The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. (antibodies-online.com)
Cysteine proteinase1
From N- to C-terminus, 206K harbors methyltransferase (MT), cysteine proteinase (PRO), helicase (HEL or 42K) and RNA-dependent RNA polymerase (POL or 66K) domains. (datexis.com)
Inhibitor1
Sacubitrilat, namely LBQ-657, is an inhibitor of endopeptidase and effective for hypertension and heart failure. (csnpharm.cn)
Protein1
The encoded protein is a member of the proteasome B-type family, also known as the T1B family, and is a 20S core beta subunit in the proteasome. (antibodies-online.com)
Activity4
First, its endopeptidase activity is required to proteolytically process 206K at the HEL/POL junctions to release the 66K polymerase, while a second cleavage at the PRO/HEL junction contributes to the regulation of viral RNA synthesis. (datexis.com)
PRO's DUB isopeptidase activity is thus also a key factor for the interaction of the virus with its host, in counteracting the ubiquitin-proteasome system and possibly subverting it into regulating availability of 66K for TYMV replication. (datexis.com)
Modelling of a PRO/ubiquitin complex, subsequent site-directed mutagenesis of PRO and enzymatic analysis of its DUB activity suggest that PRO structural elements used for specific recognition of ubiquitin overlap those used in its processing proteinase function. (datexis.com)
Bassoon inhibits proteasome activity via interaction with PSMB4. (nih.gov)
Function2
Compounds that inhibit the function or proteolytic action of the PROTEASOME. (bvsalud.org)
An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. (nih.gov)
Proteins3
There, synthesis of the viral progeny requires the establishment of specific and regulated interactions between viral proteins and different cellular factors, assembled within a replication complex. (datexis.com)
In RNA+ viruses, the replication proteins are usually synthesized as a single polypeptide chain that may be subsequently processed by viral (and sometimes also cellular) proteinases. (datexis.com)
Striations result from the complex organization of the myofibrillar proteins, responsible for the muscle contraction. (earthwormexpress.com)
Family1
Strikingly, PRO displays no homology to other processing proteinases from RNA+ viruses, including that of alphaviruses, and the closest structural homologs of PRO were identified as DUBs from the Ovarian tumor (OTU) family. (datexis.com)
Development1
Proteasome beta-4 subunit contributes to the development of melanoma and is regulated by miR-148b. (nih.gov)
Inhibitors4
Proteasome Inhibitors" is a descriptor in the National Library of Medicine's controlled vocabulary thesaurus, MeSH (Medical Subject Headings) . (ucdenver.edu)
This graph shows the total number of publications written about "Proteasome Inhibitors" by people in this website by year, and whether "Proteasome Inhibitors" was a major or minor topic of these publications. (ucdenver.edu)
Below are the most recent publications written about "Proteasome Inhibitors" by people in Profiles. (ucdenver.edu)
Measurement of ex vivo resistance to proteasome inhibitors, IMiDs, and daratumumab during multiple myeloma progression. (ucdenver.edu)
Ubiquitin4
To address this issue, we employed a recently developed and optimized three-dimensional primary Sertoli cell-gonocyte coculture system and examined the time- and dose-dependent effects of Cd on morphological alterations, cell viability, activation of stress signaling pathway proteins, and the disruption of the ubiquitin proteasome system (UPS). (nih.gov)
Using an in vitro ubiquitin conjugating-proteasome degradation system, we show that the cytosolic proteasome can degrade UCP1 at a rate commensurate with the half-life of UCP1 (i.e. 30-72h in brown adipocytes and ~3h, in thymocytes). (ox.ac.uk)
We found that RUNX1/AML1, which is essential for hematopoiesis, is continuously subjected to proteolytic degradation mediated by the ubiquitin-proteasome pathway. (nih.gov)
Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. (nih.gov)
Degradation4
Maki CG, Huibregtse JM, Howley PM. In vivo ubiquitination and proteasome-mediated degradation of p53(1). (rush.edu)
A large multisubunit complex that plays an important role in the degradation of most of the cytosolic and nuclear proteins in eukaryotic cells. (bvsalud.org)
A role for ubiquitinylation and the cytosolic proteasome in turnover of mitochondrial uncoupling protein 1 (UCP1). (ox.ac.uk)
In this study we show that mitochondrial uncoupling protein 1 (UCP1) in brown adipose tissue (BAT) and thymus mitochondria can be ubiquitinylated and degraded by the cytosolic proteasome. (ox.ac.uk)
We conclude that there is a role for ubiquitinylation and the cytosolic proteasome in turnover of mitochondrial UCP1. (ox.ac.uk)
Proteolytic2
Carfilzomib irreversibly and selectively binds to N-terminal threonine-containing active sites of the 20S proteasome, the proteolytic core particle within the 26S proteasome. (drugbank.com)
Compounds that inhibit the function or proteolytic action of the PROTEASOME. (ucdenver.edu)
Inhibition3
On Day 1 of Cycle 1, proteasome inhibition in peripheral blood mononuclear cells (PBMCs) ranged from 79% to 89% at 15 mg/m2, and from 82% to 83% at 20 mg/m2. (drugbank.com)
Proteasome inhibition was maintained for ≥ 48 hours following the first dose of carfilzomib for each week of dosing. (drugbank.com)
Proteasome Inhibition Sensitizes Liposarcoma to MDM2 Inhibition with Nutlin-3 by Activating the ATF4/CHOP Stress Response Pathway. (ucdenver.edu)
Enzyme2
Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4. (nih.gov)
In biochemistry , serine proteases or serine endopeptidases (newer name) are a class of peptidases ( enzymes that cleave peptide bonds in proteins ) that are characterised by the presence of a serine residue in the active site of the enzyme . (wikidoc.org)
Peptides1
An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. (nih.gov)
Activity3
Intravenous carfilzomib administration resulted in suppression of proteasome chymotrypsin-like activity when measured in blood 1 hour after the first dose. (drugbank.com)
P61959.1 MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY 1367453_at NP_446195 6.64 hsp90 co-chaperone Cdc37 Cdc37 Rattus norvegicus " Co-chaperone that binds to numerous kinases and promotes their interaction with the Hsp9N/A complex, resulting in stabilization and promotion of their activity. (nih.gov)
the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors (By similarity). (nih.gov)