-fli.de)
Function prediction1
- Matching of structural motifs using hashing on residue labels and geometric filtering for protein function prediction. (uni-marburg.de)
Enzyme1
- Conclusions: Although the sequence of E. coli MTA/AdoHcy nucleosidase has almost no identity with any known enzyme, its tertiary structure is similar to both the mammalian (trimeric) and prokaryotic (hexameric) purine nucleoside phosphorylases. (elsevierpure.com)
Kinases2
- The insulin receptor (IR) and JAK1 tyrosine kinases and STAT3 can serve as direct substrates for the T-cell protein tyrosine phosphatase (TCPTP). (diabetesjournals.org)
- Classification of nonenzymatic homologues of protein kinases. (leibniz-fli.de)
Encodes2
- This gene encodes the actin depolymerizing protein that severs actin filaments (F-actin) and binds to actin monomers (G-actin). (wikipedia.org)
- This RNA includes an open up reading body (ORF) which encodes polyprotein with about 2900 proteins duration. (mdm2-inhibitors.com)