Receptor tyrosine kinase like orphan receptors. Medical search. Frequent questions

ROR1, also known as neurotrophic tyrosine kinase, receptor-related 1 (NTRKR1), is normally expressed during embryogenesis. (nih.gov)

Evidence for the functionality of these proteins has been established by experiments showing that disruption of the orphan receptor genes results in developmental defects. (bvsalud.org)
The receptor tyrosine kinase-like orphan receptor (Ror) proteins are conserved tyrosine kinase receptors that play roles in a variety of cellular processes that pattern tissues and organs during vertebrate and invertebrate development. (knaw.nl)
Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. (umbc.edu)
We are using biochemical and genetic approaches as well as X-ray crystallography to determine the mechanism of activation of receptor tyrosine kinases, how they recruit target proteins, and the mode of action of downstream signaling proteins in normal cellular processes and in diseases caused by dysfunctional receptor tyrosine kinases. (yale.edu)
Receptor tyrosine kinases undergo ligand-dependent dimerization, which activates their intrinsic protein tyrosine kinase activity resulting in autophosphorylation and subsequent interaction and recruitment of multiple cellular target proteins. (yale.edu)
Interaction between Grb2 and Sos with tyrosine phosphorylated RTKs or docking proteins results in translocation of Sos to the plasma membrane allowing the exchange of GDP for GTP on Ras. (yale.edu)
Receptor tyr kinases (RTKs) are integral membrane proteins which contain an extracellular ligand-binding region, a transmembrane segment, and an intracellular tyr kinase domain. (unl.edu)
Non-receptor (or cytoplasmic) tyr kinases are distributed in different intracellular compartments and are usually multi-domain proteins containing a catalytic tyr kinase domain as well as various regulatory domains such as SH3 and SH2. (unl.edu)
Nuclear (in)FGFR1 is definitely a extremely cellular chromatin proteins [35] which binds and activates CREB joining proteins (CBP) and Ribosomal H6 kinase-1 (RSK1). (researchensemble.com)

Tyrosine-protein kinase receptor UFO is an enzyme that in humans is encoded by the AXL gene . (wikipedia.org)
The protein encoded by this gene is a member of the receptor tyrosine kinase subfamily. (wikipedia.org)
Although it is similar to other receptor tyrosine kinases, the Axl protein represents a unique structure of the extracellular region that juxtaposes IgL and FNIII repeats. (wikipedia.org)
The AXL protein is characterized by an extracellular structure consisting of two fibronectin type 3-like repeats and two immunoglobulin-like repeats along with its intracellular tyrosine kinase domain. (wikipedia.org)
The AXL receptor transduces signals from the extracellular matrix into the cytoplasm by binding growth factors like vitamin K-dependent protein growth-arrest-specific gene 6 ( GAS6 ). (wikipedia.org)
LDL receptor-related protein 5 (LRP5) affects bone accrual and eye development. (nature.com)
A mutation in the LDL receptor-related protein 5 gene results in the autosomal dominant high-bone-mass trait. (nature.com)
High bone density due to a mutation in LDL-receptor-related protein 5. (nature.com)
Additionally, inhibition of low-density lipoprotein receptor-related protein 6 (LRP6) with either siRNA or dickkopf decreased the response to Wnt3a stimulation, but no change was seen in the increased β-catenin pool associated with Ror2 expression, suggesting that LRP6 cofactor recruitment is necessary for a Wnt3a-induced signal but that it does not participate in the Ror2 effect on β-catenin signaling. (nih.gov)
In the absence of Wnt signaling, β-catenin is targeted for degradation by a destruction complex that consists of the scaffold protein Axin, the tumor suppressor gene product APC, and the kinases CK1 and GSK3β. (wormbook.org)
Binding of Wnt to the receptors Frizzled and LRP6 leads to inhibition of β-catenin degradation through a mechanism that involves the cytoplasmic protein Dishevelled and recruitment of Axin to LRP6 at the plasma membrane. (wormbook.org)
The protein encoded by this gene is a receptor protein tyrosine kinase and type I transmembrane protein that belongs to the ROR subfamily of cell surface receptors. (antibodies-online.com)
In multiple species, Rors have been shown to act as Wnt receptors signaling via novel non-canonical Wnt pathways mediated in some tissues by the adapter protein disheveled and the non-receptor tyrosine kinase Src. (knaw.nl)
Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2. (umbc.edu)
The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). (umbc.edu)
PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. (umbc.edu)
Receptor tyrosine kinases and cytoplasmic protein tyrosine kinases play a critical role in the control of many cellular processes including: cell proliferation, differentiation, metabolism, as well as cell survival and cell migration. (yale.edu)
Receptor tyrosine kinases undergo ligand dependent dimerization which activates their intrinsic protein tyrosine kinase (PTK) domains. (yale.edu)
The encoded protein is a glycosylated type I membrane protein that belongs to the ROR subfamily of cell surface receptors. (nih.gov)
Catalytic domain of Protein Tyrosine Kinases. (unl.edu)
Protein Tyrosine Kinase (PTK) family, catalytic domain. (unl.edu)
The RNAseq data indicated that TGF- β 1 reduced the expression of nearly all G α s -coupled G protein coupled receptors, with the β 2-adrenergic receptor ( β 2-AR) demonstrating the greatest decrease. (aspetjournals.org)
However, the D1 dopamine receptor (D1DR) and the orphan G protein coupled receptor 3 are spared. (aspetjournals.org)
Nur77,with related protein Nurr1 and NOR-1 jointly, comprise a group of nuclear orphan receptors that are lacking of a ligand-binding domains and function as ssTF for the reflection of several genetics within multiple signaling paths. (researchensemble.com)

Ror is a transmembrane tyrosine-kinase that contains a cysteine-rich Wnt binding domain that is similar to the extracellular domain of Frizzled ( Xu and Nusse, 1998 ). (wormbook.org)
NGF is normally the founding member of the polypeptide neurotrophin family members, activates transmembrane tyrosine kinase receptor TrkA [4] and is normally accountable for the success and difference of sympathetic and dorsal main ganglion neurons, as well as additional cells (neuronal and non-neuronal) in both the central anxious program and the periphery [5]. (researchensemble.com)

Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). (umbc.edu)
Tyrosine-specific kinase subfamily. (unl.edu)

The discoidin domain receptors (DDRs), consisting of DDR1 and DDR2, are distinctive receptor tyrosine kinases (RTKs) and signal in response to collagens instead of soluble peptide growth factors [ 9 - 11 ]. (biomedcentral.com)
RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. (umbc.edu)
RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain, leading to intracellular signaling. (unl.edu)
Some RTKs are orphan receptors with no known ligands. (unl.edu)

Mature human ROR2 contains a 369 amino acid (aa) extracellular domain (ECD) and a 518 aa cytoplasmic tail containing an tyrosine kinase domain. (rndsystems.com)
Essential effectors of the NGF system consist of the cytoplasmic/nuclear kinases, including ribosomal T6 kinase 1 (RSK1) [11], and Nur nuclear orphan receptors [12]. (researchensemble.com)

therapeutic_agents C1909 therapeutic_agents C C177537 GDC Value Terminology C133691 Aumolertinib An orally available inhibitor of the epidermal growth factor receptor (EGFR) mutant form T790M, with potential antineoplastic activity. (nih.gov)
Adults with these cancers are eligible for a randomized, open-label, phase 3 trial comparing the investigational noncovalent Bruton tyrosine-kinase (BTK) inhibitor pirtobrutinib (from Eli Lilly) to current standard ibrutinib (Imbruvica). (medscape.com)
Nintedanib is a pan-tyrosine kinase inhibitor targeting multiple cytosolic tyrosine kinases and receptor tyrosine kinases involved in cellular proliferation and migration, and the mechanism of action of pirfenidone is not entirely elucidated, yet it suppresses endogenous transforming growth factor beta 1 (TGF- β 1) production. (aspetjournals.org)

In the field of molecular biology, receptor tyrosine kinase-like orphan receptors (RORs) are a family of tyrosine kinase receptors that are important in regulating skeletal and neuronal development, cell migration and cell polarity. (wikipedia.org)
Rors can either activate or repress Wnt target expression depending on the cellular context and can also modulate signal transduction by sequestering Wnt ligands away from their signaling receptors. (knaw.nl)

We have determined the crystal structure of Stem cell factor (SCF) and fibroblast growth factor (FGF), two ligands of receptor tyrosine kinases. (yale.edu)
Among pattern recognition receptors, DCs express C-type lectin receptors triggered by both exogenous and endogenous ligands, therefore dictating pathogen response, and also shaping T-cell immunity. (bioregate.com)

A recent study by Yamazaki et al (2023) uncovers a crucial, targetable role of tyrosine kinase-like orphan receptor (ROR1) in PDAC tumor formation and progression. (bvsalud.org)

This study was designed to evaluate chimeric antigen receptor (CAR) T cells targeting the type I insulin-like growth factor receptor (IGF1R) or tyrosine kinase-like orphan receptor 1 (ROR1) molecules for their therapeutic potential against sarcomas. (johnshopkins.edu)
Chimeric antigen receptor technology (CAR-T) has revolutionized the management of these patients. (encyclopedia.pub)
More recently, the treatment landscape of LBCL has been enriched by the endorsement of chimeric antigen receptor T-cell therapy (CAR-T) in earlier lines. (encyclopedia.pub)

7. Evolutionary divergence in the catalytic activity of the CAM-1, ROR1 and ROR2 kinase domains. (nih.gov)
Tyrosine kinase, catalytic domain. (unl.edu)

We previously described in rat, the expression of the orphan C-type lectin-like receptor-1 (CLEC-1) by DCs and demonstrated in vitro its inhibitory role in downstream T helper 17 (Th17) activation. (bioregate.com)

therapeutic_agents C1909 therapeutic_agents C C177537 GDC Value Terminology C118284 Zilovertamab A humanized monoclonal antibody against the extracellular domain of the human receptor tyrosine kinase-like orphan receptor 1 (ROR1), with potential antineoplastic activity. (nih.gov)
In addition, we have determined the crystal structure of FGF in complex with the extracellular ligand binding domain of FGF-receptor (FGFR) and with a heparin sulfate oligosacchride. (yale.edu)

A family of cell surface receptors that were originally identified by their structural homology to neurotropic TYROSINE KINASES and referred to as orphan receptors because the associated ligand and signaling pathways were unknown. (bvsalud.org)
Future challenges include the identification of signaling components of the Ror pathways and bettering our understanding of the roles of these pleiotropic receptors in patterning the nervous system. (knaw.nl)
Our laboratory is exploring the mode of action of growth factor receptors and the intracellular signaling pathways that are activated in response to growth factor stimulation. (yale.edu)
Various diseases are caused by dysfunctions in receptor tyrosine kinases or in critical components of signaling pathways that are activated by receptors tyrosine kinases. (yale.edu)

The phosphorylated tyrosine residues together with their immediate flanking sequences function as binding sites for signaling molecules containing src homology 2 (SH2) domains. (yale.edu)
The activated GTP-bound form of Ras then starts a kinase cascade composed of Raf, MAPKK, and MAPK leading to phosphorylation of prooncogene Jun on serine and threonine residues to induce transcriptional activation. (yale.edu)

2. miR-27b-3p suppresses cell proliferation through targeting receptor tyrosine kinase like orphan receptor 1 in gastric cancer. (nih.gov)
sample_type A C177537 GDC Value Terminology C116938 CDK4/6 Inhibition Inhibition of cyclin-dependent kinases 4 and 6 pathway activity to prevent proliferation of cancer cells and tumor growth. (nih.gov)

Expression of the receptor tyrosine kinase-like orphan receptor 2 (Ror2) has been identified in an increasing array of tumor types and is known to play a role as an important mediator of Wnt signaling cascades. (nih.gov)
People in the experimental group will receive IV cyclophosphamide and fludarabine for 3 days followed by a single infusion of the cell therapy, which involves patients' own T-cells being engineered to express receptors keyed to their tumor antigen-mutation profiles. (medscape.com)

ROR2 (Receptor Tyrosine Kinase-like Orphan Receptor 2) is a member of the ROR family of receptor tyrosine kinases and is important for skeletal development, including bone and cartilage formation, as well as for the development of the central nervous system (1-5). (rndsystems.com)

Cthrc1 selectively activates the planar cell polarity pathway of Wnt signaling by stabilizing the Wnt-receptor complex. (nih.gov)
Feng C, Liang S, Harold V. Wnt signals across the plasma membrane to activate the beta-catenin pathway by forming oligomers containing its receptors, Frizzled and LRP. (cams.cn)
Receptor for ligand WNT5A which activate downstream NFkB signaling pathway and may result in the inhibition of WNT3A-mediated signaling (PubMed:25029443, PubMed:27162350). (nih.gov)
Moreover, we demonstrate that CLEC-1 is a functional receptor on human moDCs and that although not modulating the spleen tyrosine kinase-dependent canonical nuclear factor-κB pathway, represses subsequent Th17 responses. (bioregate.com)

AXL is a cell surface receptor tyrosine kinase, part of the TAM family of kinases including TYRO3 and MERTK. (wikipedia.org)
3. Prognostic value of receptor tyrosine kinase-like orphan receptor (ROR) family in cancer: A meta-analysis. (nih.gov)
8. Ror family receptor tyrosine kinases regulate the maintenance of neural progenitor cells in the developing neocortex. (nih.gov)
NGF goals the RSK family members of mobile kinases and endogenous RSK1 is normally enough for Computer-12 difference [11], [13]. (researchensemble.com)

Bearing receptors for epithelial cytokines and lipid mediators, they produce IL-13, IL-5, IL-4 and IL-9 in response to IL-33, IL-25, TSLP and PGD2. (medscape.com)

13. Targeting the ROR1 and ROR2 receptors in epithelial ovarian cancer inhibits cell migration and invasion. (nih.gov)

18. Molecular, functional, and gene expression analysis of zebrafish Ror1 receptor. (nih.gov)
This gene encodes a receptor tyrosine kinase-like orphan receptor that modulates neurite growth in the central nervous system. (nih.gov)

Binding of Wnt to the receptors Frizzled (Fz) and LRP6 leads to inhibition of β-catenin degradation. (wormbook.org)

Here, we review recent progress in understanding the roles of the Ror receptors in neuronal migration, axonal pruning, axon guidance, and synaptic plasticity. (knaw.nl)

Wnt/Frizzled signaling requires dPRR, the Drosophila homolog of the prorenin receptor. (nih.gov)

In addition, various developmental disorders are caused by loss of function mutations in receptor tyrosine kinases. (yale.edu)

Has very low kinase activity in vitro and is unlikely to function as a tyrosine kinase in vivo (PubMed:25029443). (nih.gov)

TGF- β 1 nearly eliminates β 2-AR mRNA and slightly increases D1DR mRNA through an activin receptor-like kinase-dependent mechanism. (aspetjournals.org)

The structure of the ternary FGF/heparin/FGFR complex provides a molecular view of how FGF acts in concert with heparin to induce the dimerization and activation of FGF-receptors. (yale.edu)

Background and Objectives: Receptor tyrosine kinase-like orphan receptor type 1 (ROR1) plays a critical role in embryogenesis and is overexpressed in many malignant cells. (bvsalud.org)

Collectively, our results establish a role for CLEC-1 as an inhibitory receptor in DCs able to dampen activation and downstream effector Th responses. (bioregate.com)

1. Prognostic Role of Receptor Tyrosine Kinase-Like Orphan Receptors in Intestinal-Type Gastric Cancer. (nih.gov)

This receptor can also mediate cell aggregation by homophilic binding. (wikipedia.org)
The presence of the truncated somatostatin receptor sst5TMD4 has been correlated with poor prognosis in breast cancer tumorsand its overexpression in breast cancer derived cell lines is associated with increased cell malignancy. (endocrine-abstracts.org)
As a cell-surface receptor, CLEC-1 may represent a useful therapeutic target for modulating T-cell immune responses in a clinical setting. (bioregate.com)

P61959.1 MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY 1367453_at NP_446195 8.92 hsp90 co-chaperone Cdc37 Cdc37 Rattus norvegicus " Co-chaperone that binds to numerous kinases and promotes their interaction with the Hsp90 complex, resulting in stabilization and promotion of their activity. (nih.gov)

the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors (By similarity). (nih.gov)

Two of these sites, FP3 (bases −7738 to −7715) and FP4 (bases −7698 to −7682), overlapped binding motifs for the orphan human pregnane X receptor (hPXR). (aspetjournals.org)

Anatomy16

Organisms8

Diseases3

Chemicals and Drugs165

Analytical, Diagnostic and Therapeutic Techniques and Equipment14

Phenomena and Processes43

Disciplines and Occupations1

Technology, Industry, Agriculture1

Information Science3

Named Groups1

Neurotrophic Tyrosine Kinase1

Proteins9

Protein24

Transmembrane tyrosine kinase2

Subfamily2

RTKs4

Cytoplasmic2

INHIBITOR3

RORs2

Ligands2

20231

Chimeric antigen receptor3

Catalytic2

Lectin like receptor1

Extracellular2

Pathways4

Residues2

Proliferation2

Tumor2

Skeletal1

Pathway4

Family4

Cytokines1

Epithelial1

Gene2

Inhibition1

Migration1

Drosophila1

Developmental1

Vitro1

Dependent1

Dimerization1

Embryogenesis1

Activation1

Type1

Cell3

Interaction1

Activity1

Human1