Runx1 core binding factors. Medical search. Frequent questions

A rearrangement (translocation) of genetic material involving the RUNX1 gene is found in approximately 7 percent of individuals with a form of blood cancer known as acute myeloid leukemia (AML). (medlineplus.gov)
Translocations and other types of mutations involving the RUNX1 gene have been associated with different types of leukemia and related blood disorders, including acute lymphoblastic leukemia (ALL), chronic myelomonocytic leukemia (CMML), familial platelet disorder with predisposition to acute myeloid leukemia, and myelodysplastic syndromes (MDS). (medlineplus.gov)
Transcription factor RUNX1 promotes survival of acute myeloid leukemia cells. (medlineplus.gov)
Core binding factor (CBF)-positive acute myeloid leukemia (AML) presents a favorable prognosis, except for patients with KIT mutation, especially D816 mutation. (nih.gov)
Runt-related transcription factor 1 (RUNX1) also known as acute myeloid leukemia 1 protein (AML1) or core-binding factor subunit alpha-2 (CBFA2) is a protein that in humans is encoded by the RUNX1 gene. (wikipedia.org)
In general, somatic SETBP1 mutations have a significant clinical impact on the outcome as poor prognostic factor, due to downstream HOXA-pathway as well as associated aggressive types of chromosomal defects (-7/del(7q) and i(17q)), which is consistent with wild-type SETBP1 activation in aggressive types of acute myeloid leukemia and leukemic evolution. (nih.gov)
18. Repression of vascular endothelial growth factor expression by the runt-related transcription factor 1 in acute myeloid leukemia. (nih.gov)
Somatic RUNX1 mutations are found in approximately 10% of patients with de novo acute myeloid leukemia (AML), but are more common in secondary forms of myelodysplastic syndrome (MDS) or AML. (molcells.org)
CSF3R Mutations are frequently associated with abnormalities of RUNX1, CBFB, CEBPA, and NPM1 genes in acute myeloid leukemia. (cdc.gov)
Prospective evaluation of prognostic impact of KIT mutations on acute myeloid leukemia with RUNX1-RUNX1T1 and CBFB-MYH11. (cdc.gov)
More recently, Dr. Liu's group made the novel observation that Cbfb-MYH11 induces acute myeloid leukemia (AML) without dominant repression of Runx1 , which was previously believed to be the only function of this fusion gene (Kamikubo et al. (nih.gov)
2011, RUNX1 mutations in acute myeloid leukemia: results from a comprehensive genetic and clinical analysis from the AML study group. (wustl.edu)
RUNX1 mutations are associated with poor outcome in younger and older patients with cytogenetically normal acute myeloid leukemia and with distinct gene and MicroRNA expression signatures. (cdc.gov)
High IL2RA mRNA expression is an independent adverse prognostic biomarker in core binding factor and intermediate-risk acute myeloid leukemia. (atlasgeneticsoncology.org)

In fact, the RUNX family is often referred to as α-subunits, together with binding of a common β-subunit CBFβ, RUNX can behave as heterodimeric transcription factors collectively called the core binding factors (CBFs). (wikipedia.org)
RUNX1 , also known as core binding factor subunit alpha ( CBFA2 ), is a transcription factor (TF) and an essential component of the core binding factor complex that plays a key role in hematopoiesis [ 1 ]. (nature.com)
9. Downregulation of TREM-like transcript-1 and collagen receptor α2 subunit, two novel RUNX1-targets, contributes to platelet dysfunction in familial platelet disorder with predisposition to acute myelogenous leukemia. (nih.gov)
A transcription factor that dimerizes with the cofactor CORE BINDING FACTOR BETA SUBUNIT to form core binding factor. (nih.gov)
RUNX members modulate the transcription of their target genes through recognizing the core consensus binding sequence 5'-TGTGGT-3', or very rarely, 5'-TGCGGT-3', within their regulatory regions via their runt domain, while CBFB is a non-DNA-binding regulatory subunit that allosterically enhances the sequence-specific DNA-binding capacity of RUNX. (nih.gov)
The surprise find is the presence of a protein called core-binding factor subunit beta (CBFB) and the absence of its partner runt-related transcription factor 1 (RUNX1). (rxwiki.com)
subunit world is all the humans located for core. (erik-mill.de)

Like other transcription factors, the RUNX1 protein attaches (binds) to specific regions of DNA and helps control the activity of particular genes. (medlineplus.gov)
The RUNX1 protein turns on (activates) genes that help control the development of blood cells (hematopoiesis). (medlineplus.gov)
It belongs to the Runt-related transcription factor (RUNX) family of genes which are also called core binding factor-α (CBFα). (wikipedia.org)
In the nucleus, Akt phosphorylates a transcription factor called Nur77, thus blocking its ability to activate transcription of proapoptotic genes. (medscape.com)
Transcription factors, proteins that bind to the regulatory sequences of target genes, compose the largest class of oncogenes identified in pediatric tumors. (medscape.com)
11. Decreased platelet expression of myosin regulatory light chain polypeptide (MYL9) and other genes with platelet dysfunction and CBFA2/RUNX1 mutation: insights from platelet expression profiling. (nih.gov)
RUNX1 promotes cell growth in human T-cell acute lymphoblastic leukemia by transcriptional regulation of key target genes. (cdc.gov)
Así, fue posible definir que solo se atenderá las cuestiones relacionadas con la edad pediátrica, dejando para un tratamiento posterior aquellas variantes detectadas en genes que sean accionables en edad adulta. (bvsalud.org)
En estos últimos años el desarrollo de las tecnologías de secuenciación masiva han provocado una explosión en el descubrimiento de nuevos genes responsables de AIDs monogénicas. (bvsalud.org)
Two genes, CBFB and RUNX1 , which encode proteins (CBFb and RUNX1, respectively) that form a dimer for DNA binding and gene expression regulation, are frequent targets of such chromosome abnormalities. (nih.gov)
Most of Dr. Liu's work focuses on these two genes and the core binding factor (CBF) leukemia, a subset of leukemia caused by chromosome abnormalities in these two genes. (nih.gov)
Dr. Liu's group, with the help of the NHGRI Zebrafish Core, headed by Dr. Raman Sood, has used zebrafish to study the roles of several transcription factor genes in hematopoiesis, such as runx1 , cbfb , and gata1 (Blake et al. (nih.gov)
The perturbation of this rheostat, using a proteasomal inhibitor, results in an increase in Runx1 and Smad6 levels that can be directly attributed to increased Runx1 binding to tissue-specific regulatory elements of these genes. (ox.ac.uk)
Se asocia a factores de transcripción de unión a ADN, a otras proteínas represoras y a HISTONA ACETILTRANSFERASAS para reprimir la expresión de genes implicados en el crecimiento y la diferenciación celular como la METALOPROTEINASA 7 DE LA MATRIZ y el factor de transcripción TCF12. (bvsalud.org)
It associates with DNA -binding transcription factors, other repressor proteins, and HISTONE ACETYLTRANSFERASES to repress expression of genes involved in cell growth and differentiation such as MATRIX METALLOPROTEINASE 7 and TCF12. (bvsalud.org)
HN - 2006(1998) MH - Activating Transcription Factor 1 UI - D051697 MN - D12.776.260.108.61.500 MN - D12.776.930.127.61.500 MS - An activating transcription factor that regulates expression of a variety of genes including C-JUN GENES and TRANSFORMING GROWTH FACTOR BETA2. (nih.gov)
The 126 kb intergenic region on chr6q23 is between the genes which is a member of the GTP-binding elongation factor family with no known association with erythroid-specific traits, and which encodes for the transcription factor c-MYB. (e-core.org)
For instance, the actin filament binding activity of EGFR might not be an enriched GO term and vice versa, a globally enriched unspecific GO term such as "protein binding" might not be relevant for all input genes with that annotation. (biomedcentral.com)
Transcriptomic analysis of these populations identifies Runx1-regulated genes and shows that HE initially expresses arterial markers at similar levels to ARE. (ox.ac.uk)
Runx1-/- mutants fail to downregulate arterial genes in the HE, which remains integrated within the DA, suggesting that Runx1 represses the pre-existing arterial programme in HE to allow progression towards the haematopoietic fate. (ox.ac.uk)
The Runx family of transcription factors supports cell fate determination, cell cycle regulation, global protein synthesis control, and genetic as well as epigenetic regulation of target genes. (umassmed.edu)
While Runx2 is known to control genes that contribute to chondrocyte hypertrophy, the functions of Runx1 and Runx3 during chondrogenesis and in cartilage tissue have been less well studied. (umassmed.edu)
To further address Runx1 function and identify downstream targets of Runx proteins, a promoter analysis of genes that are known to be either downregulated or upregulated during chondrocyte maturation was done. (umassmed.edu)
These studies found that many of these genes have 1 or more Runx binding sites within 2kb of their transcription start site, indicating that they are potential downstream Runx target genes. (umassmed.edu)
Runx proteins have been shown to epigenetically regulate their target genes by remaining bound to them throughout mitosis, "poising" them for transcription upon exit from mitosis. (umassmed.edu)
The hypothesis that Runx proteins also function by remaining bound to their target genes throughout mitosis in chondrocytes was tested. (umassmed.edu)
These AETFC components stabilize the complex through multivalent interactions, provide multiple DNA-binding domains for diverse target genes, co-localize genome wide, cooperatively regulate gene expression, and contribute to leukaemogenesis. (cornell.edu)

The RUNX1 gene provides instructions for making a protein called runt-related transcription factor 1 (RUNX1). (medlineplus.gov)
RUNX1 is a transcription factor that regulates the differentiation of hematopoietic stem cells into mature blood cells. (wikipedia.org)
As a transcription factor (TF), its DNA binding ability is encoded by the runt domain (residues 50 - 177), which is homologous to the p53 family. (wikipedia.org)
Nusslein-Volhard and Wieschaus discovered the transcription factor RUNX in a screen that was conducted to identify mutations that affect segment number and polarity in Drosophila. (wikipedia.org)
Although the protein encoded by runt was demonstrated to exhibit nuclear translocation, it was not yet established that this protein is a transcription factor. (wikipedia.org)
This translocation is present in 20% of pre-B-cell leukemias and generates a chimeric transcription factor known as E2a-Pbx1, a fusion protein containing the strong transactivation domains of E2a and the DNA binding domain of Pbx1. (medscape.com)
pRB functions as a negative regulatory transcription factor during the G1 to S phase cell cycle transition. (medscape.com)
p53 is a transcription factor whose expression is increased by DNA damage and blocks cell division at the G1 phase of the cell cycle to allow DNA repair. (medscape.com)
14. Early growth response transcription factor EGR-1 regulates Galphaq gene in megakaryocytic cells. (nih.gov)
The oncogenic transcription factor Runx1 is required for the specification of definitive hematopoietic stem cells (HSC) in the developing embryo. (ox.ac.uk)
Taken together, we describe a scenario in which a key hematopoietic transcription factor controls its own expression levels by transcriptionally controlling its controller. (ox.ac.uk)
The transcription factor Runx1 is a pivotal regulator of definitive hematopoiesis in mouse ontogeny. (ox.ac.uk)
Transforming growth factor beta regulates clusterin gene expression via modulation of transcription factor c-Fos. (musc.edu)
A stable transcription factor complex nucleated by oligomeric AML1-ETO controls leukaemogenesis. (cornell.edu)
AML1-ETO, a fusion protein generated by the t(8;21) translocation in acute myeloid leukaemia, is a transcription factor implicated in both gene repression and activation. (cornell.edu)
Here we show that, in human leukaemic cells, AML1-ETO resides in and functions through a stable AML1-ETO-containing transcription factor complex (AETFC) that contains several haematopoietic transcription (co)factors. (cornell.edu)
The embryonic transcription factor DUX4 was recently characterized as a suppressor of interferon-γ signaling and antigen presentation that is aberrantly expressed in a small subset of primary tumors. (elifesciences.org)

This protein interacts with another protein called core binding factor beta or CBFβ (produced from the CBFB gene), which helps RUNX1 bind to DNA and prevents it from being broken down. (medlineplus.gov)
The full-length RUNX1 protein is encoded by 12 exons. (wikipedia.org)
These domains are necessary for RUNX1 to mediate DNA binding and protein-protein interactions respectively. (wikipedia.org)
The protein RUNX1 is composed of 453 amino acids. (wikipedia.org)
Soon after the discovery of the drosophila runt protein and the human RUNX1 protein, RUNX1's function was discovered. (wikipedia.org)
Runx1 was purified as a sequence-specific DNA-binding protein that regulated the disease specificity of the Moloney murine Leukemia virus. (wikipedia.org)
SETBP1 is a SET-binding protein regulating self-renewal potential through HOXA-protein activation. (nih.gov)
3. Platelet protein kinase C-theta deficiency with human RUNX1 mutation: PRKCQ is a transcriptional target of RUNX1. (nih.gov)
the resulting fusion protein (AML1-ETO or RUNX1-RUNX1T1) plays a critical role in leukemogenesis. (bvsalud.org)
HN - 2006(1981) BX - Cofilins MH - Actin-Related Protein 2 UI - D051377 MN - D5.750.78.730.246.500 MN - D12.776.220.525.246.500 MS - A PROFILIN binding domain protein that is part of the Arp2-3 complex. (nih.gov)
Arp2-3 complex binds WASP PROTEIN and existing ACTIN FILAMENTS, and it nucleates the formation of new branch point filaments. (nih.gov)
HN - 2006 BX - Arp2-3 Complex MH - Actin-Related Protein 3 UI - D051378 MN - D5.750.78.730.246.750 MN - D12.776.220.525.246.750 MS - A component of the Arp2-3 complex that is related in sequence and structure to ACTIN and that binds ATP. (nih.gov)
It is expressed at higher levels than ARP2 PROTEIN and does not contain a PROFILIN binding domain. (nih.gov)
MicroRNAs (miRNAs) are a group of small, non-coding RNAs that regulate protein-coding gene function at the post-transcriptional level by binding to complementary sites on target mRNAs in the 3′UTR ( Ambros, 2004 ). (peerj.com)
Runx factors, which regulate rates of global protein synthesis, are expressed in both proliferating and hypertrophic chondrocytes. (umassmed.edu)
NICD1, which not is a skeletal focus, can be controlled by docking to the hormone-bound addition 1-alpha( HIF1A) which serves in the protein when amine homodimers are progressive. (evakoch.com)
download carnivorous III plasma is read associated with signal promoter protein in binding adapters, with the hormone III on the gene, including a experimentally-verified ubiquitin( Fleischmajer et al. (erik-mill.de)
One major area of interest is a recently identified signaling pathway whereby TGFß regulates epithelial-mesenchymal transitions (EMT) and metastasis through a post-transcriptional mechanism involving the regulation of an RNA binding protein, heterogeneous ribonucleoprotein E1 (hnRNP E1). (musc.edu)
Smad3 potentiates transforming growth factor beta (TGFbeta )-induced apoptosis and expression of the BH3-only protein Bim in WEHI 231 B lymphocytes. (musc.edu)
Crystallographic analysis of the NHR2-N2B complex reveals a unique interaction pattern in which an N2B peptide makes direct contact with side chains of two NHR2 domains as a dimer, providing a novel model of how dimeric/oligomeric transcription factors create a new protein-binding interface through dimerization/oligomerization. (cornell.edu)
Repression of 24p3R expression by BCR ABL occurs through a Runx protein binding switch As described earlier, BCR ABL represses 24p3R expression. (hdac-inhibitors.com)
To rule out the possibility that the effects we observed on imatinib treatment resulted from inhibition of protein kinases other than BCR ABL, we monitored binding of Runx1 and Runx3 to the 24p3R promoter in 32D cells expressing the imatinib resistant BCR ABL mutant. (hdac-inhibitors.com)
Published functional studies demonstrate this variant affects GTP binding activity of the KRAS protein (Chen et al. (varsome.com)

Together, these proteins form one version of a complex known as core binding factor (CBF). (medlineplus.gov)
RUNX proteins form a heterodimeric complex with CBFβ which confers increased DNA binding and stability to the complex. (wikipedia.org)
The transcription of RUNX1 is regulated by 2 enhancers (regulatory element 1 and regulatory element 2), and these tissue specific enhancers enable the binding of lymphoid or erythroid regulatory proteins, therefore the gene activity of RUNX1 is highly active in the haematopoietic system. (wikipedia.org)
13. RUNX1, but not its familial platelet disorder mutants, synergistically activates PF4 gene expression in combination with ETS family proteins. (nih.gov)
AN - coordinate IM with ADENOMA (IM) HN - 2006 BX - Corticotroph Adenoma BX - Pituitary Adenoma, ACTH-Secreting BX - Pituitary Corticotropin-Secreting Adenoma MH - Actin Capping Proteins UI - D051344 MN - D5.750.78.730.32 MN - D12.776.220.525.32 MS - Actin capping proteins are cytoskeletal proteins that bind to the ends of ACTIN FILAMENTS to regulate actin polymerization. (nih.gov)
HN - 2006(1981) BX - Actin-Capping Proteins MH - Actin Depolymerizing Factors UI - D051339 MN - D5.750.78.730.212 MN - D12.776.220.525.212 MS - A family of low MOLECULAR WEIGHT actin-binding proteins found throughout eukaryotes. (nih.gov)
The goals of this project were to characterize expression of Runx proteins in articular cartilage and differentiating chondrocytes and to determine the contribution of Runx1 to osteoarthritis (OA). (umassmed.edu)
It was demonstrated by immunofluorescense imaging of Runx proteins on metaphase chromosomes of ATDC5 cells, that Runx2 remains bound to chromosomes during mitosis. (umassmed.edu)
high bacteria are as proteins of pathway ATM rise, either as acids for greenhouse initiation or for the dehydrogenase of binding eIF2 disorders. (evakoch.com)
The ternary complex containing UFD1L, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. (nih.gov)
Within the AETFC complex, AML1-ETO oligomerization is required for a specific interaction between the oligomerized NHR2 domain and a novel NHR2-binding (N2B) motif in E proteins. (cornell.edu)
As the download Windows 7 Annoyances of times is to public end, defects can bind involved an phosphorylated citron of the IL1R and IL18R leading structures, capping dermatan medicine influencing to endothelial end proteins known by reverse isoforms( TLRs). (evakoch.com)
As an initial step to determine whether Runx proteins have a role in BCR ABL mediated regulation of 24p3R expression, we performed ChIP analysis for Runx1 and Runx3. (hdac-inhibitors.com)

The study patients consisted of 121 patients with CBF AML (82 patients with RUNX1/RUNX1T1 [67.8 %] and 39 patients with CBFB/MYH11 [32.2 %]) recruited from eight institutions in Korea. (nih.gov)
Forms the heterodimeric complex core-binding factor (CBF) with CBFB. (nih.gov)
To study the fusion gene CBFB-MYH11 , Dr. Liu's group generated a knock-in mouse model, which demonstrated that CBFB-MYH11 blocks normal hematopoiesis through dominant repression of Cbfb and Runx1 (Castilla et al. (nih.gov)

On transcriptional level interferon and TNF signaling were deregulated in primary RUNX1 mut CML cells and stem cell and B-lymphoid factors upregulated giving a rise to distinct phenotype. (nature.com)
6. Mechanism of platelet factor 4 (PF4) deficiency with RUNX1 haplodeficiency: RUNX1 is a transcriptional regulator of PF4. (nih.gov)
We here show that cyclin-dependent kinase 6 (Cdk6) is specifically expressed in proliferating hematopoietic progenitor cells, and that Cdk6 inhibits transcriptional activation by Runx1, but not C/EBPalpha or PU.1. (ox.ac.uk)
Vertebrate Runx1 is transcribed from 2 promoters, the distal P1 and proximal P2, which provide a paradigm of the complex transcriptional and translational control of Runx1 function. (ox.ac.uk)
Mutational analysis confirmed that the Runx binding site was required for 24p3R transcriptional activity in 32D cells. (hdac-inhibitors.com)

Since Runx transcription factors play central roles in hematopoietic, neuronal and osteogenic lineages, this novel, noncanonical Cdk6 function may control terminal differentiation in multiple tissues and cell types. (ox.ac.uk)
Analysis of the 24p3R promoter revealed the presence of a putative Runx binding site at 425 to 432 bp upstream of the transcription start site. (hdac-inhibitors.com)
Of the three Runx family members, only Runx1 and Runx3 are expressed in cells of hematopoietic origin. (hdac-inhibitors.com)

10. Mechanisms underlying platelet function defect in a pedigree with familial platelet disorder with a predisposition to acute myelogenous leukemia: potential role for candidate RUNX1 targets. (nih.gov)
Germline mutations in RUNX1 cause familial platelet disorder with associated myeloid malignancies (FPDMM, or simply FPD), an autosomal dominant disease. (nih.gov)

Using a high-throughput reverse genetic screening system they generated a fish line carrying a truncation mutation in runx1 , which led to discoveries of novel functions of the gene during hematopoiesis (Sood et al. (nih.gov)
A Runx1-Smad6 rheostat controls Runx1 activity during embryonic hematopoiesis. (ox.ac.uk)
Nonredundant roles for Runx1 alternative promoters reflect their activity at discrete stages of developmental hematopoiesis. (ox.ac.uk)

The runt domain of RUNX1 binds to the core consensus sequence TGTGGNNN (where NNN can represent either TTT or TCA). (wikipedia.org)
RUNX1 can bind DNA as a monomer, but its DNA binding affinity is enhanced by 10 fold if it heterodimerises with the core binding factor β (CBFβ), also via the runt domain. (wikipedia.org)
It contains a highly conserved DNA-binding domain known as the runt domain. (nih.gov)
Cdk6 inhibits Runx1 activity by binding to the runt domain of Runx1, interfering with Runx1 DNA binding and Runx1-C/EBPalpha interaction. (ox.ac.uk)

The translocation, written as t(8;21), combines genetic information from chromosome 21 and chromosome 8, fusing the RUNX1 gene on chromosome 21 with a gene on chromosome 8 called RUNX1T1 (also known as ETO ). (medlineplus.gov)
Transcription factors are frequently altered in leukaemia through chromosomal translocation, mutation or aberrant expression. (cornell.edu)

Somatic and germline alterations involving RUNX1 gene are commonly encountered in a variety of hematological malignancies [ 2 ]. (nature.com)

ClinGen Myeloid Malignancy Variant Curation Expert Panel recommendations for germline RUNX1 variants. (uchicago.edu)

Why secondary RUNX1 mutations are associated with sMDS/AML and how they contribute to the pathogenesis of these conditions remains largely unclear. (molcells.org)

In the t(12;21) ETV6-RUNX1 ALL, it has been reported that the aberrant RAG recombination activity mediates off-target deletions and is the driver mutagenic mechanism [ 8 ]. (nature.com)

1. RUNX1/core binding factor A2 regulates platelet 12-lipoxygenase gene (ALOX12): studies in human RUNX1 haplodeficiency. (nih.gov)
Here we show that Runx1, in conjunction with Fli1, Gata2, and Scl, directly regulates the expression of Smad6 in the aorta-gonad-mesonephros (AGM) region in the developing embryo, where HSCs originate. (ox.ac.uk)
Runx1 regulates Smad6 activity via a novel upstream enhancer, and Runx1 null embryos show reduced Smad6 transcripts in the yolk-sac and c-Kit-positive fetal liver cells. (ox.ac.uk)

The RUNX1 gene mutations associated with these diseases are somatic mutations and are not inherited. (medlineplus.gov)

Runx1 is frequently mutated in human LEUKEMIAS . (nih.gov)

purified Runx2, the homolog of Runx1. (wikipedia.org)
the binding affinity of RUNX1 and RUNX2 was significantly increased by association with CBFβ. (wikipedia.org)
15. RUNX1 and RUNX2 upregulate Galectin-3 expression in human pituitary tumors. (nih.gov)
Here, the expression pattern of Runx1 and Runx2 was characterized in normal bovine articular cartilage. (umassmed.edu)
Runx2 is expressed at higher levels in deep zone chondrocytes, while Runx1 is primarily expressed in superficial zone chondrocytes, which is the single cell layer that lines the surface of articular cartilage. (umassmed.edu)

The unfavorable impact of D816 mutation was more prominent when the analysis was confined to the RUNX1/RUNX1T1 subtype. (nih.gov)
The KIT D816 mutation demonstrated an unfavorable prognostic implication, particularly in the RUNX1/RUNX1T1 subtype. (nih.gov)

Biologically, mutant SETBP1 attenuates RUNX1 and activates MYB. (nih.gov)
Secreted transforming growth factor beta2 activates NF-kappaB, blocks apoptosis, and is essential for the survival of some tumor cells. (musc.edu)

Molecular pathogenesis of core binding factor leukemia: current knowledge and future prospects. (medlineplus.gov)
Chromosomal translocations involving the RUNX1 gene are associated with several types of leukemia including M2 AML. (wikipedia.org)
Blast-phase chronic myeloid leukemia (BP-CML) is associated with additional chromosomal aberrations, RUNX1 mutations being one of the most common. (nature.com)
High-throughput drug sensitivity and resistance testing revealed leukemia cells from RUNX1 mut patients to be highly responsive for mTOR-, BCL2-, and VEGFR inhibitors and glucocorticoids. (nature.com)
Exome sequencing identifies recurring FLT3 N676K mutations in core-binding factor leukemia. (cdc.gov)
The heterodimers bind to the core site of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL3 and GM-CSF promoters (Probable). (nih.gov)

This enhancer encompasses a 3-bp deletion polymorphism (rs66650371), which is surrounded by binding sites for erythroid-specific transcription factors TAL1/E47, GATA, RUNX1, LDB1 and KLF1, and is likely the functional motif to account for most of the effect upon HbF level by this QTL [10,12,13]. (e-core.org)

Because this genetic change affects CBF, the condition is classified as core binding factor AML (CBF-AML). (medlineplus.gov)
Because some people with a 16p12.2 microdeletion have no obvious signs or symptoms (a situation called incomplete penetrance), researchers believe that other genetic or environmental factors may also be involved. (nih.gov)
Clinical and genetic risk factors for decreased bone mineral density in Japanese patients with inflammatory bowel disease. (atlasgeneticsoncology.org)

RUNX1 was found to be rearranged in the leukemic cell DNAs from t(8;21)(q22;q22) AML patients. (wikipedia.org)

Mice embryos with homozygous mutations on RUNX1 died at about 12.5 days. (wikipedia.org)
These findings were further investigated and confirmed in CRISPR/Cas9-edited homozygous RUNX1 −/− and heterozygous RUNX1 −/mut BCR-ABL positive cell lines. (nature.com)

The results of Figure 2B show that in 32D cells, in which 24p3R is transcriptionally active, binding of Runx3 but not Runx1 could be detected at the 24p3R promoter. (hdac-inhibitors.com)
By contrast, in 32D/BCR ABL cells, in which 24p3R is transcriptionally inactive, binding of Runx1 but not Runx3 was detected at the 24p3R promoter. (hdac-inhibitors.com)
Moreover, after treatment of 32D/BCR ABL cells with imatinib, binding of Runx1 to the 24p3R promoter decreased, which was accompanied by increased Runx3 binding. (hdac-inhibitors.com)
Figure 2D shows that imatinib failed to alter the binding pattern of Runx1 and Runx3 in 32D/BCR ABL cells. (hdac-inhibitors.com)

La proteína de fusión resultante (AML1-ETO o RUNX1-RUNX1T1) juega un papel esencial en la leucemogénesis. (bvsalud.org)
AML1-ETO oligomerization, mediated by the NHR2 domain, is critical for leukaemogenesis, making it important to identify co-regulatory factors that 'read' the NHR2 oligomerization and contribute to leukaemogenesis. (cornell.edu)

The transcription factors that upregulate the expression of Runx1 also upregulate the expression of Smad6, the inhibitory Smad, which controls Runx1 activity by targeting it to the proteasome. (ox.ac.uk)

However, very little is known about the biologic relevance of alternative Runx1 promoter usage in definitive hematopoietic cell emergence. (ox.ac.uk)
In addition, the dynamic expression of P1-Runx1 and P2-Runx1 points at a requirement for Runx1 early in development, when the P2 is still the prevalent promoter in the emerging hemogenic endothelium and/or first committed hematopoietic cells. (ox.ac.uk)
The results of Figure 1C show that Stat5 bound to the 24p3 promoter and that this interaction did not occur after imatinib treatment. (hdac-inhibitors.com)
ChIP experiments revealed that both Stat5a and Stat5b were bound to Adrenergic Receptors the 24p3 promoter. (hdac-inhibitors.com)
By contrast, Stat5a but not Stat5b was bound to the control Ksr1 promoter. (hdac-inhibitors.com)
We next tested whether BCR ABL mediated activation of the JAK/STAT pathway in 32D cells was required for Stat5 binding to the 24p3 promoter and 24p3 transcription. (hdac-inhibitors.com)
Collectively, these results indicate that BCR ABL stimulates the JAK/STAT pathway, leading to activation of Stat5, which then binds to the 24p3 promoter resulting in transcription activation. (hdac-inhibitors.com)

P61959.1 MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY 1367453_at NP_446195 8.92 hsp90 co-chaperone Cdc37 Cdc37 Rattus norvegicus " Co-chaperone that binds to numerous kinases and promotes their interaction with the Hsp90 complex, resulting in stabilization and promotion of their activity. (nih.gov)
In next deficiencies style XV promotes mediated binding secreted sequence studies C1q-mediated to the alpha rise( Amenta et al. (erik-mill.de)

This association with prognosis was seen both when investigating (i) an unselected patient population as well as for patients with (ii) normal cytogenetic and (iii) core-binding factor AML. (oncotarget.com)

Here, we present a transgenic zebrafish runx1 reporter line to isolate HE and aortic roof endothelium (ARE)s, excluding non-aortic endothelium. (ox.ac.uk)

The axonemal site of NOTCH1 and the collagen Ligand-binding WD40 cell of 40kDa are different benefits of pumps in accumulation epithelial Endoplasmic development - T-ALL( Welcker and Clurman 2008). (evakoch.com)
Ligand 2-arachidonoylglycerol phosphorylates a abasic bind in NOTCH3, which stops the lysosomal thrombosis in the GM1 order of NOTCH3. (evakoch.com)

RUNX1 plays a crucial role in adult (definitive) haematopoiesis during embryonic development. (wikipedia.org)
Some cancers exhibit aberrant expression of embryonic DUX transcription factors. (elifesciences.org)

It is related in sequence and structure to ACTIN and binds ATP. (nih.gov)
For example with EGFR, identifying actin filament binding and cell division activities as being higher relevance than signal transduction and kinase activities would inform hypotheses that help prioritize downstream experiments: altering the EGFR actin-binding domain and testing for cell division phenotypes would be given more precedence than inhibiting the EGFR kinase activity. (biomedcentral.com)
USP7 industries to play the set for commitment sequence( a functional disease actin), nuclear as resulting bacteria and serving chain disabilities, pathogen-associated damage cells, an cycle in generalisation Organisations, and FBXW7 resources binding at least 20 control of the transfer's reticulum. (erik-mill.de)

In both the surface layer of normal articular cartilage, and in OA cartilage, Runx1 expression by IF co-localized with markers of mesenchymal progenitor cells, as well as markers of proliferation Ki-67 and PCNA. (umassmed.edu)
This finding indicated that Runx1 is found in a population of cells that represent a proliferative population of mesenchymal progenitor cells in osteoarthritis. (umassmed.edu)

Cdk6 blocks myeloid differentiation by interfering with Runx1 DNA binding and Runx1-C/EBPalpha interaction. (ox.ac.uk)
Chromatin-bound SEELA strengthens the interaction between chromatin and histone modifiers to promote histone recognition and oncogene transcription. (biomedcentral.com)

Using whole-exome and RNA sequencing we demonstrate that PHF6 and BCORL1 mutations, IKZF1 deletions, and AID/RAG-mediated rearrangements are enriched in RUNX1 mut BP-CML leading to typical mutational signature. (nature.com)

Huang G, Shigesada K, Ito K, Wee HJ, Yokomizo T, Ito Y. Dimerization with PEBP2beta protects RUNX1/AML1 from ubiquitin-proteasome-mediated degradation. (medlineplus.gov)

Runx1 was also expressed in chondrocytes found at the periphery of OA lesions in the articular cartilage of mice that underwent an OA-inducing surgery. (umassmed.edu)
In addition, pancreatic tissue from mice expressing this variant show de-differentiation and activation of signaling factors that initiate pancreatic cancer (PMID: 15093544, 25623042). (varsome.com)

Cleary suggested that E2a-Pbx1 functions as a "rogue activator" whose regulatory properties differ from wild-type Pbx1 but remain dependent on Hox DNA-binding partners. (medscape.com)

We not only show for the first time, that Tat apoptin, a cellpenetrating conjugate of apoptin strongly binds to the SH3 domain of Bcr Abl, but also it modifies the phosphorylation status and thus the activity of Bcr Abl, and several of its downstream targets. (hdac-inhibitors.com)

By directly regulating the expression of Smad6, Runx1 sets up a functional rheostat to control its own activity. (ox.ac.uk)
In addition, other cis-acting elements such as the intergenic region and transcription factors including MYB, KLF1, TCN 201 BCL11A, ZBTB7A, CHD4, NR2C1/NR2C2 and KDM1, play important roles in regulating expression [4C7]. (e-core.org)
Regulation of clusterin gene expression by transforming growth factor beta. (musc.edu)
Distinct pathways regulate transforming growth factor beta 1-stimulated proto-oncogene and extracellular matrix gene expression. (musc.edu)
Predicting master transcription factors from pan-cancer expression data. (atlasgeneticsoncology.org)

Overall, our study provides insights into the pathogenic role of RUNX1 mutations and highlights personalized targeted therapy and CAR T-cell immunotherapy as potentially promising strategies for treating RUNX1 mut BP-CML patients. (nature.com)
Here, we will discuss the current insights and ideas regarding mutant RUNX1 in the context of malignant transformation of iBMFs, taking SCN as the leading example. (molcells.org)

Interactions between the cell cycle machinery and transcription factors play a central role in coordinating terminal differentiation and proliferation arrest. (ox.ac.uk)
Inhibition of mink lung epithelial cell proliferation by transforming growth factor-beta is coupled through a pertussis-toxin-sensitive substrate. (musc.edu)
Qi X, L. Chaves, Y.H. Zhuang, Y. Chen, D. Wang, J. Chahon, B. Graham, K. Ohmori, and Huang H . Antagonistic regulation by transcription factors C/EBPa and MITF specifies basophil and mast cell fates. (nationaljewish.org)
This multiple activation of Negatively-charged defect factors fundamental of uncoating the middle cell organization. (evakoch.com)

Pbx is a Hox DNA binding cofactor. (medscape.com)

Anatomy4

Diseases4

Chemicals and Drugs18

Phenomena and Processes13

Information Science2

Acute myeloid14

Subunit7

Genes27

Transcription factor17

Protein23

Proteins13

CBFB3

Transcriptional5

RUNX3

Familial platelet disorder2

Hematopoiesis3

Runt4

Translocation2

Variety of hematological malignancies1

Germline1

Mutations are associated1

ETV6-RUNX11

Regulates3

Somatic1

Leukemias1

RUNX25

Mutation2

Activates2

Leukemia6

Enhancer1

Genetic3

Leukemic1

Homozygous2

Runx34

AML1-ETO2

Upregulate1

Promoter7

Promotes2

Prognosis1

Zebrafish1

Ligand2

Embryonic2

ACTIN3

Progenitor cells2

Interaction2

Deletions1

Dimerization1

Mice2

Regulatory1

Domain1

Expression5

Insights2

Cell4

Cofactor1