MULTIENZYME COMPLEXESSynthaseMutantLipidsMitochondrialInitiatesMitochondriaDehydrogenaseCarrierAntibodiesNeuronsDiseasesMolecularStructuralChemistryPathwayGeneralLargeEnergyChemicalComponents of the glycine decarboEnzymesUbiquitin--proteSubstratesGABABindsDegradationHSP70MitochondrialAMMONIAPhosphorylationMembraneCYTOSKELETONSynthesisRepeatsToxicIncorporationCellularFattyRoleSmallFamilyAnimalsTransportFormationActivityLevelsSupport
MULTIENZYME COMPLEXES1
- The enzyme is a component of several MULTIENZYME COMPLEXES . (nih.gov)
Synthase1
- As an example of one of the complex transformations on this pathway, the figure below shows the structure of the pyrimidine synthase catalyzing the complex rearrangement of aminoimidazole ribotide (left) to the thiamin pyrimidine (right). (tamu.edu)
Mutant1
- A mutant form of Ub, UBB +1 is another protein that can resist proteasomal degradation. (5dok.org)
Lipids1
- In addition, neurons (and glia) are constantly synthesizing a variety of neurotransmitters, proteins for axonal flow, and proteins and lipids for regeneration of synaptic vesicles and other components of membranes. (medscape.com)
Mitochondrial5
- HADHB is a subunit of the mitochondrial trifunctional protein and has thiolase activity. (wikidoc.org)
- This gene encodes the beta subunit of the mitochondrial trifunctional protein, a catalyst of mitochondrial beta-oxidation of long chain fatty acids . (wikidoc.org)
- The genes of the alpha and beta subunits of the mitochondrial trifunctional protein are located adjacent to each other in the human genome in a head-to-head orientation. (wikidoc.org)
- Furthermore, in AD brains, mitochondrially associated APP formed stable ∼480 kDa complexes with the translocase of the outer mitochondrial membrane 40 (TOM40) import channel and a super complex of ∼620 kDa with both mitochondrial TOM40 and the translocase of the inner mitochondrial membrane 23 (TIM23) import channel TIM23 in an "N in mitochondria -C out cytoplasm " orientation. (jneurosci.org)
- Accumulation of APP across mitochondrial import channels, which varied with the severity of AD, inhibited the entry of nuclear-encoded cytochrome c oxidase subunits IV and Vb proteins, which was associated with decreased cytochrome c oxidase activity and increased levels of H 2 O 2 . (jneurosci.org)
Initiates2
- Thus the formation of aggregates renders these toxic proteins resistant to proteasomal degradation and initiates the accumulation of polyGln proteins and polyGln-interacting proteins. (5dok.org)
- The basic reason why BCAAs work to build and preserve muscle is that leucine is the primary activator of the mammalian target of rapamycin (mTOR), [1-4] which initiates muscle protein synthesis in the human body. (priceplow.com)
Mitochondria1
- Here we report that nonglycosylated full-length and C-terminal truncated amyloid precursor protein (APP) accumulates exclusively in the protein import channels of mitochondria of human AD brains but not in age-matched controls. (jneurosci.org)
Dehydrogenase1
- [4] Trifunctional protein deficiency is characterized by decreased activity of long-chain 3-hydroxyacyl-CoA dehydrogenase (LCHAD), long-chain enoyl-CoA hydratase, and long-chain thiolase. (wikidoc.org)
Carrier2
- Carrier proteins. (lookformedical.com)
- Current, antibody-based diagnostical methods utilize antibodies against histamine raised by conjugating histamine to a large immunogenic protein carrier, such as bovine serum albumin (BSA) or ovalbumin (OVA) via its primary amine group. (justia.com)
Antibodies1
- Consequently, only the imidazole will be exposed to lymphocytes, which commonly results in generation of antibodies that recognize protein-bound histamine with only limited affinity and sensitivity for free histamine. (justia.com)
Neurons1
- Nevertheless, in neurodegenerative diseases these proteins accumulate with disastrous consequences for neurons, eventually leading to cell death. (5dok.org)
Diseases2
Molecular1
- Our research involves a combination of molecular biology, protein biochemistry, organic synthesis and structural studies and provides a strong training for students interested in understanding the organic chemistry of living systems and in pursuing careers in biotechnology, drug design or academia. (tamu.edu)
Structural1
- Combining NMR and small angle X-ray and neutron scattering in the structural analysis of a ternary protein-RNA complex. (ibs.fr)
Chemistry1
- The Begley Group is interested in the mechanistic chemistry and enzymology of complex organic transformations, particularly those found on the vitamin biosynthetic pathways. (tamu.edu)
Pathway3
- Characterization of a pre-export enzyme-chaperone complex on the twin-arginine transport pathway. (ibs.fr)
- The ubiquitin-proteasome system (UPS) is the main pathway in the cell for the elimination of aberrant or misfolded proteins. (5dok.org)
- The major constituent of a senile plaque is β-amyloid (Αβ), which is a 40-43 amino acid peptide produced by the action of secretory pathway-associated proteases, namely β and γ secretases, at the C terminus of a type I membrane-spanning glycoprotein termed amyloid precursor protein (APP). (jneurosci.org)
General1
- These studies focus on the degradation of specific disease related proteins and the general status of the UPS under conditions of an excess of aberrant or misfolded proteins. (5dok.org)
Large1
- Deciphering the role of large ATP-independent peptidases complexes in extremophilic Archaea . (ibs.fr)
Energy1
- Ruminants (foregut fermentors) benefit from microbial protein as well as the absorption of energy that is released by anaerobic microorganisms in the form of fermentation acids [ 2 ]. (animbiosci.org)
Chemical1
- The biosyntheses of the thiamin pyrimidine and thiazole are complex and are different from any of the characterized chemical or biochemical routes to these heterocycles. (tamu.edu)
Components of the glycine decarbo2
- A LIPOIC ACID -containing protein that plays the pivotal role in the transfer of methylamine groups and reducing equivalents between the three enzymatic components of the glycine decarboxylase complex. (bvsalud.org)
- It is one of four components of the glycine decarboxylase complex. (uchicago.edu)
Enzymes2
- Large enzyme complexes composed of a number of component enzymes that are found in STREPTOMYCES which biosynthesize MACROLIDES and other polyketides. (nih.gov)
- Thiamine pyrophosphate (also called thiamine diphosphate) is derived from vitamin Bi (thiamine) and has the structure: The thiazole ring can lose a proton to produce a negatively-charged carbon atom: This is a potent nucleophile and can participate in covalent catalysis, particularly with α-keto (oxo) acid decarboxylase, α-keto acid oxidase, transketolase and phosphoketolase enzymes. (ferienwohnung-gluecksburg.net)
Ubiquitin--prote1
- Regulates E3 ubiquitin-protein ligase activity of RNF19A (By similarity). (nih.gov)
Substrates1
- Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4. (nih.gov)
GABA4
- Evolutionary conserved low-molecular-weight transmitters (glutamate, aspartate, glycine, GABA, and ATP) acted as coordinators of distinct locomotory and feeding patterns. (frontiersin.org)
- Specifically, L-glutamate induced and partially mimicked endogenous feeding cycles, whereas glycine and GABA suppressed feeding. (frontiersin.org)
- Glycine and GABA increased the frequency of turns. (frontiersin.org)
- Furthermore, we view the integration of feeding behaviors in nerveless animals by amino acids as ancestral exaptations that pave the way for co-options of glutamate, glycine, GABA, and ATP as classical neurotransmitters in eumetazoans. (frontiersin.org)
Binds4
- Arp2-3 complex binds WASP PROTEIN and existing ACTIN FILAMENTS, and it nucleates the formation of new branch point filaments. (nih.gov)
- HN - 2006 BX - Arp2-3 Complex MH - Actin-Related Protein 3 UI - D051378 MN - D5.750.78.730.246.750 MN - D12.776.220.525.246.750 MS - A component of the Arp2-3 complex that is related in sequence and structure to ACTIN and that binds ATP. (nih.gov)
- P61959.1 MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY 1367453_at NP_446195 6.42 hsp90 co-chaperone Cdc37 Cdc37 Rattus norvegicus " Co-chaperone that binds to numerous kinases and promotes their interaction with the Hsp90 complex, resulting in stabilization and promotion of their activity. (nih.gov)
- The ternary complex containing UFD1L, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. (nih.gov)
Degradation1
- Polymeric SUMO2 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins (By similarity). (nih.gov)
HSP701
- In Drosophila , ubiquitin proteasome system (UPS) impairment leads to enhancement of CGG-repeat-induced degeneration, whereas overexpression of the chaperone protein HSP70 suppresses this toxicity. (sdbonline.org)
Mitochondrial1
- Alternative name(s): Mitochondrial uncoupling protein 1. (ferienwohnung-gluecksburg.net)
AMMONIA2
Phosphorylation1
- The phosphorylation of a given sugar requires four proteins, two general proteins, Enzyme I and HPr and a pair of sugar-specific proteins designated as the Enzyme II complex. (nih.gov)
Membrane1
- The Transporter Classification Database (or TCDB ) is an International Union of Biochemistry and Molecular Biology (IUBMB)-approved classification system for membrane transport proteins , including ion channels . (wikipedia.org)
CYTOSKELETON1
- HN - 2006(1998) MH - Actin-Related Protein 2-3 Complex UI - D051376 MN - D5.750.78.730.246 MN - D12.776.220.525.246 MS - A complex of seven proteins including ARP2 PROTEIN and ARP3 PROTEIN that plays an essential role in maintenance and assembly of the CYTOSKELETON. (nih.gov)
Synthesis1
- Unfortunately, synthetic polymers such as these suffer from the effects of polydispersity, lack of architectural control, variable levels of biocompatibility, and complex synthesis schemes. (justia.com)
Repeats1
- The earlier finding that CGG repeats support RAN translation to produce homopolymeric proteins containing polyglycine and (in cell culture models) polyalanine suggests one possible mechanism by which this might occur. (sdbonline.org)
Toxic1
- However, recent studies demonstrate that the repeat also elicits production of a toxic polyglycine protein, FMRpolyG, via repeat-associated non-AUG (RAN)-initiated translation. (sdbonline.org)
Incorporation1
- GTP but cannot hydrolyze it inhibits incorporation of the MCM helicase into pre-replication complexes (pre-RC's) in Xenopus egg extracts. (nih.gov)
Cellular1
- This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. (nih.gov)
Fatty1
- TPP is required by this component of the peroxisomal enzyme complex involved in fatty acid catabolism.41 This enzyme catalyzes the TPP-dependent cleavage of 2-hydroxy fatty acids (e.g., 2-hydroxyoctadecanoic acid42) to yield formate and a 1C-shortened aldehyde. (ferienwohnung-gluecksburg.net)
Role2
- This paper (Cell 113, 115-125, April 4, 2003) reports results of experiments that together strongly support the conclusion that, in metazoan cells, formation of a complex consisting of the GTP binding protein Ran, the exportin Crm1, and the DNA helicase MCM plays a critical role in limiting DNA replication to a single round each cell cycle. (nih.gov)
- Yet, the exact role that these proteins play in UPS impairment and disease pathogenesis is unclear (Oh, 2015). (sdbonline.org)
Small3
- For example, such an ELP composition may comprise an ELP complexed with a therapeutic small molecule, polypeptide or nucleic acid. (justia.com)
- For instance, an ELP composition may comprise an ELP domain covalently linked to a small molecule or an ELP linked to a therapeutic polypeptide by a peptide bond (i.e. an ELP fusion protein). (justia.com)
- Probe Set ID Ref Seq Protein ID Signal Strength Name Gene Symbol Species Function Swiss-Prot ID Amino Acid Sequence 1367452_at NP_598278 7.9 small ubiquitin-related modifier 2 precursor Sumo2 Rattus norvegicus " Ubiquitin-like protein that can be covalently attached to proteins as a monomer or as a lysine-linked polymer. (nih.gov)
Family1
- HN - 2006(1981) BX - Actin-Capping Proteins MH - Actin Depolymerizing Factors UI - D051339 MN - D5.750.78.730.212 MN - D12.776.220.525.212 MS - A family of low MOLECULAR WEIGHT actin-binding proteins found throughout eukaryotes. (nih.gov)
Animals1
- Placozoans are the simplest known free-living animals without recognized neurons and muscles but a complex behavioral repertoire. (frontiersin.org)
Transport1
- Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. (nih.gov)
Formation1
- The NPLOC4-UFD1L-VCP complex regulates spindle disassembly at the end of mitosis and is necessary for the formation of a closed nuclear envelope. (nih.gov)
Activity2
- The above paper describes the purification and characterization of a pathogen-inducible NOS- like activity from tobacco plants and its identification as a variant form of the P subunit of the glycine decarboxylase complex. (nih.gov)
- The demonstration that recombinant Arabidopsis variant P protein has NO-synthesizing activity was a critical piece of evidence leading to the above conclusion. (nih.gov)
Levels1
- It is expressed at higher levels than ARP2 PROTEIN and does not contain a PROFILIN binding domain. (nih.gov)
Support1
- Therefore, although experiments using RanQ69L support a model involving the Crm1-MCM complex to limit re-replication, the inability of RanT24N to induce re-replication leaves the model unproven. (nih.gov)