Inhibiting platelet aggregationFibrinogen receptorMembrane glycoprotein IIb.IIIa comKnown as integrinInvolved in platelet aggregationIncreased and GPIb deMegakaryocytesNormal plateletWillebrandReactivityFIBRONECTINInhibitorCollagenThrombosisHemostasisActivationInhibitsAntagonistThromboxaneCD41Flow CytometryInhibitionSuggests that plateletsClopidogrelBinding of fibrinogenRole of circulatAgonistInducesThrombin receptorAdhesion and aggregationAntibodiesAbnormalities in plateletNegatively charged phospholipidsAntiplateletDeficiencyPDGFConformationalDiagnosis of inheritedFibrinAlpha 2bBlood clotsPolymorphismGPIbSecretionPeptidesMediatesProteinCoagulation factorsInhibitorsMorphological changeDefectEndothelialClotMoleculesGranulesVesselGlanzmann
Inhibiting platelet aggregation2
- Selectively inhibits ADP binding to platelet receptor and subsequent ADP-mediated activation of glycoprotein GPIIb/IIIa complex, inhibiting platelet aggregation. (medscape.com)
- This active metabolite selectively inhibits adenosine diphosphate (ADP) binding to its platelet P2Y12 receptor and subsequently the ADP-mediated activation of the glycoprotein GPIIb/IIIa complex, thereby inhibiting platelet aggregation. (itopmeds.com)
Fibrinogen receptor3
- Using flow cytometry and Western blot, we determined the number of GP IIb-IIIa receptors (fibrinogen receptor) and P2Y12 receptors (ADP receptor) on the surface of platelets upon their activation with ADP and collagen. (bvsalud.org)
- Glanzmann thrombasthenia (GT) is a rare platelet disorder in which the platelets have qualitative or quantitative deficiencies of the fibrinogen receptor αIIbβ3. (medscape.com)
- Platelet membrane glycoprotein IIb-IIIa forms a calcium-dependent heterodimer and constitutes the fibrinogen receptor on stimulated platelets. (rupress.org)
Membrane glycoprotein IIb.IIIa com3
- Shattil SJ, Hoxie JA, Cunningham M, Brass LF: Changes in the platelet membrane glycoprotein IIb.IIIa complex during platelet activation. (exbio.cz)
- 8. Khaspekova SG, Vyzova TV, Lukin VV, Tikhomirov OIu, Berndt M, Kouns W, Mazurov AV. (1996) [Conformational changes of the platelet membrane glycoprotein IIb-IIIa complex stimulated by a monoclonal antibody to the N-terminal segment of glycoprotein IIIa]. (yoproteins.eu)
- 9. Khaspekova SG, Vlasik TN, Byzova TV, Vinogradov DV, Berndt MC, Mazurov AV. (1993) Detection of an epitope specific for the dissociated form of glycoprotein IIIa of platelet membrane glycoprotein IIb-IIIa complex and its expression on the surface of adherent platelets. (yoproteins.eu)
Known as integrin3
- Glycoprotein IIb/IIIa (GPIIb/IIIa, also known as integrin αIIbβ3) is an integrin complex found on platelets. (hemostasis.com)
- CD61, also known as integrin ß3 and glycoprotein IIIa (gpIIIa), is a 90 kD type I integral transmembrane glycoprotein. (biolegend.com)
- The mouse monoclonal antibody PAC-1 recognizes an extracellular activation-induced conformational epitope PAC-1 on CD41/CD61 complex (gpIIb/IIIa), also known as integrin alpha IIb beta 3, a receptor which mediates platelet aggregation. (exbio.cz)
Involved in platelet aggregation1
- Upon blood vessel damage, this receptor binds to a variety of proteins including von Willebrand factor, fibrinogen, fibronectin and vitronectin, and it is involved in platelet aggregation. (exbio.cz)
Increased and GPIb de1
- RESULTS: Fresh PLTs responded to the dual agonists arachidonic acid and adenosine diphosphate (ADP) to aggregate and produce thromboxane A2, and in both the PLT surface markers P-selectin and GPIIb-IIIa increased and GPIb decreased after stimulation. (umassmed.edu)
Megakaryocytes9
- Integrin alpha 2b (ITGA2b), also known as CD41 and GPIIb, is a transmembrane glycoprotein that is expressed by megakaryocytes and platelets. (rndsystems.com)
- Platelets are produced in hematopoiesis by budding off from megakaryocytes . (wikidoc.org)
- The platelets arise from the fragmentation of the cytoplasm of megakaryocytes in the bone marrow and circulate in blood as disc-shaped anucleate particles for 7-10 days. (medscape.com)
- CD41/CD61 is expressed on platelets and megakaryocytes, and plays a role in platelet activation and aggregation through interaction with fibrinogen, fibronectin, vWF, and other RGD-containing adhesion molecules. (biolegend.com)
- Biosynthesis and processing of platelet GPIIb-IIIa in human megakaryocytes. (rupress.org)
- To examine the biosynthesis and processing of GPIIb-IIIa, purified human megakaryocytes were isolated from liquid cultures of cryopreserved leukocytes stem cell concentrates from patients with chronic myelogenous leukemia. (rupress.org)
- The glycosylation of GPIIb-IIIa was examined in megakaryocytes by metabolic labeling in the presence of tunicamycin, monensin, or treatment with endoglycosidase H. The polypeptide backbones of the GPIIb and the GPIIIa have molecular masses of 120 and 90 kD, respectively. (rupress.org)
- The antibody reacts with human platelets and megakaryocytes. (yoproteins.eu)
- Platelets originate from megakaryocytes, which are the largest progenitor cells of the bone marrow. (teachmephysiology.com)
Normal platelet5
- The complex is formed via calcium-dependent association of gpIIb and gpIIIa, a required step in normal platelet aggregation and endothelial adherence. (hemostasis.com)
- A normal platelet count in a healthy person is between 150,000 and 400,000 per mm³ of blood (150-400 x 10 9 / L ). 95% of healthy people will have platelet counts in this range. (wikidoc.org)
- The platelet integrin αIIbβ3, also known as the glycoprotein GPIIb/IIIa (CD41/CD61) complex, is essential for normal platelet function. (medscape.com)
- Most patients have a normal platelet size and count. (medscape.com)
- The normal platelet count is 150-400 x 10 9 /L. Although they are primarily found in the bloodstream, up to 30% of platelets are transiently sequestered within the spleen , ready for rapid mobilisation. (teachmephysiology.com)
Willebrand7
- Integrin alpha 2b associates with Integrin beta 3 to form complexes that interact with Fibrinogen, von Willebrand factor, Fibronectin, and Vitronectin. (rndsystems.com)
- It is a receptor for fibrinogen and von Willebrand factor and aids in platelet activation. (hemostasis.com)
- this is a calcium-dependent receptor for fibrinogen, fibronectin , vitronectin, thrombospondin and von Willebrand factor (vWF). (wikidoc.org)
- Platelets play a primary role in this process, interacting with subendothelium-bound von Willebrand factor (vWf) via the membrane glycoprotein (GP) Ib complex. (medscape.com)
- [ 4 ] With platelet activation, the αIIbβ3 complex shifts into its active configuration, which allows the binding of fibrinogen and/or von Willebrand factor (vWF). (medscape.com)
- 4. Naimushin YA, Mazurov AV. (2004) Von Willebrand factor can support platelet aggregation via interaction with activated GPIIb-IIIa and GPIb. (yoproteins.eu)
- Abciximab binds to the glycoprotein (GP) IIb/IIIa receptor of human platelets and inhibits platelet aggregation by preventing the binding of fibrinogen, von Willebrand factor and other adhesive molecules. (smpdb.ca)
Reactivity4
- Platelet Activation and Reactivity in a Large Cohort of Patients with Gaucher Disease. (harvard.edu)
- Dipyridamole is a platelet adhesion inhibitor that possibly inhibits RBC uptake of adenosine, itself an inhibitor of platelet reactivity. (medscape.com)
- At late sampling after 30 min no significant differences were found between groups for both platelet reactivity and GP IIb/IIIa receptor occupancy. (uni-luebeck.de)
- Flow cytometry can be used to measure platelet reactivity, circulating activated platelets, platelet-platelet aggregates, leukocyte-platelet aggregates, procoagulant platelet-derived microparticles, and calcium flux. (umassmed.edu)
FIBRONECTIN1
- ITGA2B is a receptor for fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin and functions in platelet activation (5). (peertechzpublications.com)
Inhibitor7
- The drug is an irreversible inhibitor of the P2Y12 adenosine diphosphate receptor found on the membranes of platelet cells. (itopmeds.com)
- Ticlopidine is a platelet aggregation inhibitor structurally and pharmacologically similar to clopidogrel. (lgmpharma.com)
- It has been proposed that 1 or more active metabolites may account for ticlopidine's activity, because ticlopidine itself is an extremely weak platelet aggregation inhibitor in vitro at the concentrations achieved in vivo. (lgmpharma.com)
- Panel members preferred a single intravenous aspirin bolus or, in jurisdictions in which intravenous aspirin is not available, a glycoprotein IIb/IIIa receptor inhibitor as intraprocedural antiplatelet regimen and a combination therapy of oral aspirin and a P2Y12 inhibitor in the postprocedural period. (elsevierpure.com)
- Panel members preferred intravenous aspirin or, alternatively, a glycoprotein IIb/IIIa receptor inhibitor as an intraprocedural antiplatelet agent, followed by a dual oral regimen of aspirin and a P2Y12 inhibitor in the postprocedural period. (elsevierpure.com)
- Eptifibatide is a Platelet Aggregation Inhibitor that is FDA approved for the treatment of acute coronary syndrome ( ACS ), percutaneous coronary intervention ( PCI ). (wikidoc.org)
- Current or planned administration of another parenteral GP IIb/IIIa inhibitor . (wikidoc.org)
Collagen10
- Platelets are activated when brought into contact with collagen (which is exposed when the endothelial blood vessel lining is damaged), thrombin (primarily through PAR -1), ADP receptors (P2Y1 and P2Y12) expressed on platelets, a negatively charged surface (e.g. glass), or several other activating factors. (wikidoc.org)
- Other receptors include GPIb-V-IX complex (vWF) and GPVI ( collagen ). (wikidoc.org)
- This initial interaction (platelet adhesion) sets the stage for other adhesive reactions that allow the platelets to interact with other agonists in the vicinity of vessel injury, such as adenosine 5'-diphosphate (ADP), subendothelial collagen, and thrombin. (medscape.com)
- 2001) A novel viper venom metalloproteinase, alborhagin, is an agonist at the platelet collagen receptor GPVI. (yoproteins.eu)
- Exposed collagen fibres bind vWF released from the damaged endothelium, which in turn binds to vWF receptors on platelets to promote adhesion. (teachmephysiology.com)
- The exposed collagen itself also promotes platelet binding. (teachmephysiology.com)
- When a platelet binds to collagen, the glycoprotein IIb/IIIa pathway is activated - a complex system controlled by G-protein coupled receptors (GPCRs). (teachmephysiology.com)
- The collagen-induced platelet aggregation of platelet-rich plasma samples from 14 healthy rabbits was measured turbidometrically using a platelet aggregometer, before and 1 hour after intravenous injection of alum. (who.int)
- Collagen-induced platelet aggregation was significantly reduced after alum injection. (who.int)
- contradiction in the mechanism of action of alum, we evaluated the in vivo effect of Alum (aluminium potassium sulfate) is a alum in terms of collagen-induced platelet food additive and traditional remedy used to aggregation and bleeding time. (who.int)
Thrombosis12
- Dematin Regulates Calcium Mobilization, Thrombosis, and Early Akt Activation in Platelets. (harvard.edu)
- Exploratory Use of Glycoprotein IIb/IIIa Inhibition in Prevention of Blalock-Taussig Shunt Thrombosis. (harvard.edu)
- May be used in low dose to inhibit platelet aggregation and improve complications of venous stasis and thrombosis. (medscape.com)
- Dysfunction or low levels of platelets predisposes to bleeding , while high levels, although usually asymptomatic, may increase the risk of thrombosis . (wikidoc.org)
- Under physiological circumstances, the resistance of the endothelial cell lining to interactions with platelets and coagulation factors prevents thrombosis. (medscape.com)
- Hughes Syndrome/Antiphospholipid syndrome (APS) is a systemic autoimmune, hypercoagulable, thrombo inflammatory, and thrombosis and/or pregnancy complications syndrome caused by the persistent presence of antiphospholipid antibodies (APL) in plasma of patients with vascular thrombosis and/or pregnancy morbidity along with persistent anti-phospholipid antibodies (APLA), including lupus anticoagulant (LA), anti-β2-glycoprotein I (anti-β2GPI) and/or anti-cardiolipin (ACL) antibodies. (endinglines.com)
- GP IIb/IIIa receptor activation plays an important role in thrombosis. (aging-us.com)
- In thrombosis, platelet activation serves as the initiation factor. (aging-us.com)
- However, following conformational changes, these receptors are transformed into a high-affinity state wherein they can bind to fibrinogen and promote thrombosis. (aging-us.com)
- Blood platelets play an essential role in hemostasis, thrombosis and coagulation of blood. (biomedcentral.com)
- High shear stress in stenotic atherosclerotic arteries cause platelet adhesion leading to the development of arterial thrombosis and cardiovascular events[ 15 ]. (biomedcentral.com)
- to Platelet adhesion and aggregation are initiating events in arterial thrombosis. (justia.com)
Hemostasis7
- Platelets , or thrombocytes , are the cells circulating in the blood that are involved in the cellular mechanisms of primary hemostasis leading to the formation of blood clots . (wikidoc.org)
- Platelet disorders lead to defects in primary hemostasis and produce signs and symptoms different from coagulation factor deficiencies (disorders of secondary hemostasis). (medscape.com)
- The initial hemostatic plug, composed primarily of platelets, is stabilized further by a fibrin mesh generated in secondary hemostasis. (medscape.com)
- In the present study, the antithrombotic effect of ASA in patients with CAD was assessed in platelet-rich plasma (PRP) using integral tests of the hemostasis study: the T-TAS system (Total Thrombus-formation Analysis System) and the thrombin generation test (TGT). (bvsalud.org)
- Adjacent platelets are cross-linked through the αIIβ3, resulting in platelet aggregation and hemostasis. (medscape.com)
- In other words platelets are corpuscular messengers, or are more than a member of the family providing hemostasis. (biomedcentral.com)
- The function of platelets in the maintenance of hemostasis has long been recognized and well defined. (biomedcentral.com)
Activation29
- Peripheral versus central venous blood sampling does not influence the assessment of platelet activation in cirrhosis. (harvard.edu)
- Sex-specific platelet activation through protease-activated receptor-1 in patients undergoing cardiac catheterization. (harvard.edu)
- The active metabolite of clopidogrel prevents binding of adenosine diphosphate (ADP) to its platelet receptor, impairing the ADP-mediated activation of the glycoprotein GPIIb/IIIa complex. (itopmeds.com)
- As the glycoprotein GPIIb/IIIa complex is the major receptor for fibrinogen, its impaired activation prevents fibrinogen binding to platelets and inhibits platelet aggregation. (itopmeds.com)
- By blocking the amplification of platelet activation by released ADP, platelet aggregation induced by agonists other than ADP is also inhibited by the active metabolite of clopidogrel. (itopmeds.com)
- Platelet activation by ADP (blocked by clopidogrel) leads to a conformational change in platelet gpIIb/IIIa receptors that induces binding to fibrinogen. (hemostasis.com)
- TR1-41-induced platelet activation was synergistic with TR42-55. (umassmed.edu)
- Circulating monocyte-platelet aggregates appear to be a more sensitive marker of in vivo platelet activation than circulating P-selectin-positive platelets. (umassmed.edu)
- The contents of the granules are released upon activation of the platelet. (wikidoc.org)
- Platelet activation further results in the scramblase -mediated transport of negatively charged phospholipids to the platelet surface. (wikidoc.org)
- Platelet aggregation is stimulated by thromboxane and α2 receptor -activation, but inhibited by other inflammatory products like PGI2 and PGD2 . (wikidoc.org)
- Platelet activation allows binding of these proteins, which bridges adjacent platelets. (medscape.com)
- Platelet activation pathways. (medscape.com)
- Shattil SJ, Cunningham M, Hoxie JA: Detection of activated platelets in whole blood using activation-dependent monoclonal antibodies and flow cytometry. (exbio.cz)
- Qin R , Zhu H , Wang F , Song M , Lin P , Xing Y , Zhang W , Zhong M , Wang Z , . Platelet activation in diabetic mice models: the role of vascular endothelial cell-derived protein disulfide isomerase-mediated GP IIb/IIIa receptor activation. (aging-us.com)
- The mechanism of early activation of GP IIb/IIIa receptors in diabetic conditions remains unknown. (aging-us.com)
- The purpose of this study was to investigate the release of Endothelial microparticle (EMP)-associated protein disulfide isomerase (PDI) after endothelial cell injury induced in diabetes and the changes in platelet activation. (aging-us.com)
- Compared with the normal diet group, the diabetic group had significantly increased plasma EMP-PDI content and accelerated platelet activation by increased GP IIb/IIIa expression. (aging-us.com)
- In conclusion, EMP-PDI promotes early platelet activation through glycoprotein (GP) IIb/IIIa receptors present on platelet surface in the diabetic state. (aging-us.com)
- However, diabetic patients have significantly higher platelet aggregation and activation than non-diabetic patients, including those undergoing dual antiplatelet therapy [ 4 - 6 ]. (aging-us.com)
- This suggests that the mechanism of platelet activation in the diabetic state has not been fully elucidated. (aging-us.com)
- However, the ultimate common pathway of platelet aggregation is the activation of glycoprotein (GP) IIb/IIIa receptors present on platelet surface [ 7 - 9 ]. (aging-us.com)
- The identification of the key molecules that accurately regulate the activation of these receptors may provide a novel approach for antiplatelet therapy. (aging-us.com)
- Activation of thrombin receptors occurs through the proteolytic action of THROMBIN, which cleaves the N-terminal peptide from the receptor to reveal a new N-terminal peptide that is a cryptic ligand for the receptor. (bvsalud.org)
- Platelet activation results in a morphological change on the membrane surface of the platelet, increasing the surface area and preparing it for aggregation. (teachmephysiology.com)
- Platelet activation means their aggregation, sludge formation, furthermore the release of the for-mentioned biologically very powerful factors, which can locally amplify and deepen the tissue specific cell reactions. (biomedcentral.com)
- Stehbens and Biscoe, 1967 ), platelet shape change was, and still is, generally regarded to be the initial stage of platelet activation. (nature.com)
- Thrombin can produce platelet aggregation largely independently of other pathways but substantial quantities of thrombin are unlikely to be present without prior activation of platelets by other mechanisms. (justia.com)
- The P 2T receptor (also known as P2Y ADP or P2T AC ) is primarily involved in mediating platelet aggregation/activation and is a G-protein coupled receptor which is as yet uncloned. (justia.com)
Inhibits5
- Inhibits prostaglandin synthesis, which prevents formation of platelet-aggregating thromboxane A2. (medscape.com)
- Aspirin inhibits prostaglandin synthesis, preventing formation of platelet-aggregating thromboxane A2. (medscape.com)
- he drug specifically and irreversibly inhibits the P2Y12 subtype of ADP receptor, which is important in aggregation of platelets and cross-linking by the protein fibrin. (itopmeds.com)
- Aspirin inhibits the formation of thromboxane A2 in the platelets. (neisslabs.com)
- This inhibits platelet aggregation and coagulation. (neisslabs.com)
Antagonist3
- Background: In patients with ST-elevation myocardial infarction (STEMI), direct intracoronary bolus administration of the glycoprotein (GP) IIb/IIIa receptor antagonist abciximab is associated with a reduction in infarct size, better myocardial salvage, less microvascular obstruction and improved myocardial blush grade as compared to intravenous bolus injection, presumably caused by higher local drug concentrations leading to a more pronounced inhibition of platelet aggregation. (uni-luebeck.de)
- Flow cytometry can also be used in the following clinical settings: monitoring of GPIIb-IIIa antagonist therapy, diagnosis of inherited deficiencies of platelet surface glycoproteins, diagnosis of storage pool disease, diagnosis of heparin-induced thrombocytopenia, and measurement of the rate of thrombopoiesis. (umassmed.edu)
- 2010) [Glycoprotein IIb-IIIa antagonist Monafram in primary angioplasty of patients with acute coronary syndrome without st segment elevation]. (yoproteins.eu)
Thromboxane5
- May also inhibit phosphodiesterase activity, leading to increased cyclic-3', 5'-adenosine monophosphate levels in platelets and formation of the potent platelet activator thromboxane A2. (medscape.com)
- BACKGROUND: Studies have been performed on human fresh, liquid-preserved, and cryopreserved platelets (PLTs) to assess PLT-adhesive surface receptors, PLT membrane procoagulant activity, PLT aggregation, and thromboxane production. (umassmed.edu)
- STUDY DESIGN AND METHODS: In both human and baboon fresh and lyophilized PLTs, aggregation response and PLT production of thromboxane A2 were measured after stimulation, and PLT surface markers P-selectin, glycoprotein (GP) Ib, GPIIb-IIIa, and factor (F) V were measured before and after stimulation. (umassmed.edu)
- The result is the secretion of ADP and thromboxane A2 which subsequently activate other platelets. (teachmephysiology.com)
- The limited anti-thrombotic efficacy of aspirin may reflect the fact that it blocks only one source of ADP which is that released in a thromboxane-dependent manner following platelet adhesion (see e.g. (justia.com)
CD415
- Detection of Integrin alpha 2b/CD41 in Human Blood Platelets by Flow Cytometry. (rndsystems.com)
- Human peripheral blood platelets were stained with FITC-conjugated Anti-Human Integrin a2b/CD41 Antibody (Clone P2) and either (A) Mouse Anti-Human Integrin a2b/CD41 APC-conjugated Monoclonal Antibody (Catalog # FAB7616A) or (B) Mouse IgG 1 Allophycocyanin Isotype Control (Catalog # IC002A ). (rndsystems.com)
- It is a member of the integrin family, associating with platelet gpIIb (CD41) to form CD41/CD61 complex and with integrin aV (CD51) to form aV/ß3 (CD51/CD61) integrin. (biolegend.com)
- CD41 (platelet glycoprotein IIb, integrin alpha IIb) is composed of two subunits (120 kDa transmembrane alpha chain and 23 kDa extracellular beta chain) and interacts with CD61 (platelet glycoprotein IIIa, integrin beta 3) in the presence of calcium to form a functional adhesive protein receptor. (exbio.cz)
- CD41/CD61 complex is one of the earliest markers of the megakaryocytic lineage. (exbio.cz)
Flow Cytometry2
- Platelet function in whole blood can be comprehensively evaluated by flow cytometry. (umassmed.edu)
- Application of flow cytometry to platelet disorders. (umassmed.edu)
Inhibition7
- May have positive influence on several hemorrhagic parameters and may exert protection against atherosclerosis (inhibition of platelet function and changes in hemorrhagic profile). (medscape.com)
- It is proposed that the inhibition involves a defect in the mobilization from the storage sites of the platelet granules to the outer membrane. (itopmeds.com)
- We investigated whether there are differences in the degree of GP IIb/IIIa receptor occupancy and platelet inhibition in blood drawn from the coronary sinus (CS) shortly after intracoronary versus intravenous abciximab bolus administration. (uni-luebeck.de)
- The degree of platelet inhibition was also markedly higher with intracoronary compared to intravenous dosing. (uni-luebeck.de)
- Conclusions: Acutely, direct intracoronary bolus injection resulted in a more pronounced local inhibition of platelet function and a higher degree of GP IIb/IIIa receptor occupancy as compared to standard intravenous bolus injection. (uni-luebeck.de)
- When taken orally, ticlopidine causes a time- and dose-dependent inhibition of both platelet aggregation and release of platelet granule constituents, as well as a prolongation of bleeding time. (lgmpharma.com)
- 2001) [Inhibition of thrombocyte aggregation by F(ab')2-fragments of monoclonal antibodies FraMon (CRC64) to glycoproteins IIb-IIIa]. (yoproteins.eu)
Suggests that platelets2
- Recently, a growing body of evidence suggests that platelets have the pivotal role in the pathogenesis of several poor prognostic mediacal conditions like inflammation and cancer (10). (peertechzpublications.com)
- Nevertheless, their distinctive armament of soluble mediators as well as the presence of surface receptors suggests that platelets must have further roles in several physiological and pathophysiological regulatory processes[ 14 ]. (biomedcentral.com)
Clopidogrel2
- Covalent binding to platelets has accounted for 2% of radiolabeled clopidogrel with a half-life of 11 days. (itopmeds.com)
- 1. Khaspekova SG, Ziuriaev IT, Iakushkin VV, Golubeva NV, Ruda MIa, Mazurov AV. (2011) [Platelet aggregation upon acetylsalicylic acid and clopidogrel treatment and glycoprotein IIb/IIIa content in patients with acute coronary syndrome]. (yoproteins.eu)
Binding of fibrinogen1
- Whatever the initial stimulus, the final common event is a cross-linking of platelets by binding of fibrinogen to a membrane-binding site, glycoprotein IIb/IIIa (GPIIb/IIIa). (justia.com)
Role of circulat1
- The role of circulating platelet transcripts. (umassmed.edu)
Agonist5
- In this study, we demonstrate that the 41-aa cleaved peptide, TR1-41 (MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPR) is a strong platelet agonist. (umassmed.edu)
- In summary, the cleaved peptide of the seven-transmembrane domain TR (TR1-41) is a strong platelet agonist. (umassmed.edu)
- Platelets have abundant surface receptors , classified into agonist and adhesion receptors. (teachmephysiology.com)
- Agonist receptors recognise stimulatory molecules. (teachmephysiology.com)
- Platelets were activated with ADP, thrombin, or the thrombin receptor agonist peptide SFLLRN (TRAP 1-6 ). (nature.com)
Induces1
- TR1-41 induces platelet aggregation. (umassmed.edu)
Thrombin receptor2
- Peptides corresponding to the new amino terminal end of the proteolyzed seven-transmembrane domain thrombin receptor [TR42-55, SFLLRNPNDKYEPF, also known as TRAP (thrombin receptor-activating peptide)], previously have been demonstrated to activate the receptor. (umassmed.edu)
- A cryptic peptide ligand contained within the N-terminal of the thrombin receptor. (bvsalud.org)
Adhesion and aggregation1
- Platelet membrane glycoprotein complex important for platelet adhesion and aggregation. (harvard.edu)
Antibodies3
- Recombinant coagulation factor VIIa is approved for bleeding episodes and perioperative management in patients with GT refractory to platelet transfusions, with or without antibodies to platelets. (medscape.com)
- Immunoprecipitation of [35S]methionine pulse-chase-labeled cell extracts by antibodies specific for the alpha or beta subunits of GPIIb indicated that GPIIb was derived from a precursor of Mr 130,000 that contains the alpha and beta subunits. (rupress.org)
- The high anti-platelet efficacy of antibodies or antagonists for GPIIb/IIIa is explained by their interference with this final common event. (justia.com)
Abnormalities in platelet2
- Disorders caused by abnormalities in platelet count or function. (umassmed.edu)
- Severe abnormalities in platelet function, such as Bernard-Soulier syndrome, Glanzmann's thrombasthenia, or platelet storage-pool deficiency, are characterized by the inability of platelets to aggregate in response to certain agonists. (nature.com)
Negatively charged phospholipids1
- In addition, when platelets are activated, negatively charged phospholipids move from the inner to the outer leaflet of the membrane bilayer. (medscape.com)
Antiplatelet1
- Clinical applications of whole blood flow cytometric assays of platelet function in disease states (e.g., acute coronary syndromes, angioplasty, and stroke) may include identification of patients who would benefit from additional antiplatelet therapy and prediction of ischemic events. (umassmed.edu)
Deficiency1
- The antibody does not react with platelets from patients with the hereditary deficiency of GP IIb-IIIa (Glanzmann's thrombasthenia). (yoproteins.eu)
PDGF1
- It also secretes e.g. platelet-derived growth factor (PDGF). (wikidoc.org)
Conformational1
- This process relies on the destruction of disulfide bonds present on these receptors, such as Cys5-Cys435, Cys663-Cys687, and a third Cys-rich repetitive zone, to be transformed into the ligand-binding, high-affinity state and evoke conformational changes in GP IIb/IIIa receptors [ 10 ]. (aging-us.com)
Diagnosis of inherited2
- M, Gresele P. Expert opinion on the use of platelet secretion assay for the diagnosis of inherited platelet function disorders: Communication from the ISTH SSC Subcommittee on Platelet Physiology. (umassmed.edu)
- Mumford AD, Frelinger AL, Gachet C, Gresele P, Noris P, Harrison P, Mezzano D. A review of platelet secretion assays for the diagnosis of inherited platelet secretion disorders. (umassmed.edu)
Fibrin2
- The platelets adhere to each other via adhesion receptors or integrins , and to the endothelial cells in the wall of the blood vessel forming a haemostatic plug in conjunction with fibrin . (wikidoc.org)
- Retraction of a clot resulting from contraction of PLATELET pseudopods attached to FIBRIN strands. (lookformedical.com)
Alpha 2b3
- Integrin alpha 2b is required for platelet aggregation, and defects lead to disorders of coagulation. (rndsystems.com)
- In this study we aimed to investigate the effect of ITGA2B (integrin alpha 2b, platelet glycoprotein IIb of IIb/IIIa complex) gene polymorphism on the magnitude of inflammatory response after CPB. (peertechzpublications.com)
- The antibody is specific to the integrin complex alpha 2b beta 3, but not to the dissociated integrins. (yoproteins.eu)
Blood clots3
- Platelets play an important role in the formation of blood clots . (teachmephysiology.com)
- The key role of platelets is their participation in haemostasis through the formation of blood clots at the site of bleeding. (teachmephysiology.com)
- Platelets are small cells that circulate in blood and are an essential component of blood clots. (medlineplus.gov)
Polymorphism2
- Koray Ak, Ergun S, Altınoz H, Uyguner ZO, Tetik S (2016) GG Polymorphism of Platelet ITGA2B Gene Increases the Magnitude of Interleukin-6 Release after Cardiopulmonary Bypass. (peertechzpublications.com)
- 3. Sirotkina OV, Khaspekova SG, Zabotina AM, Shimanova YV, Mazurov AV. (2007) Effects of platelet glycoprotein IIb-IIIa number and glycoprotein IIIa Leu33Pro polymorphism on platelet aggregation and sensitivity to glycoprotein IIb-IIIa antagonists. (yoproteins.eu)
GPIb2
- and (iv) independent of the GPIb-IX and GPIIb-IIIa complexes. (umassmed.edu)
- Knockin of human VWF exon 28 and crossbreeding with hGPIbα Tg generated a humanized mouse model of platelet GPIbα-VWFA1 interaction. (ashpublications.org)
Secretion1
- Through these pathways activated platelets are accumulated in the follicular vessels surrounding the follicle and due to its released soluble molecules (factors, mediators, chemokines, cytokines, neurotransmitters) locally increase oocyte maturation and hormone secretion. (biomedcentral.com)
Peptides2
- Small synthetic peptides that contain the unmasked N-terminal peptide sequence can also activate the receptor in the absence of proteolytic activity. (bvsalud.org)
- Peptidomimetics are designed to overcome the barriers posed by natural peptides such as premature proteolysis, low availability and less receptor selectivity 15 . (ijpsr.com)
Mediates1
- The platelet GP IIb/IIIa complex mediates platelet-to-platelet interactions (platelet aggregation). (medscape.com)
Protein6
- Thrombin cleaves its G-protein-linked seven-transmembrane domain receptor, thereby releasing a 41-aa peptide and generating a new amino terminus that acts as a tethered ligand for the receptor. (umassmed.edu)
- Although platelets lack nuclei, they are capable of de novo protein synthesis. (bvsalud.org)
- We speculate that key platelet receptors are involved in the regulation of this process, and the changes in their number indicate the de novo protein synthesis in platelets. (bvsalud.org)
- GPIIb is a two-chain protein containing disulfide-linked alpha and beta subunits. (rupress.org)
- These genes provide instructions for making the two parts (subunits) of a receptor protein called integrin alphaIIb/beta3 (αIIbβ3). (medlineplus.gov)
- This protein is abundant on the surface of platelets. (medlineplus.gov)
Coagulation factors2
- Once activated, they release a number of different coagulation factors and platelet activating factors. (wikidoc.org)
- The hemostatic system consists of platelets, coagulation factors, and the endothelial cells lining the blood vessels. (medscape.com)
Inhibitors1
- This was also seen when preactivated platelets, which cannot undergo further morphological changes, were used, and when platelets were activated in the presence of shape-change inhibitors such as cytochalasin D and vincristine. (nature.com)
Morphological change1
- It was suggested that this optical effect was caused by the morphological change of platelets from discs to spherical cells with pseudopodia ( Latimer et al, 1977 ). (nature.com)
Defect1
- A defect in either glycoprotein can lead to a bleeding disorder. (medscape.com)
Endothelial2
- They are found primarily on PLATELETS and on ENDOTHELIAL CELLS. (bvsalud.org)
- Although the process of platelet adhesion to the sub-endothelial surface may have an important role to play in the repair of damaged vessel walls, the platelet aggregation that this initiates can precipitate acute thrombotic occlusion of vital vascular beds, leading to events with high morbidity such as myocardial infarction and unstable angina. (justia.com)
Clot3
- Clot retraction is used as a measure of platelet function. (lookformedical.com)
- The production of the platelet plug is an example of positive feedback and thus it is necessary to have measures in place to prevent excessive and inappropriate clot formation. (teachmephysiology.com)
- As a result, platelets cannot clump together to form a blood clot, leading to prolonged bleeding. (medlineplus.gov)
Molecules2
- The resemblance in the Morphine Phenol system and N-Terminal tyrosine residue in the opioid receptors implied that these molecules also interacted with the opioid receptors in a similar manner and cause similar responses 8-9 . (ijpsr.com)
- It is well known, that platelets have an armament of soluble molecules, factors, mediators, chemokines, cytokines and neurotransmitters in their granules, and have multiple adhesion molecules and receptors on their surface. (biomedcentral.com)
Granules3
- Platelets contain two unique types of granules: alpha granules and dense granules. (medscape.com)
- The alpha granules contain hemostatic proteins such as fibrinogen, vWf, and growth factors (eg, platelet-derived growth factor and transforming growth factors). (medscape.com)
- Granules merge with channels of the canalicular system after platelet stimulation and evacuate their contents[ 8 - 10 ]. (biomedcentral.com)
Vessel3
- The body's reaction to vessel wall injury is rapid adhesion of platelets to the subendothelium. (medscape.com)
- Adhesion receptors promote the adhesion of platelets to other platelets, the vessel wall or leucocytes , depending on the receptor stimulated. (teachmephysiology.com)
- This property let platelets arrest bleeding and promote vessel repair. (biomedcentral.com)
Glanzmann2
- [ 5 ] Acquired Glanzmann thrombasthenia is characterized by anti-αIIbβ3 autoantibodies or paraproteins that block platelet aggregation. (medscape.com)
- Patients with Glanzmann thrombasthenia can have severe bleeding problems, but their prognosis remains good with appropriate supportive care and platelet transfusions if necessary. (medscape.com)