Tyrosine kinasePhosphorylationIntegrinFibroblastsInhibitorTumorProteinAutophagyMigrationMechanismPharmacologicMechanismsStructuralCellImplicated in severalImportantMoleculesInducesTyrosineKEGGProliferationProteinsEndothelial cellsInhibitoryMotilityCatalytic cleftActivationCellularCytoskeletonInteractionTherapiesActivityFunctionsCellsBreastTechniques
Tyrosine kinase5
- Focal adhesion kinase (FAK) is a tyrosine kinase localized at the site of focal adhesions (FA). (aacrjournals.org)
- In addition, the BCR-ABL fusion gene product, a constitutively activated tyrosine kinase which is crucial for the development of chronic myeloid leukemia (CML), is highly sensitive to bosutinib. (mdm2-receptor.com)
- Interestingly, distinctly lower concentrations of bosutinib are required to ablate BCR-ABL phosphorylation when compared to the first-generation tyrosine kinase inhibitor imatinib (IM). (mdm2-receptor.com)
- Bosutinib has the potency to induce deep and fast responses in second- and third-/fourth-line treatment, and as a consequence, the drug has recently been licensed for patients previously treated with one or more tyrosine kinase inhibitor(s) and for whom imatinib, nilotinib, and dasatinib are not considered appropriate treatment options. (mdm2-receptor.com)
- The tyrosine kinase Src is a member of a family of related kinases known as the Src family kinases (SFKs) that share a common structural organization and function as key regulators of signal transduction pathways triggered by a wide variety of surface receptors, including receptor tyrosine kinases, integrins, G-protein-coupled receptors, and antigen receptors (Thomas and Brugge 1997). (mdm2-receptor.com)
Phosphorylation4
- Endostatin inhibits endothelial cell migration by inhibiting phosphorylation of focal adhesion kinase via binding to α5β1 integrin (Wickstrom et al. (justia.com)
- Tyr14 phosphorylation by Src, Fyn or Abl tyrosine kinases, has been linked to various cellular phenomena including mechano-transduction, signal transduction, endocytosis, cell migration and focal adhesion dynamics. (diff.org)
- DUSP3 regulated OCLN ubiquitination and degradation through decreasing OCLN tyrosine phosphorylation directly or through suppressing focal adhesion kinase, the OCLN kinase. (biomedcentral.com)
- Pharmacologic blockade of PKC inhibits cell adhesion and spreading as well as focal adhesion formation and focal adhesion kinase (FAK) phosphorylation [13,14]. (mirnamimic.com)
Integrin9
- Inhibition of cell/substrate adhesion with specific anti-integrin antibodies demonstrated that P-FAKSer732 activation is not induced by integrin clustering. (aacrjournals.org)
- tTG-FN supports RGD-independent cell adhesion of different cell types and the formation of distinctive RhoA-dependent focal adhesions following inhibition of integrin function by competitive RGD peptides and function blocking antiintegrin antibodies α5β1. (ntu.ac.uk)
- We propose a novel RGD-independent cell adhesion mechanism that promotes cell survival when the anti-apoptotic role mediated by RGD-dependent integrin function is reduced as in tissue injury, which is consistent with the externalisation and binding of tTG to fibronectin following cell damage/stress. (ntu.ac.uk)
- Focal Adhesion Kinase (FAK) is a Src-regulated, integrin-effector kinase that is frequently elevated in cancer, and there are a number of small molecule FAK inhibitors currently in clinical development. (ncri.org.uk)
- Using mutant Ras-dependent models of Squamous Cell Carcinoma (SCC) and pancreatic cancer, we have uncovered a mechanism that tumour cells use to survive when flux through the integrin/Src/FAK pathway is severely perturbed. (ncri.org.uk)
- Adhesion stress, including that caused by deletion of FAK, promotes selective sequestration of active Src away from integrin adhesions and into intracellular autophagic structures and on for lysosomal degradation. (ncri.org.uk)
- In experiments probing for a role of PKCa in human laminin-2-integrin-mediated cell adhesion and spreading of PC12 cells, we observed unexpected enhancements of adhesion, spreading and stress fiber formation to 1 mM Go¨6976 with concomitant increase in membrane translocation of PKCd and autophosphorylation of focal adhesion kinase (FAK). (mirnamimic.com)
- Biological activities of laminin are mediated through binding to a subset of integrin family of cell adhesion receptors, a3b1, a6b1, a6b4, and a7b1 [2]. (mirnamimic.com)
- PKC family of serine-threonine kinases plays key roles in many of the signaling pathways that control cellular function, including those mediated through integrin signaling. (mirnamimic.com)
Fibroblasts3
- The tTG-FN complex can maintain cell viability of tTG-null mouse dermal fibroblasts when apoptosis is induced by inhibition of RGD-dependent adhesion (anoikis), suggesting an extracellular survival role for tTG. (ntu.ac.uk)
- The interplay between mechanical strain and inflammation in pulmonary fibrosis remain incompletely understood.APPROACH: In this study, we used conditional KO mice to block mechanotransduction by knocking out FAK (Focal Adhesion Kinase) expression in fibroblasts, followed by induction of pulmonary fibrosis using bleomycin. (stanford.edu)
- Go¨6976 also induced laminin-dependent cell adhesion in NIH/3T3 and CV-1 fibroblasts, suggesting of a mechanism that may be common to multiple cell-types. (mirnamimic.com)
Inhibitor7
- Importantly, cancer cell immune evasion depends on FAK's catalytic activity, and VS-4718, a small molecule FAK kinase inhibitor that is in clinical development, suppresses regulatory T-cells, increases cytotoxic CD8 + T-cells and promotes tumour regression and clearance in mice. (ncri.org.uk)
- Bosutinib (SKI-606) is a 4-anilino-3-quinoline carbonitrile, which acts as a dual inhibitor of Src and ABL kinases. (mdm2-receptor.com)
- Bosutinib (SKI-606), 4-[(2,4-dichloro-5-methoxyphenyl)amino]-6-methoxy-7-[3- (4-methyl-1-piperazinyl) propoxy]-3-quinolinecarbonitrile monohydrate, is a competitive inhibitor of both Src and ABL tyrosine kinases. (mdm2-receptor.com)
- It was originally synthesized as an inhibitor of the Src kinase family. (mdm2-receptor.com)
- Bosutinib is a potent dual inhibitor of the Src and ABL tyrosine kinases (Puttini et al. (mdm2-receptor.com)
- A specific inhibitor of PKCd, rottlerin, completely abrogated Go¨6976-dependent increase in PC12 cell adhesion to laminin as well as the activation of small GTPases, Rac1 and Cdc42, that are downstream of PKCd in adhesion receptor signaling. (mirnamimic.com)
- In preliminary experiments examining the role of PKCa in cell adhesion and spreading, we found that Go¨6976, a widely used, nonglycosidic indolocarbazole inhibitor of PKCa/b, had effects that could not be explained by inhibition of PKCa/b alone. (mirnamimic.com)
Tumor5
- FAK seems also to have a role in the proliferation of tumor cells by its biochemical and biological association to cytoplasmic kinases such as src and ERK. (aacrjournals.org)
- Moreover, Cav1 is also localized outside of caveolar regions in the cytoplasm, focal adhesions, the extracellular milieu, and the nucleus emphasizing its function in a variety of cell signalling and mechanotransduction phenomena that may regulate tumor cell behaviour. (diff.org)
- Similarly, pY14Cav1 was shown to stabilize FAK, focal adhesion kinase and other components within focal adhesions, and lead to enhanced focal adhesions turnover and tumor cell migration. (diff.org)
- Recent work shows that pYCav1 in cooperation with the Mgat5/galectin-3 lattice, regulates FAK dynamics in focal adhesions and favours focal adhesion disassembly ad tumor cell migration. (diff.org)
- Synthetic peptides or recombinant fragments containing bio- logically active motifs have been shown to partially mimic the effects of native laminin in various cellular functions, such as cell adhesion, spreading, migration, neurite outgrowth, and tumor metastasis [6-10], suggesting that laminin-derived-short peptide- modified biomaterials may have therapeutic potential in tissue regeneration applications. (mirnamimic.com)
Protein4
- RGD-independent cell adhesion to tTG-FN does not require transamidating activity, is mediated by the binding of tTG to cell-surface heparan sulfate chains, is dependent on the function of protein kinase Cα (PKCα) and leads to activation of the cell survival focal adhesion kinase (FAK). (ntu.ac.uk)
- Hamilton: B. C. Decker Inc.). A number of anti-angiogenic activities have been reported for this protein, such as inhibition of endothelial cell proliferation, migration, and tube formation. (justia.com)
- Dual specificity phosphatase 3 (DUSP3), a suppressor of multiple protein tyrosine (Tyr) kinases, is decreased in lung cancer tissues. (biomedcentral.com)
- DUSP3/VHR, related to the vaccinia virus phosphatase VH1, is initially found to be a phosphatase that dephosphorylates multiple protein tyrosine kinases (PTKs) in vitro [ 21 ]. (biomedcentral.com)
Autophagy1
- Inhibition of autophagy leads to cancer cell death, demonstrating that selective autophagic targeting of Src (and other oncogenic tyrosine kinases) is an adaptive mechanism to maintain viability, identifying a cancer cell vulnerability that provides a new therapeutic opportunity. (ncri.org.uk)
Migration3
- PY14C av1 has been localized to focal adhesions using a monoclonal antibody, suggesting a specific function in cell migration processes. (diff.org)
- PKC activation by phorbol myristate acetate has been shown to induce the adhesion, spreading, and migration of cells [12]. (mirnamimic.com)
- Notably, the HSPA12A overexpression-induced inhibition of lactate export and migration were abolished by CD147 overexpression. (thno.org)
Mechanism1
- This identifies an additional mechanism, namely immunomodulation, through which FAK kinase inhibitors may impart anti-tumour efficacy. (ncri.org.uk)
Pharmacologic1
- Given the dynamic environment of the lung, we examined the significance of mechanotransduction on both inflammatory and fibrotic signaling during IPF.INNOVATION: Mechanotransduction pathways have not been thoroughly examined in the context of lung disease and pharmacologic approaches for IPF do not currently target these pathways. (stanford.edu)
Mechanisms1
- We use genetic and chemical intervention and imaging to understand the biological and molecular mechanisms by which adhesion-linked tyrosine kinases promote malignancy, and how best to perturb for therapeutic advantage. (ncri.org.uk)
Structural1
- Strong evidence suggests that pY14cav1 plays both a structural and signalling role in focal adhesion function. (diff.org)
Cell1
- Association of tTG with its binding site on the 70 kda aminoterminal FN fragment does not support this cell adhesion process, which seems to involve the entire FN molecule. (ntu.ac.uk)
Implicated in several1
- Endostatin has been implicated in several signaling pathways, such as downregulation of c-myc (Shichiri and Hirata (2001) Faseb J, 15: 1044-1053), cyclin-D1 (Hanai et al. (justia.com)
Important1
- Its etiology remains unknown, although inflammatory pathways appear to be important. (stanford.edu)
Molecules6
- [ 41 ] Recruitment of pericytes to newly created blood vessels involves binding of integrins on endothelial cells to vascular adhesion molecules on the pericytes. (medscape.com)
- The term "oncotarget" encompasses all molecules, pathways, cellular functions, cell types, and even tissues that can be viewed as targets relevant to cancer as well as other diseases. (oncotarget.com)
- proteins), followed by further GO and KEGG pathway analyses of these overlapped molecules, and molecular network analysis to obtain the hub molecules with Cytoscape. (frontiersin.org)
- KEGG pathway analysis of 1088 overlapped molecules obtained 52 statistically significant pathways, including focal adhesion, cGMP-PKG pathway, and platelet activation signaling pathways. (frontiersin.org)
- Inflammatory conditions promote the disassembly of the adherens junction and a loss of intercellular adhesion, creating openings or gaps in the endothelium through which small molecules diffuse and leukocytes transmigrate. (hindawi.com)
- Recent findings indicate a complex interaction between kinases, phosphatases, and the adherens junction components that allow a fine regulation of the endothelial permeability to small molecules, leukocyte migration, and barrier resealing. (hindawi.com)
Induces2
- [ 38 ] Ligand binding induces integrins to form focal adhesion complexes in the cell membrane. (medscape.com)
- Ligation of PRRs induces downstream-signaling pathways modifying the activity of transcription factors that regulates the expression of genes linked to inflammation. (intechopen.com)
Tyrosine1
- Tyrosine kinase signaling has emerged as a central regulator of the inflammatory response, partly through direct phosphorylation and dephosphorylation of the adherens junction components. (hindawi.com)
KEGG1
- KEGG pathway analysis of 6076 proteins obtained 114 statistically significant pathways, including endocytosis, and spliceosome signaling pathways. (frontiersin.org)
Proliferation3
- These pathways regulate functions involved in proliferation, motility, cytoskeleton organization and survival. (medscape.com)
- Integrins fulfill signaling functions that are essential for cell migration (invasion), proliferation, survival and for adhesion to the ECM. (medscape.com)
- Upon activation by GIT1-PIX PAK1 phosphorylates Aurora-A and Plk1 both essential regulators of mitotic occasions[18 19 Furthermore to traveling cell cycle development PAK also promotes cell proliferation through phosphorylation of c-Raf (Ser338) Albendazole and MEK (Ser298) two the different parts of the MAPK pathway [20 21 PAK protects cells from apoptosis via multiple systems. (biongenex.com)
Proteins4
- Focal adhesion complexes are composed of clusters of integrins with signaling and adaptor proteins (Figure 2). (medscape.com)
- The p21-activated kinases (PAKs) immediate downstream effectors of the tiny G-proteins from the Rac/cdc42 family are critical mediators of signaling pathways regulating cellular behaviors and therefore have already been implicated in pathological conditions including cancer. (biongenex.com)
- Endothelial cells may allow the transport of proteins and even cells through their cell body in what has been called the transcellular pathway. (hindawi.com)
- In this pathway, fluid and proteins are actively transported in a complex system of vesicles from the luminal to the basal side of the cell, where the vesicular content is released [ 13 , 17 ]. (hindawi.com)
Endothelial cells1
- In contrast, many proinflammatory mediators promote the disengagement of the AJ-based contacts, allowing the passage of fluids and leukocytes through a paracellular pathway, that is, between two endothelial cells. (hindawi.com)
Inhibitory3
- Particularly an "inhibitory change" site that associates using the huge lobe from the kinase site and a "kinase inhibitory" site straight blocks the catalytic cleft. (biongenex.com)
- Upon binding of Rac or Cdc42-GTP to its N-terminal tail the PAK1 dimer can be expected Albendazole to dissociate as well as the "kinase inhibitory" site is taken off the catalytic cleft [8]. (biongenex.com)
- The activation of Src kinase in cells is strictly controlled by intramolecular inhibitory interactions mediated by SH3 and SH2 domains. (elifesciences.org)
Motility1
- This is accompanied by an increased affinity to the plasma membrane, decreased membrane motility, and slower diffusion from focal adhesions. (elifesciences.org)
Catalytic cleft1
- These autoinhibitory interactions pack both regulatory domains against the kinase domain at a site opposite to the catalytic cleft. (elifesciences.org)
Activation1
- This enables for a dynamic conformation that may right now auto-phosphorylate threonine 423 inside the activation loop and extra residues that avoid the kinase from moving back to an inactive condition (Shape 1B) [13]. (biongenex.com)
Cellular2
- The significance of these processes in cellular homeostasis therefore implies a requirement for precise and tight regulation of the kinase. (elifesciences.org)
- The activity of the Src kinase is regulated in response to numerous cellular signals through allosteric conformational transitions. (elifesciences.org)
Cytoskeleton2
- [ 42 ] Cell migration is mediated by remodeling the intracellular actin cytoskeleton in the leading edge of the cell, with coordinated extracellular cell matrix adhesions providing the necessary traction for cell movement. (medscape.com)
- The adherens junction, a major mechanism of intercellular adhesion, is comprised of transmembrane cadherins forming homotypic interactions between adjacent cells and associated cytoplasmic catenins linking the cadherins to the cytoskeleton. (hindawi.com)
Interaction1
- P61959.1 MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY 1367453_at NP_446195 6.42 hsp90 co-chaperone Cdc37 Cdc37 Rattus norvegicus " Co-chaperone that binds to numerous kinases and promotes their interaction with the Hsp90 complex, resulting in stabilization and promotion of their activity. (nih.gov)
Therapies2
- Effective targeting of aberrant-oncogene addicted and nonaddicted pathways with rational combinations of targeted therapies directed to the hallmarks of cancer will be the key to cure. (medscape.com)
- Recently, the IL-8/CXCR1 axis was proposed as an attractive pathway for the design of specific therapies against breast cancer stem cells. (oncotarget.com)
Activity1
- Given the role of integrins in regulating these pathways, it follows that alterations to integrin activity facilitates the development of a malignant phenotype. (medscape.com)
Functions1
- This work establishes a solid foundation for the further analysis of how and under what circumstances this modification impacts Src kinase functions in myriad biological contexts. (elifesciences.org)
Cells1
- 5] The final common pathway is the successful breaching of a hardwired anticancer defense program by cancer cells that survive and proliferate in an altered microenvironment. (medscape.com)
Breast2
- Somatic mutations vary in distinct cancer types (eg, brain, pancreas, breast, colon), as well as in a given tumor type, but they do appear to utilize common overlapping oncogenic pathways detected in the malignant phenotype. (medscape.com)
- The tasks of PAK1 in tumor pathogenesis as well as the potential restorative great things about PAK inhibition are characterized generally in most fine detail in breast tumor and two types of mainly benign cancer symptoms neurofibromatosis type 1 and 2 (NF1 and NF2). (biongenex.com)
Techniques1
- We establish a pH dependant oligomerisation pathway forming tetrameric DEC-205 using solution-based techniques and ultimately solved the 4.9 Å cryo-EM structure of the DEC-205 tetramer to identify the unfurling of the second lectin ring which enables tetramer formation. (uci.edu)