Malaria-causing parasites have a life cycle with unique cell-division cycles, and a repertoire of divergent CDKs and cyclins of poorly understood function and interdependency. (elifesciences.org)
Four CDKs (CDKs 1, 2, 4 and 6) and their activating cyclins (A, B, D and E), play key roles in cell cycle progression. (sdstate.edu)
While, expression and activity of cyclins and CDKs are tightly regulated in normal cells, they are often deregulated in cancer cells through frequent overexpression and frequent inactivation. (sdstate.edu)
To address this, numerous biochemical, molecular biological studies were carried out in multiple cancer cell lines along with molecular docking studies to determine the interactions between aspirin/salicylic acid with CDKs and cyclins. (sdstate.edu)
PCTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. (umbc.edu)
Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. (umbc.edu)
Cyclin-dependent kinases (CDKs) are key regulatory enzymes that control cell cycle transitions and the commitment to cell division. (nih.gov)
Cyclin-dependent kinases (CDKs) play a pivotal role in cell cycle regulation, and their dysregulation is implicated in cancer. (nih.gov)
We have a long-standing interest in understanding disorder-function relationships for two prototypical disordered proteins, p21 and p27, that are key regulators of the cyclin-dependent kinases (Cdks) that control cell division. (stjude.org)
Of these, five are divergent CDK-related kinases (CRK), i.e. they are clearly related to CDKs but have no clear orthologues in the yeast or human kinomes. (elifesciences.org)
Liberated Cdc14 dephosphorylates mitotic Clb cyclin reliant kinases (Clb-CDKs) and their substrates to market leave from mitosis [3]C[6]. (bioinf.org)
Cyclin-dependent kinases (CDKs) are commonly known by their role in cell cycle regulation which affects cancer mechanism. (iospress.com)
Cyclin-dependent kinases (CDKs) are central to the cell cycle control system, and deregulation of these kinases leads to the development of malignancies, including breast cancer. (bvsalud.org)
The pursuit of drugs that inhibit cyclin-dependent kinases (CDKs) has been an intense area of research for more than 15 years. (sdstate.edu)
In mammalian cells, cell cycle is controlled by the sequential activation of cyclin dependent kinases (CDKs). (sdstate.edu)
The profiling of compound 51 against a panel of 339 kinases revealed high selectivity for CDKs, with preference for CDK2 and CDK5 over CDK9, CDK1, CDK4, and CDK6. (proteopedia.org)
The transition from G1 into DNA replication (S phase) is an emergent behavior resulting from dynamic and complex interactions between cyclin-dependent kinases (Cdks), Cdk inhibitors (CKIs), and the anaphase-promoting complex/cyclosome (APC/C). Understanding the cellular decision to commit to S phase requires a quantitative description of these interactions. (nih.gov)
In this process Tat enhances phosphorylation of the C-terminal domain (CTD) of RNAPII by activating cell cycle-dependent kinases (CDKs) associated with general transcription factors of the promoter complex, specifically CDK7 and CDK9. (howard.edu)
P61959.1 MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY 1367453_at NP_446195 8.92 hsp90 co-chaperone Cdc37 Cdc37 Rattus norvegicus " Co-chaperone that binds to numerous kinases and promotes their interaction with the Hsp90 complex, resulting in stabilization and promotion of their activity. (nih.gov)
This protein belongs to a kinase family that includes serine/arginine-rich protein-specific kinases and cyclin-dependent kinases (CDKs). (nih.gov)
Inhibitors2
By docking results and viewed interactions, some molecules are identified and discussed as potential CDK2 inhibitors. (iospress.com)
In fact, it turns out that these different allosteric regulators profoundly alter allosteric interactions with inhibitors. (levinsonlab.org)
Protein-protein inte2
The phosphorylation of initiation factor Sld2 by S -phase Cdks (S-Cdks) triggers the protein-protein interactions between Sld2 and Dbp11. (medscape.com)
Aurora A has a wealth of interaction partners, and these protein-protein interactions recruit the kinase to different cellular locations to perform a range of functions. (levinsonlab.org)
Phosphorylation7
[ 52 ] The multiple phosphorylation sites on Sld2 by S-Cdks are regulated differently, with the key site on the threonine 84 residue phosphorylated only when Sld2 is hyperphosphorylated by S-Cdks on other loci, causing a conformation change of Sld2 to reveal the Thr84 site. (medscape.com)
The activity of these complexes is modulated by activating and inhibitory phosphorylation events, as well as by interactions with small regulatory proteins including, p16, p21, p27 and others. (bdbiosciences.com)
Upon admittance into anaphase, nevertheless, this interaction can be dissolved via the phosphorylation of Cfi/Online1, which is essential for the discharge of Cdc14 through the nucleolus [1]C[3]. (bioinf.org)
Phosphorylation of RB1 disturbs its interaction with E2F1. (proteopedia.org)
Cdk phosphorylation triggers sequential intramolecular interactions that progressively block Rb functions as cells move through G1. (proteopedia.org)
A huge selection of Cdk substrates have already been discovered in proteomic displays and Cdk phosphorylation alters the positioning interactions balance and activity of the target protein4 5 A deregulated cell routine AWD 131-138 is certainly a hallmark of cancers emphasizing the necessity for restricted coordination of Cdk activity6. (conferencedequebec.org)
We suggest that CDK2 is part of a transcription complex that is required for Tat-dependent transcription and that interaction of Tat with CTD and a dynamic association of Tat with CDK2/cyclin E stimulated CTD phosphorylation by CDK2. (howard.edu)
CDK24
Additionally, the study explores the diversity of CDK-cyclin interacting pairs, evaluating whether other CDKs have multiple cyclin partners as observed in CDK2, and the implications of these interactions on cell cycle progression. (nih.gov)
p21, also known as senescent cell-derived inhibitor 1 (Sdi1), wild-type p53-activated fragment 1 (Waf1), Cdk-interacting protein 1 (Cip1), and p53-regulated inhibitor of Cdks (Pic1) inhibits cyclin D-cdk4, cyclin E-cdk3, cyclin A-cdk2, and cyclin A-cdk1. (bdbiosciences.com)
Molecular docking studies identified Asp145 and Lys33 as the potential sites of salicylic acid interactions with CDK2. (sdstate.edu)
RHD is involved in DNA binding, dimerization and NF-κB/REL inhibitor interaction. (wikipedia.org)
Current efforts are focused on studying how evolutionary divergence among CDKs has altered the allosteric coupling between the cyclin and CDK subunits, resulting in altered activation dynamics and pronounced differences in inhibitor recognition. (levinsonlab.org)
We are studying how the diverse array of allosteric interactions of Aurora A and Aurora B regulate kinase function and modulate inhibitor recognition. (levinsonlab.org)
Kinase1
Activation of the CDKs is triggered by the binding of an activating cyclin subunit, which drives conformational changes in the kinase domain to bring about kinase activation. (levinsonlab.org)
Substrates1
Still many queries remain relating to how regulatory protein recognize Cdks and exactly how Cdks discriminate among substrates to phosphorylate them in the correct order AWD 131-138 with the appropriate situations in the cell routine. (conferencedequebec.org)
Eukaryotic cell1
A substantial portion of the regulatory interactions in the higher eukaryotic cell are mediated by simple sequence motifs in the regulatory segments of genes and (pre-)mRNAs, and in the intrinsically disordered regions of proteins. (biomedcentral.com)
Replication2
activated by interaction with cyclin E during the early stages of DNA synthesis to permit G1-S transition, and subsequently activated by cyclin A2 (cyclin A1 in germ cells) during the late stages of DNA replication to drive the transition from S phase to mitosis, the G2 phase. (proteopedia.org)
Ohno had in fact explored the most likely reason for this difference: "hub" genes with many interactions with other loci, be those interactions regulatory, protein interaction or metabolic, will tend to respond poorly to a change in copy number. (hindawi.com)
In many cancer types, CDKs show extreme activity or CDK inhibiting proteins are dysfunctional. (iospress.com)
Both proteins mediate protein-protein and protein-RNA interactions for cooperative RNA-binding during spliceosome assembly. (cipsm.de)
Cellular1
9. Characterization of murine gammaherpesvirus 68 v-cyclin interactions with cellular cdks. (nih.gov)
Yeast1
We addressed the possibility that Cak1 is also required for the activation of other yeast CDKs, such as Kin28, Pho85, and Srb10. (ox.ac.uk)
Inhibitory1
Although these experiments do not allow us to discriminate between complexes that may contain one or more molecules of p21Cthe latter being the proposed inhibitory form of p21 (10)Cthey nevertheless indicate the complete loss of activity of Cdks upon association with p21 inhibitory activity for p21 (18). (ap26113.com)
Activity1
Despite salicylic acid interacting with CDK 1 and 2 via interactions using amino acids in the active site of the enzyme, inhibition of the enzyme activity was not observed. (sdstate.edu)
Family1
The studies carried out during the course of this dissertation work have established that aspirin, salicylic acid and salicylic acid metabolites and derivatives target all more 4 members of CDK family namely CDKs 1, 2, 4 and 6, the major findings of which are detailed below. (sdstate.edu)
Cancer1
Our studies demonstrate that both aspirin and its primary metabolite, salicylic acid, decreased cyclin A2, B1, D3, CDKs 1, 2, 4 and 6 protein levels in a diverse panel of cancer cell lines. (sdstate.edu)
Research1
My overall research goals are to define the interactions of AAV with its target cell and to develop improved vectors for gene transfer. (nih.gov)
Complex1
The interactions between the capsid of an AAV particle and its host cells that result in transduction are complex and largely not understood. (nih.gov)
Phase1
also called CCNA1) cyclin A, a cell cycle inducible protein, prominent in S-phase, which activates cdks. (nih.gov)
Domain3
The main regulatory interaction involves ubiquitination by MDM2 RING domain, leading to p53 degradation. (nih.gov)
No pairwise interactions are available for this conserved domain. (umbc.edu)
HIV-1 Tat interaction with RNA polymerase II C-terminal domain (CTD) a" by Longwen Deng, Tatyana Ammosova et al. (howard.edu)
Apply1
Our underlying hypothesis is that by understanding these interactions as they apply to the biology of the virus, we can contribute to the development and use of AAV vectors for gene therapy. (nih.gov)
Small1
We also use p27 as a model system for studies of small molecule/disordered protein interactions. (stjude.org)