Receptor tyrosinHeterotrimeric G proteiGuanine nucleotidePhosphatidylinositolHydrolysisCytoskeletalReceptorsExtracellularBiologicalMutationsIsoformsGenesMolecularApoptosisPathwaysRegulationFamilyPlayClassSmallRoleFoundHeterotrimeric GTP-bindTyrosineGTPaseResiduesMediatePhospholipaseInositolActivityCellularNuclearSignalFormationBetaDatabase
Receptor tyrosin1
- A range of agonists acting through G protein-coupled receptors and receptor tyrosine kinases stimulate this hydrolysis. (wikipedia.org)
Heterotrimeric G protei1
- They share a common structure and signal through HETEROTRIMERIC G-PROTEINS. (lookformedical.com)
Guanine nucleotide1
- Regulators of small G-proteins like guanine nucleotide releasing factor GNRP (Ras-GRF) (which contains 2 PH domains), guanine nucleotide exchange proteins like vav, dbl, SoS and Saccharomyces cerevisiae CDC24, GTPase activating proteins like rasGAP and BEM2/IPL2, and the human break point cluster protein bcr. (embl.de)
Phosphatidylinositol1
- Point mutations cluster into the positively charged end of the molecule around the predicted binding site for phosphatidylinositol lipids. (embl.de)
Hydrolysis1
- They associate with microtubule bundles (MICROTUBULES) and are believed to produce mechanical force via a process linked to GTP hydrolysis. (lookformedical.com)
Cytoskeletal2
- Cytoskeletal proteins such as dynamin (see IPR001401 ), Caenorhabditis elegans kinesin-like protein unc-104 (see IPR001752 ), spectrin beta-chain, syntrophin (2 PH domains) and S. cerevisiae nuclear migration protein NUM1. (embl.de)
- Clathrin also interacts with cytoskeletal proteins. (lookformedical.com)
Receptors5
- RAS family proteins mediate extracellular signals, transduced through their receptors, with multiple signaling pathways, and consequently regulate a wide array of cellular processes [ 8 ] . (encyclopedia.pub)
- Regulatory proteins that down-regulate phosphorylated G-protein membrane receptors, including rod and cone photoreceptors and adrenergic receptors. (lookformedical.com)
- A family of serine-threonine kinases that are specific for G-PROTEIN-COUPLED RECEPTORS. (lookformedical.com)
- A ubiquitously expressed G-protein-coupled receptor kinase subtype that has specificity for the agonist-occupied form of BETA-ADRENERGIC RECEPTORS and a variety of other G-PROTEIN-COUPLED RECEPTORS. (lookformedical.com)
- A family of G-protein-coupled receptors that was originally identified by its ability to bind N-formyl peptides such as N-FORMYLMETHIONINE LEUCYL-PHENYLALANINE. (lookformedical.com)
Extracellular1
- The process of moving proteins from one cellular compartment (including extracellular) to another by various sorting and transport mechanisms such as gated transport, protein translocation, and vesicular transport. (lookformedical.com)
Biological2
- Thus, we have reviewed the role of RAS protein related to the biological events of the corpus luteum in the ovary. (encyclopedia.pub)
- Eye proteins are the biological molecules that make up the various structures of the eye and are essential for its proper function. (lookformedical.com)
Mutations2
- Scope includes mutations and abnormal protein expression. (cancerindex.org)
- Mutations in Brutons tyrosine kinase (Btk) within its PH domain cause X-linked agammaglobulinaemia (XLA) in patients. (embl.de)
Isoforms2
- The paralog group of RAS proteins is composed of four isoforms (H-RAS, N-RAS, K-RAS4A, and K-RAS4B) that are encoded by three genes, H-RAS , N-RAS , and K-RAS [ 6 ] . (encyclopedia.pub)
- Several isoforms of the protein with molecular sizes of 47 kDa and 52 kDa exist due to multiple ALTERNATIVE SPLICING. (lookformedical.com)
Genes1
- RAS family proteins include 23 genes coding for at least 25 proteins that are divided into eight paralog groups based on sequence identity, structure, and function: RAS, RAS-like (RAL), RAS-related protein (R-RAS), RAS-like protein in tissues (RIT), RAS-related protein Rap (RAP), RAS homolog enriched in brain (RHEB), Dexamethasone-induced RAS-related protein (RASD), and GTP-binding protein Di-RAS (DIRAS) [ 5 ] . (encyclopedia.pub)
Molecular6
- RAS protein plays a vital role in the modulation of cell survival, proliferation, and differentiation by molecular pathway signaling. (encyclopedia.pub)
- In cellular signaling, the monomeric small GTPases (small G proteins) are known to play an important role in diverse molecular processes. (encyclopedia.pub)
- The RAS family proteins act as binary molecular switches that cycle between active guanosine triphosphate (GTP)-bound and inactive guanosine diphosphate (GDP)-bound states [ 9 ] . (encyclopedia.pub)
- RAS family proteins play a vital role in the modulation of cell survival, proliferation, and differentiation by signaling through a set of molecular pathways [ 10 ] . (encyclopedia.pub)
- Those molecular functions of RAS family proteins exhibit an essential role that co-occurs in the repeated pattern of physiological change during the ovarian cycle. (encyclopedia.pub)
- A family of high molecular weight GTP phosphohydrolases that play a direct role in vesicle transport. (lookformedical.com)
Apoptosis1
- A c-jun amino-terminal kinase that is found predominantly within NEURONS of the BRAIN, suggesting a role in stress-induced neuronal APOPTOSIS. (lookformedical.com)
Pathways2
- What pathways are this gene/protein implicaed in? (cancerindex.org)
- Through these interactions, PH domains play a role in recruiting proteins to different membranes, thus targeting them to appropriate cellular compartments or enabling them to interact with other components of the signal transduction pathways. (embl.de)
Regulation2
- Several S. cerevisiae proteins involved in cell cycle regulation and bud formation like BEM2, BEM3, BUD4 and the BEM1-binding proteins BOI2 (BEB1) and BOI1 (BOB1). (embl.de)
- A G-protein-coupled receptor kinase subtype that is primarily expressed in the MYOCARDIUM and may play a role in the regulation of cardiac functions. (lookformedical.com)
Family4
- The small-G-protein family consists of numerous proteins with varying degrees of homology, one of which is a guanosine nucleotide-binding protein (RAS) [ 4 ] . (encyclopedia.pub)
- RAS family proteins are membrane-associated, small GTPases that have the function of transmitting a multitude of cellular signals [ 7 ] . (encyclopedia.pub)
- The domain family possesses multiple functions including the abilities to bind inositol phosphates, and various proteins. (embl.de)
- Ser/Thr protein kinases such as the Akt/Rac family, the beta-adrenergic receptor kinases, the mu isoform of PKC and the trypanosomal NrkA family. (embl.de)
Play3
- They are regulatory proteins that play a role in G-protein-coupled receptor densensitization. (lookformedical.com)
- Although it is highly homologous to G-PROTEIN-COUPLED RECEPTOR KINASE 2, it is not considered to play an essential role in regulating myocardial contractile response. (lookformedical.com)
- The main structural coat protein of COATED VESICLES which play a key role in the intracellular transport between membranous organelles. (lookformedical.com)
Class1
Small2
- Metformin (MTF) has been reported to target NLK (Nemo-like kinase) to inhibit non-small lung cancer cells. (cancerindex.org)
- Pleckstrin homology (PH) domains are small modular domains that occur in a large variety of proteins. (embl.de)
Role1
- Recently, we focused on the role of RAS protein in the ovarian corpus luteum. (encyclopedia.pub)
Heterotrimeric GTP-bind1
- 18. Compound 48/80 activates mast cell phospholipase D via heterotrimeric GTP-binding proteins. (nih.gov)
Tyrosine5
- A range of agonists acting through G protein-coupled receptors and receptor tyrosine kinases stimulate this hydrolysis. (wikipedia.org)
- 4. The roles of protein kinase C and tyrosine kinases in mediating endothelin-1-stimulated phospholipase D activity in rat myometrium: differential inhibition by ceramides and cyclic AMP. (nih.gov)
- 5. Inhibition by toxin B of inositol phosphate formation induced by G protein-coupled and tyrosine kinase receptors in N1E-115 neuroblastoma cells: involvement of Rho proteins. (nih.gov)
- Mutations in Brutons tyrosine kinase (Btk) within its PH domain cause X-linked agammaglobulinaemia (XLA) in patients. (embl.de)
- Tyrosine protein kinases belonging to the Btk/Itk/Tec subfamily. (embl.de)
GTPase2
- A GTP-binding protein with low intrinsic GTPase activity that activates MTORC1 protein kinase activity. (nih.gov)
- Regulators of small G-proteins like guanine nucleotide releasing factor GNRP (Ras-GRF) (which contains 2 PH domains), guanine nucleotide exchange proteins like vav, dbl, SoS and Saccharomyces cerevisiae CDC24, GTPase activating proteins like rasGAP and BEM2/IPL2, and the human break point cluster protein bcr. (embl.de)
Residues1
- This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. (nih.gov)
Mediate1
- 12. Calcium and protein kinase C (PKC)-related kinase mediate alpha 1A-adrenergic receptor-stimulated activation of phospholipase D in rat-1 cells, independent of PKC. (nih.gov)
Phospholipase7
- 3. Cross-talk between receptor-mediated phospholipase C-beta and D via protein kinase C as intracellular signal possibly leading to hypertrophy in serum-free cultured cardiomyocytes. (nih.gov)
- 10. Endothelin-1-induced phospholipase C-beta and D and protein kinase C isoenzyme signaling leading to hypertrophy in rat cardiomyocytes. (nih.gov)
- 13. Sphingosylphosphorylcholine generates reactive oxygen species through calcium-, protein kinase Cdelta- and phospholipase D-dependent pathways. (nih.gov)
- 14. Contribution of phospholipase D in endothelin-1-mediated extracellular signal-regulated kinase activation and proliferation in rat uterine leiomyoma cells. (nih.gov)
- 15. Ral and Rho-dependent activation of phospholipase D in v-Raf-transformed cells. (nih.gov)
- 17. Metabotropic glutamate receptors activate phospholipase D in astrocytes through a protein kinase C-dependent and Rho-independent pathway. (nih.gov)
- 19. Phospholipase D in rat myocardium: formation of lipid messengers and synergistic activation by G-protein and protein kinase C. (nih.gov)
Inositol1
Activity3
- Type II Diabetes: the protein PED/PEA15 is often elevated in type II diabetic patients, thus enhancing PLD1 activity, and in turn impairing insulin. (wikipedia.org)
- P61959.1 MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY 1367453_at NP_446195 6.42 hsp90 co-chaperone Cdc37 Cdc37 Rattus norvegicus " Co-chaperone that binds to numerous kinases and promotes their interaction with the Hsp90 complex, resulting in stabilization and promotion of their activity. (nih.gov)
- Regulates E3 ubiquitin-protein ligase activity of RNF19A (By similarity). (nih.gov)
Cellular1
- Through these interactions, PH domains play a role in recruiting proteins to different membranes, thus targeting them to appropriate cellular compartments or enabling them to interact with other components of the signal transduction pathways. (embl.de)
Nuclear1
Signal1
Formation1
Beta1
- Ser/Thr protein kinases such as the Akt/Rac family, the beta-adrenergic receptor kinases, the mu isoform of PKC and the trypanosomal NrkA family. (embl.de)