AntigensViral envelopeEpitopesInfectionSubunitTrimericGp160EpitopeConformationVaccinePeptideInhibitionPeptidesEctodomain of gp41MembraneCytoplasmic tailAntibodies producedExtracellular domainAntigenStructural proteinsInfectionsPrefusionAntiretroviral TherapyGeneStrainsTrimersBindsMutationsConformational changesVirus's outerBindCapsidImmuneAmino AcidsReceptorsRecombinantVirusesAntibody response4E10AIDSMPERMacrophagesVaccinesInfluenzaInteractionsReceptor proteinsVirusMolecularCharacterizationRetrovirusesTargetsCellularNeutralize
Antigens9
- The N-terminal part of gp41 is thought to be involved in CELL FUSION with the CD4 ANTIGENS of T4 LYMPHOCYTES, leading to syncytial formation. (musc.edu)
- Gp41 is one of the most common HIV antigens detected by IMMUNOBLOTTING. (musc.edu)
- The project has been structured in 3 main pathways or "tracks": a Discovery track, aiming at designing gp41-based antigens (Ag) using an iterative improvement process, and two development tracks (Parenteral and Mucosal) to determine the safety and immunogenicity of the Ags and the optimal administration conditions before selecting the most promising candidate for clinical development. (europa.eu)
- Over 250 crystal structures of monoclonal Fab fragments and complexes with a variety of antigens, such as peptides, steroids, cocaine, and proteins, including HIV-1, gp120 and gp41, have led to significant insights into antibody-antigen recognition, virus neutralization, and vaccine design for HIV-1. (scripps.edu)
- Included are CD4 ANTIGENS, found on T4 lymphocytes, and monocytes/macrophages, which bind to the HIV ENVELOPE PROTEIN GP120. (harvard.edu)
- Vaccines or candidate vaccines containing inactivated HIV or some of its component antigens and designed to prevent or treat AIDS. (lookformedical.com)
- Antibodies reactive with HIV ANTIGENS . (lookformedical.com)
- Overall, 131 sera (16.6%) reacted strongly and an additional 34 (4.3%) reacted weakly with HIV antigens. (cdc.gov)
- This occurs because the region of the HIV virus that the immune system targets, the gp41 region on the virus's outer envelope, appears to be a molecular mimic of bacterial antigens that B cells are primed to target. (hivandhepatitis.com)
Viral envelope10
- DNA sequences that form the coding region for the viral envelope (env) proteins in retroviruses. (lookformedical.com)
- They are usually synthesized as protein precursors (POLYPROTEINS) and later cleaved into the final viral envelope glycoproteins by a viral protease. (lookformedical.com)
- Using a primary cell-based coculture model, we show that monocyte-derived macrophages (MDM) efficiently transmit a high-multiplicity HIV-1 infection to autologous CD4(+) T cells through a viral envelope glycoprotein (Env) receptor- and actin-dependent virological synapse (VS), facilitated by interactions between ICAM-1 and LFA-1. (ox.ac.uk)
- Entry of HIV-1 into human lymphoid requires activities of viral envelope glycoproteins gp120 and gp41, and two host-cell proteins, the primary receptor CD4 and a chemokine co-receptor. (biomedcentral.com)
- The latest ART drug to be approved by FDA in 2018, the post-attachment inhibitor prevents the viral envelope fusion with the cell membrane after it binds to the cell. (hdkino.org)
- Viral infection depends on gp41, which orchestrates fusion of the viral envelope with the target cell membrane. (wisc.edu)
- The viral envelope (Env) protein is a vital driver of the infectious binding and fusion to the target cells and comprises two primary non-covalently linked glycoproteins, surface component gp120 and transmembrane gp41. (articlemarketingnews.com)
- Entry inhibitors targeting viral envelope proteins, or host factors, are effective antiviral agents and have been widely studied. (bvsalud.org)
- The viral envelope consists of a lipid bilayer derived from the plasma membrane of infected cells, with glycoprotein spikes anchored in it. (ecolowood.com)
- HIV-1-induced cell fusion is mediated by multiple regions within both the viral envelope and the CCR-5 co-receptor. (microbiologyresearch.org)
Epitopes11
- Fifty-one vaccine candidates were designed mainly to mimic fusion intermediate conformations of gp41 and in some instance to increase exposure of the 2F5/4E10 epitopes. (europa.eu)
- Another design strategy was developed using gammaretroviruses backbone where 2 domains were substituted with HIV epitopes in the N-terminal part of the ectodomain and the membrane proximal external region (MPER) respectively. (europa.eu)
- Co-receptor Binding Site Antibodies Enable CD4-Mimetics to Expose Conserved Anti-cluster A ADCC Epitopes on HIV-1 Envelope Glycoproteins. (harvard.edu)
- Nevertheless, attempts to generate an HIV-1 neutralizing antibody response with immunogens bearing MPER epitopes have met with limited success. (cornell.edu)
- Objectives: In this study, we investigated the association of levels of autoantibodies and lymphoproliferation against myosin in leprosy patients across the spectrum and tried to find out the mimicking proteins or epitopes between host protein and protein/s of Mycobacterium leprae. (bvsalud.org)
- B cell epitopes of the proteins were predicted by BCPREDS server 1.0 followed by identification of mimicking epitopes. (bvsalud.org)
- Conclusion: These data suggest that these mimicking proteins tropomyosin and ATP-dependent Clp protease ATP-binding subunit of M. leprae or more precisely mimicking epitopes (four B cell epitopes) might be responsible for extensive tissue damage during type1 reaction in leprosy. (bvsalud.org)
- The mAbs 2F5 and 4E10 bind gp41-M-MAT with nanomolar affinities, in keeping with the significant publicity of their particular epitopes in the trimer framework. (physiciansontherise.org)
- 5292134] resulted from the targeting of mutable epitopes of the HIV virus. (advfn.com)
- Of all viral proteins, only gp120 and gp41 have epitopes for antibody acknowledgement. (ecolowood.com)
- Comparative evaluation for consensus B-cell epitopes relating to transmembrane topology, predicated on physico-chemical and machine learning strategies uncovered that residue 231- 296 (NH2- EARLVPLILLLLWWWVNQLAVLGLPAVEAAVAGEVFAGPALSWCLGLPVVSMILGLANLVLYFRWL-COOH) is certainly most reliable and possible B cell epitope for E2 proteins. (mdm2-inhibitors.com)
Infection66
- This interaction is of unknown physiological significance although peptide T20/DP178 is a licensed anti-retrovirus agent (pentafuside) termed Enfuvirtide which acts at the level of HIV-target cell fusion and is used clinically to treat HIV-1 infection). (wikipedia.org)
- Preferential susceptibility of Th9 and Th2 CD4+ T cells to X4-tropic HIV-1 infection. (harvard.edu)
- Widespread use of the HIV antigen (Ag)/antibody (Ab) immunoassay (formerly known as the "4th-generation" test) can increase the number of people aware of their HIV status, including those who may transmit HIV during acute infection. (hivguidelines.org)
- These tests have been used for various purposes, including clinical diagnosis of HIV-1 infection--for symptomatic and asymptomatic patients in counseling and testing programs--for seroprevalence surveys, and for blood-donor screening. (cdc.gov)
- The purpose of this report is to provide guidance for interpreting Western blot test results and their use in diagnosing HIV-1 infection. (cdc.gov)
- Antibodies to the HIV-1 major group-specific antigen (GAG) protein p24, and its precursor p55, are the earliest detected after infection by Western blot and tend to decrease or become undetectable with onset or progression of clinical symptoms (4-9). (cdc.gov)
- The HIV envelope proteins gp41 and gp120 play critical roles in HIV infection, the causative agent of AIDS. (uic.edu)
- The new technology platform opens new possibilities for devising an approach to prevent HIV infection, says Dr. Scott Blanchard, an associate professor of physiology and biophysics at Weill Cornell, and one of three co-lead authors on the Science study. (sciencedaily.com)
- We desperately need solutions to prevent HIV infection, which, to date, has infected or killed more than 70 million people worldwide," Dr. Blanchard says. (sciencedaily.com)
- If this technology proves useful in HIV management, it could potentially be used to decode infection processes for other viruses, he says. (sciencedaily.com)
- The envelope consists of three gp120 and gp41 proteins positioned close together, and referred to as "trimers," that open up like a flower in the presence of CD4, exposing the gp41 subunit that is essential for subsequent aspects of the mechanism that causes infection. (sciencedaily.com)
- The conserved membrane-proximal external region (MPER) of the HIV-1 gp41 envelope protein is the established target for very rare but broadly neutralizing monoclonal antibodies (NAbs) elicited during natural human infection. (cornell.edu)
- HIV-1 genetic diversity to estimate time of infection and infer adherence to preexposure prophylaxis. (cdc.gov)
- The action of in vivo high potential HIV electrotherapy appears to penetrate the soft tissues as well as the blood, targeting the principal reservoirs of infection in the lymphatic system. (electroherbalism.com)
- High-multiplicity HIV-1 infection and neutralizing antibody evasion mediated by the macrophage-T cell virological synapse. (ox.ac.uk)
- Macrophage infection is considered to play an important role in HIV-1 pathogenesis and persistence. (ox.ac.uk)
- Virological synapse (VS)-mediated transmission by MDM results in high levels of T cell HIV-1 integration and is 1 to 2 orders of magnitude more efficient than cell-free infection. (ox.ac.uk)
- The entry of virus into target cell represents one of the most attractive targets in the search for new drugs to treat HIV infection. (biomedcentral.com)
- What is antiretroviral therapy (ART) for human immunodeficiency virus (HIV) infection? (hdkino.org)
- Antiretroviral therapy (ART) is a complete treatment regimen for human immunodeficiency virus ( HIV ) infection, with a combination of three or more classes of drugs . (hdkino.org)
- HIV infection has no cure but ART can contain the viral growth and keep the patient healthy and active for many years. (hdkino.org)
- What is HIV infection? (hdkino.org)
- HIV infection is caused by a virus that infects human immune cells known as T-cells. (hdkino.org)
- HIV infection spreads through certain bodily fluids such as blood, semen, vaginal fluids or breast milk . (hdkino.org)
- In its later stages, HIV infection can lead to acquired immune deficiency syndrome ( AIDS ), when the immune system is so weakened that it is unable to fight even common infections. (hdkino.org)
- First recognized in the early 1980s, AIDS represents the endstage of infection with one of two lentiviruses, termed Human immunodeficiency virus type 1 (HIV-1) or type 2 (HIV-2) ( 1 , 2 ). (cdc.gov)
- More than 40 million persons are estimated to have HIV infection or AIDS ( 4 ) . (cdc.gov)
- Ashley Trama and Barton Haynes from Duke Human Vaccine Institute and colleagues found that more than 80% of anti-gp41 antibodies produced by B-cells in the ileum (final section of the small intestine) of people with acute HIV infection cross-react with normal gut flora such as E. coli . (hivandhepatitis.com)
- Such cross-reactive immunoglobulin G antibodies were also detected in HIV negative people, indicating that they are present prior to HIV infection. (hivandhepatitis.com)
- The hypothesis now is that the gp41 antibody response in HIV infection can be derived from a pre-infection memory B cell pool triggered by gut bacteria that cross-reacts with the HIV envelope,' said lead author Ashley M. Trama. (hivandhepatitis.com)
- This supports the notion that the dominant HIV antibody response is influenced by previously activated memory B cells that are present before HIV infection and are cross-reactive with intestinal bacteria. (hivandhepatitis.com)
- Methods are provided for the treatment of a HIV infection. (justia.com)
- The methods can include administering to a subject with an HIV infection a therapeutically effective amount of an agent that interferes with the interaction of gp120 and α4 integrin, such as a α4β1 or α4β7 integrin antagonist, thereby treating the HIV infection. (justia.com)
- Methods are also provided to reduce HIV replication or infection. (justia.com)
- The primary immunologic abnormality resulting from infection by human immunodeficiency virus (HIV) is the progressive depletion and functional impairment of T lymphocytes expressing the CD4 cell surface glycoprotein. (justia.com)
- Studies of HIV-1 infection of fractionated CD4 and CD8 T-cells from normal donors and AIDS patients have revealed that depletion of CD4 T-cells results from the ability of HIV-1 to selectively infect, replicate in, and ultimately destroy this T lymphocyte subset (Klatzmann et al. (justia.com)
- Thus, a need remains for additional agents that can be used to study HIV infection in vitro, and is of use for treating or preventing HIV replication in vivo. (justia.com)
- Infection of the Compact disc4+ T cell by HIV-1 is certainly mediated with the envelope proteins (Env), a trimeric complicated on the virion surface area that includes three copies each of glycoprotein (gp) 120 and gp41. (physiciansontherise.org)
- An α/β-peptide that inhibits HIV infection. (wisc.edu)
- Our α/β-peptide, like the conventional peptide on which it is based, blocks HIV infection in a cellular assay (Horne et al. (wisc.edu)
- The initial line of defense against HIV infection is a few naturally occurring peptides. (articlemarketingnews.com)
- In addition other cells such as B-lymphocytes and macrophages are destroyed by HIV infection. (padeepz.net)
- The management of HIV infection involves the above general measures, treatment of opportunistic infections and cancer, antiretroviral drugs, immunomodulators and supportive treatment and counselling. (padeepz.net)
- In this study, we found that EKL1C also exhibited broad-spectrum fusion inhibitory activity against human immunodeficiency virus type 1 (HIV-1) infection by interacting with the N-terminal heptad repeat 1 (HR1) of viral gp41 to block six-helix bundle (6-HB) formation. (bvsalud.org)
- These results suggest that HR1 is a common target for the development of broad-spectrum viral fusion inhibitors and EKL1C has potential clinical application as a candidate therapeutic or preventive agent against infection by coronavirus, HIV-1, and possibly other class I enveloped viruses. (bvsalud.org)
- Does HIV-2 protect against HIV-1 infection? (microbiologyresearch.org)
- Plasma viral load in HIV-1 and HIV-2 singly and dually infected individuals in Guinea-Bissau, West Africa: significantly lower plasma virus set point in HIV-2 infection than in HIV-1 infection. (microbiologyresearch.org)
- Does HIV-2 infection provide cross-protection against HIV-1 infection? (microbiologyresearch.org)
- Diagnosis of HIV-1/2 dual infection using dilution analysis of type-specific antibody. (microbiologyresearch.org)
- Human immunodeficiency virus (HIV) type 2-mediated inhibition of HIV type 1: a new approach to gene therapy of HIV-infection. (microbiologyresearch.org)
- The detection of HIV-2 infection in southern India. (microbiologyresearch.org)
- Low peripheral blood viral HIV-2 RNA in individuals with high CD4 percentage differentiates HIV-2 from HIV-1 infection. (microbiologyresearch.org)
- Axis 1: Role of autophagy during CD4+ T cells infection by HIV-1 (Véronique Robert-Hebmann, Baptiste Pradel and Lucile Espert). (cfatg.org)
- Moreover, Env can also induce autophagy at the entry step of HIV-1 into CD4+ T cells, but this process is quickly inhibited, then completely blocked when the infection become productive, suggesting that HIV-1 has developed strategies to control autophagy. (cfatg.org)
- In this context, we are now researching, in CD4 T cells, (i) what are the Env-induced signaling pathways leading to autophagy, (ii) the mechanisms linking the Env-induced autophagy to apoptosis in uninfected cells, (iii) the role of autophagy in the early steps of HIV-1 infection (iv) the cellular factors are selectively degraded by Env-induced autophagy in different contexts of infection. (cfatg.org)
- Our project is thus to further characterize the impact of ASP on the cellular response to HIV-1 infection, in particular its role on the autophagic process. (cfatg.org)
- It has been shown that infection of macrophages by HIV-1, in the absence of other cell types, promotes infection of neighboring ("bystanders") macrophages by MTB. (cfatg.org)
- HIV-1 Vpr inhibits autophagy during the early steps of infection of CD4 T cells. (cfatg.org)
- Since the first cases of human immunodeficiency virus (HIV) infection were identified, the number of children infected with HIV has risen dramatically in developing countries, the result of an increased number of HIV-infected women of childbearing age in these areas. (medscape.com)
- Vertical HIV infection occurs before birth, during delivery, or after birth. (medscape.com)
- Detection of antibody to HIV is the usual first step in diagnosing HIV infection. (medscape.com)
- Cognitive disorder in the setting of human immunodeficiency virus (HIV) infection has long been recognized as an important and disabling aspect of the disease. (medscape.com)
- [ 1 ] In addition to its effects on the cellular immune system, HIV enters the central nervous system (CNS) early in the course of the infection and causes several important CNS conditions over the course of the disease, such as HIV encephalopathy and HAND. (medscape.com)
- In addition, patients are at risk for many other neurologic complications of HIV infection, including vacuolar myelopathy, peripheral neuropathies, and polymyositis, which can contribute to further disability. (medscape.com)
- For other discussions of HIV infection, see HIV Disease , Pediatric HIV Infection , and Antiretroviral Therapy for HIV Infection . (medscape.com)
- HIV infection in the CNS can be detected and monitored by cerebrospinal fluid (CSF) viral load measurements. (medscape.com)
Subunit6
- This mode of cell-to-cell transmission is broadly susceptible to the activity of CD4 binding site (CD4bs) and glycan or glycopeptide epitope-specific broadly neutralizing monoclonal antibodies (bNMAbs) but shows resistance to bNMAbs targeting the Env gp41 subunit membrane-proximal external region (MPER). (ox.ac.uk)
- This process allows the virus to avoid neutralization by a class of antibody targeting the gp41 subunit of the envelope glycoproteins. (ox.ac.uk)
- gp41, the transmembrane subunit, mediates fusion of viral and cellular membranes [ 3 ]. (plos.org)
- The membrane proximal external region (MPER) is a 28-residue segment of each subunit in the gp41 homotrimer. (physiciansontherise.org)
- The envelope glycoprotein of HIV-1 consists of the surface subunit gp120 and the transmembrane subunit gp41. (proteopedia.org)
- Epstein-Barr virus envelope glycoprotein 110 inhibits NF-κB activation by interacting with NF-κB subunit p65. (nih.gov)
Trimeric14
- We confirmed that 2C6 binds preferentially to trimeric envelope and recognizes the clades A, B, and C SOSIP trimers. (nih.gov)
- IMPORTANCE This paper further defines the function and area of the HIV trimeric envelope protein targeted by the monoclonal antibody 2C6. (nih.gov)
- Scholars@Duke publication: Prefusion structure of trimeric HIV-1 envelope glycoprotein determined by cryo-electron microscopy. (duke.edu)
- Prefusion structure of trimeric HIV-1 envelope glycoprotein determined by cryo-electron microscopy. (duke.edu)
- The activation of trimeric HIV-1 envelope glycoprotein (Env) by its binding to the cell-surface receptor CD4 and co-receptors (CCR5 or CXCR4) represents the first of a series of events that lead to fusion between viral and target-cell membranes. (duke.edu)
- Here, we present the cryo-EM structure, at subnanometer resolution (~6 Å at 0.143 FSC), of the 'closed', prefusion state of trimeric HIV-1 Env complexed to the broadly neutralizing antibody VRC03. (duke.edu)
- The architecture of trimeric HIV-1 Env in the prefusion state and in the activated intermediate state resembles the corresponding states of influenza hemagglutinin trimers, thus providing direct evidence for the similarity in entry mechanisms used by HIV-1, influenza and related enveloped viruses. (duke.edu)
- We propose that the trimeric MPER structure represents the prefusion conformation of gp41, preceding the putative prehairpin intermediate and the postfusion trimer-of-hairpins structure. (cornell.edu)
- The HIV-1 envelope (Env) glycoproteins are produced as a 160 kDa polyprotein that is subsequently processed to yield virion-associated, trimeric complexes of non-covalently associated gp120-gp41 heterodimers [ 1 , 2 ]. (plos.org)
- The NMR alternative structure of the trimeric area, designated gp41-M-MAT, implies that the three MPER peptides each adopt symmetric -helical conformations revealing the amino acidity side chains from the antibody binding sites. (physiciansontherise.org)
- Vaccine candidates based on linear peptides from the MPER (19), trimeric gp41 constructs (20, 21), and conformationally constrained peptides have Nafamostat hydrochloride been previously reported (22, 23). (physiciansontherise.org)
- Each viral spike is definitely a trimeric heterodimer comprising the external glycoprotein gp120 and the transmembrane glycoprotein gp41, with about 70C79 trimers within the virion surface [5]. (ecolowood.com)
- The crystallography on individual gp120 and gp41 parts, as well as with the context of trimeric gp120/gp41, has been obtained in recent years, alongside mapping of gp120 CD4 and co-receptor binding sites [6]. (ecolowood.com)
- A buried isoleucine (Ile573) in a central trimeric coiled coil within the fusion-active gp41 ectodomain core is thought to favor this conformational activation. (proteopedia.org)
Gp1606
- In contrast, antibodies to the envelope (ENV) precursor protein gp160 and the final ENV proteins (gp120 and gp41) can be detected in specimens from virtually all HIV-infected persons regardless of clinical stage (4-9). (cdc.gov)
- HIV-1 antibody levels and avidity to three envelope proteins (gp41, gp160, and gp120) were measured in the plasma using a customized Bio-Plex (Bio-Rad Laboratories) assay. (cdc.gov)
- Here we describe two IMCs derived from subtypes C and CRF01_AE HIV-1 primary isolates expressing LucR (IMC.LucR) that were engineered to express heterologous gp160 Envs. (plos.org)
- To use HIV-1 as an example, the envelope gene codes for a 'precursor protein', g lyco p rotein160 (gp160). (scienceblogs.com)
- The glycoproteins gp120 and gp41, which are encoded from the env gene, are called Env proteins and translate to a full-length gp160 polyprotein, followed by trimerization and cleavage by a furin-like protease inside a Golgi compartment. (ecolowood.com)
- Q89797_9HIV1 ] The envelope glyprotein gp160 precursor down-modulates cell surface CD4 antigen by interacting with it in the endoplasmic reticulum and blocking its transport to the cell surface (By similarity). (proteopedia.org)
Epitope11
- Previous studies in our laboratory characterized a panel of highly mutated HIV-specific conformational epitope-targeting antibodies (Abs) from a panel of HIV-infected long-term nonprogressors (LTNPs). (nih.gov)
- The fact that different amino acids were included in the epitope depending on the targeted protein supports the conclusion that 2C6 targets a native conformational epitope. (nih.gov)
- When we mapped these amino acids on the trimerized structure, they spanned across oligomers, supporting the notion that the epitope targeted by 2C6 lies in a recessed pocket between two gp41 oligomers. (nih.gov)
- This epitope is recognized on multiple clades (variant groups of circulating viruses) of gp41, gp140 trimers, and SOSIP trimers. (nih.gov)
- The broadly-neutralizing anti-HIV antibody 4E10 recognizes an epitope in the membrane-proximal external region of the HIV envelope protein gp41. (healthdisparitiesks.org)
- HIV epitope binding site and disclosing profound versatility, but creating an electropositive pocket in keeping with nonspecific binding of phospholipid headgroups. (healthdisparitiesks.org)
- However, studies have suggested a more complex role of the gp41 endodomain [ 11 , 12 ], showing neutralization of HIV-1 by Abs directed to an epitope in CT of gp41 [ 13 - 15 ]. (plos.org)
- However, none of the induced plasma antibodies strongly neutralize HIV-1 (19, 20, 23, 24), either because the trial vaccines do not present the epitope residues in a native conformation or in the presence of the correct molecular environment, or because of the limitation of induction of MPER antibodies by host tolerance mechanisms (25C28). (physiciansontherise.org)
- The basis for its broad-spectrum efficacy is the fact that Clone 3 mAb targets an immutable epitope on the HIV virus. (advfn.com)
- The targeted epitope has remained present in 98% (either directly or by way of conserved substitutions) of all now known 87,336 HIV isolates analyzed by the Company's use of artificial intelligence.The failure of other mAbs, such as the Vaccine Research Group VRC01 [Bar KJ, et al. (advfn.com)
- Early studies from the gp41-CT generally attended to the immunogenic properties from the Kennedy epitope or the viroporin properties from the α-helical lentiviral lytic peptides LLP-1 LLP-2 and LLP-3 and PF 3716556 their function in viral incorporation and infectivity. (biosemiotics2013.org)
Conformation6
- The overall objective of EuroNeut-41 was to design a vaccine that raises antibodies able to prevent HIV cell fusion by blocking the virus fusion protein gp41 in its pre-fusogenic conformation. (europa.eu)
- We show that three gp41 helices at the core of the trimer serve as an anchor around which the rest of Env is reorganized upon activation to the 'open' quaternary conformation. (duke.edu)
- It is of fundamental importance in determining PROTEIN CONFORMATION. (lookformedical.com)
- With two of these special beacons in place, smFRET imaging can be used to visualize how the molecules move over time, when the virus proteins change conformation. (sciencedaily.com)
- Structure of the HIV-1 gp41 membrane-proximal ectodomain region in a putative prefusion conformation. (cornell.edu)
- α/β-Peptides containing 25-30% β residues, with α → β replacement sites distributed evenly, can adopt an α-helix-like conformation and bind to protein partners that naturally associate with α-helical ligands. (wisc.edu)
Vaccine18
- In parallel, a questionnaire was submitted to a population of women in Haiti to assess their willingness to participate in a future HIV vaccine trial. (europa.eu)
- Some of our studies are aimed at creating an HIV vaccine that elicits antibodies against a transient, but vulnerable, intermediate in the membrane-fusion process, called the pre-hairpin intermediate. (stanford.edu)
- We have also determined structures of almost all of the rare, broadly neutralizing antibodies against the HIV-1 envelope proteins, gp120 and gp41, in order to elucidate the sites of vulnerability that can be used for HIV-1 vaccine design. (scripps.edu)
- As the target of 2C6 is available in the major clades of HIV and has robust ADCC activity, further definition and appreciation of targeting of antibodies similar to 2C6 during vaccine development should be considered. (nih.gov)
- Standardized assays to assess vaccine and antiviral drug efficacy are critical for the development of protective HIV-1 vaccines and drugs. (plos.org)
- Thus far, a subtype B IMC backbone expressing Renilla luciferase (LucR), and into which the ectodomain of heterologous env coding sequences can be expressed has been successfully developed but as execution of HIV-1 vaccine efficacy trials shifts increasingly to non-subtype B epidemics (Southern African and Southeast Asia), non-subtype B HIV-1 reagents are needed to support vaccine development. (plos.org)
- Our results suggest a possible effect of non- env HIV-1 genes on the interaction of Env and neutralizing antibodies and highlight the need to generate a library of IMCs representative of the HIV-1 subtype spectrum to be used as standardized neutralization assay reagents for assessing HIV-1 vaccine efficacy. (plos.org)
- We developed a candidate DNA vaccine called "DNA-4"consisting of 4 plasmid DNAs encoding Nef, Gag, Pol(rt), and gp140 HIV-1 proteins. (mdpi.com)
- The study, published Aug. 13, 2014, in the journal Cell Host & Microbe , builds on previous work from researchers at the Duke Human Vaccine Institute that outlined a perplexing quality about HIV: The antibodies that originally arise to fight the virus are ineffective. (hivandhepatitis.com)
- Haynes said the finding provides compelling new information for HIV vaccine development, which is the next phase of research. (hivandhepatitis.com)
- are binding sites for the HIV-1 neutralizing antibodies FTDCR1B 2F5 broadly, 4E10, and 10E8, producing these binding sites essential goals for HIV-1 vaccine advancement. (physiciansontherise.org)
- Enhanced humoral HIV-1-specific immune responses generated from recombinant rhabdoviral-based vaccine vectors co-expressing HIV-1 proteins and IL-2. (jefferson.edu)
- A safe and potent vaccine against HIV-1 could limit the spread of HIV-1 and consequently eradicate the disease. (ecolowood.com)
- This review summarizes current literature on bNAbs, which suggests new options for anti-HIV-1 vaccine design. (ecolowood.com)
- HIV-1 envelope gp41 broadly neutralizing antibodies: hurdles for vaccine development. (duke.edu)
- An understanding of the gp41 activation process may suggest novel strategies for vaccine and antiviral drug development. (proteopedia.org)
- E2 envelope proteins of GB trojan Adenosine IC50 C plays function in trojan entry in to the cytosol, genotyping (10), the perfect goals for vaccine advancement, and a marker to diagnose GBV-C attacks (11), and besides, the concomitance between E2 proteins and gp41 proteins of HIV-1 impacts proteins folding and whether it forms a non energetic complicated with gp41-FP. (mdm2-inhibitors.com)
- In primates (Chimpanzees model in HCV) it's been reported that purified recombinant envelope glycoproteins (E1 and E2) acquired potential to safeguard against problem with homologous trojan, as a result these proteins will be the ideal goals for vaccine advancement (11). (mdm2-inhibitors.com)
Peptide11
- Formyl peptide receptor 1 (FPR1, FPR1 receptor, fMet-Leu-Phe receptor 1, FMLP receptor 1, or N-formylmethionyl-leucyl-phenylalanine receptor 1) is a cell surface receptor protein that in humans is encoded by the formyl peptide receptor 1 (FPR1) gene. (wikipedia.org)
- For instance, T20/DP178, a peptide fragment situated in the C-terminal section of HIV-1LAV envelope protein gp41 (aa 643C678) can be an operating ligand for FPR, whereas two overlapping peptides partly, T21/DP107 (aa 558C595) and N36 (aa 546C581), inside a leucine zipper-like site of gp41 of HIV-1LAV, activate FPRL1 [37], [38]. (bakingandbakingscience.com)
- Hp(2C20), an antibacterial, cecropin-like peptide produced from the N-terminal series of ribosomal protein L1, activates both calcium mineral mobilization as well as the NADPH oxidase in neutrophils via FPRL1 also to a lesser extent in monocytes via FPRL2 [17], [42]. (bakingandbakingscience.com)
- In this work we describe the design of dual -targeting peptides composed of peptide domains of E2 and El envelope proteins from Human Pegivirus with the aim of targeting both the loop region and the fusion peptide domains of HIV-I gp41. (uab.cat)
- Lower left shows a co-crystal structure of the α/β-peptide (multicolor) bound to a protein partner (gray) (PDB 3O43). (wisc.edu)
- Figure 2 shows the crystal structure of a 38-residue α/β-peptide (yellow, orange and blue) bound to an engineered partner protein (gray) that represents a critical portion of the HIV protein gp41. (wisc.edu)
- The crystal structure shows that the α/β-peptide forms a 10-turn helix and binds into a long, complementary groove presented by gp41. (wisc.edu)
- The α/β-peptide is an excellent structural mimic of the α-helix that naturally binds to the target site on gp41, despite the fact that every turn of the α/β-peptide helix contains one more carbon atom than does one turn of an authentic α-helix. (wisc.edu)
- Currently, the primary antiviral medicines are small molecules, and just a handful are protein, peptide, or oligonucleotide-based therapeutics. (articlemarketingnews.com)
- Enfuvirtide, a 36 residue long peptide intended to replicate the C-terminal heptad repeat (CHR) of the helical region of gp41, was licensed by the FDA in 2003. (articlemarketingnews.com)
- In the process of membrane fusion, envelope protein exposes fusion peptide, followed by an insertion into the cell membrane or endosomal membrane. (bvsalud.org)
Inhibition2
- Other specific initiatives were conducted such as evaluation of the sublingual route for immunization, investigation of the Principal Immunodominant Domain (PID) of gp41, and direct HIV inhibition with an Ag family which demonstrated in vitro antiviral activities comparable to the antiretroviral drug T20 (Fuzeon). (europa.eu)
- In this scenario, inhibition of HIV-1 entry can be brought about by introducing agents that can block thiol-disulfide interchange reaction of cell surface PDI. (biomedcentral.com)
Peptides4
- Many cryptic peptides of HIV-1 envelope proteins have already been proven to activate myeloid cells via FPR and/or FPRL1. (bakingandbakingscience.com)
- Two peptides, named V3 and F, produced from the HIV-1LAV envelope protein gp120, are great activators of FPRL1 [39] also, [40]. (bakingandbakingscience.com)
- Novel strategies in the design of HIV-I fusion/entry inhibitors are based on the construction of dual- targeting fusion proteins and peptides with synergistic antiviral effects. (uab.cat)
- Experimental data obtained from peptides and by sequence evaluation and modeling suggest the fact that structural and physicochemical properties from the gp41-CT are amazingly highly conserved regardless of the series variants. (biosemiotics2013.org)
Ectodomain of gp411
- 2C6 binds gp140 constructs of clades A, B, C, and D, suggesting a conserved binding site that we localized to the ectodomain of gp41. (nih.gov)
Membrane9
- The envelope consists of an inner layer of lipids and virus specified proteins also called membrane or matrix proteins. (lookformedical.com)
- Introduced in 2003, the fusion inhibitor stops the HIV from fusing with the immune cell's membrane, preventing entry. (hdkino.org)
- The Env proteins complicated goes through dramatic conformational adjustments during the procedure for membrane fusion. (physiciansontherise.org)
- env codes for the protein that sticks out of the lipid membrane. (scienceblogs.com)
- To keep using HIV-1 as an example, this precursor protein gets chopped in two, into a t rans m embrane gp41, which stays anchored in the viral membrane, and a s ub u nit gp120, which is noncovalently attached to gp41 like a lolly-pop. (scienceblogs.com)
- The HIV-1 Tat protein is strongly secreted by infected CD4+ T cells and low doses of Tat are known to inhibit PIP2-dependent membrane trafficking. (cfatg.org)
- Our results demonstrate that the proper folding of the gp41 core underlies the membrane fusion properties of the gp120-gp41 complex. (proteopedia.org)
- Structural and functional analysis of the HIV gp41 core containing an Ile573 to Thr substitution: implications for membrane fusion. (proteopedia.org)
- Liu J, Shu W, Fagan MB, Nunberg JH, Lu M. Structural and functional analysis of the HIV gp41 core containing an Ile573 to Thr substitution: implications for membrane fusion. (proteopedia.org)
Cytoplasmic tail2
- the cytoplasmic tail (CT) of gp41 (endodomain) is considered to be entirely contained inside the virion [ 9 , 10 ] and consequently is thought not to be targeted by the host immune response. (plos.org)
- gene: the gp120 ectodomain may be the many adjustable the gp41 ectodomain may be the least adjustable as PF 3716556 well as the gp41 cytoplasmic tail (gp41-CT) lies somewhere in between with an intermediate level of sequence diversity and phylogenetic development [29]. (biosemiotics2013.org)
Antibodies produced1
- When these reagents were used, serum specimens with only gp41 antibodies produced bands at the 41-, 120-, and 160-kd positions. (cdc.gov)
Extracellular domain1
- The extracellular domain of the Coxsackie and Adenovirus Receptor protein (CAR-D1D2) has been shown to be the receptor for the Coxsackie B virus (CBV), which is a major cause of viral heart infections. (uic.edu)
Antigen6
- However, in a recent study, the protein with a mobility of 160 kilodaltons (kd) present in commercially available Western blots and in viral lysate antigen preparations was identified as a multimer of the gp41 protein (10,11). (cdc.gov)
- A blood protein produced in response to and counteracting a specific antigen. (idmod.org)
- We studied the evolution of glycan-reactive B cells of rhesus macaques and humans using glycosylated HIV-1 envelope (Env) as a model antigen. (duke.edu)
- Pemeriksaan HIV1 yang paling banyak digunakan berdasarkan pada deteksi tiga marker biologis HIV1, yaitu RNA virus (materi genetik), antigen p24 (protein capsid virus), dan antibodi HIV1. (studylibid.com)
- Pemeriksaan antigen p24 dapat memberikan manfaat untuk deteksi infeksi dini HIV, skrining darah, diagnosis infeksi pada bayi baru lahir dan pada pemantauan terapi antiretroviral. (studylibid.com)
- Simpulan : pemeriksaan antigen p24 HIV dapat dilakukan untuk mendeteksi infeksi HIV dengan menggunakan peralatan yang sederhana, penyiapan sampel lebih sederhana, dan dilakukan dengan biaya yang lebih sedikit. (studylibid.com)
Structural proteins1
Infections7
- It is important to characterize the impact of PrEP on HIV antibody responses in people who experience breakthrough infections in order to understand the potential impact on timely diagnosis and treatment. (cdc.gov)
- Not only can gut flora influence the development and function of the immune system, but perhaps also pre-determine our reaction to certain infections such as HIV,' Haynes said. (hivandhepatitis.com)
- This relates to the field of human immunodeficiency virus (HIV), specifically to the use of α4 integrin antagonists for the treatment of HIV infections. (justia.com)
- Molecular characterization of human immunodeficiency virus (HIV)-1 and -2 in individuals from Guinea-Bissau with single or dual infections: predominance of a distinct HIV-1 subtype A/G recombinant in West Africa. (microbiologyresearch.org)
- HIV-1/Mycobacterium tuberculosis (MTB) co-infections are a major public health issue. (cfatg.org)
- You will find evidences on reducing HCV-related liver morbidity associated with GB computer virus C (GBV-C) and inhibitory effect of GB computer virus C on HCV/HIV viremia, survival, a lower mortality rate, slower disease development in sufferers with coinfection and in addition, GBV-C could play function being a predictor for medical center acquired infections (7, 8). (mdm2-inhibitors.com)
- In addition to HIV itself, other causes of neurologic complications in HIV-infected individuals include opportunistic infections, tumors, autoimmune conditions, and antiretroviral drugs. (medscape.com)
Prefusion1
- The second state is a prefusion intermediate where gp41 is interacting with Nafamostat hydrochloride both the host cell and viral membranes. (physiciansontherise.org)
Antiretroviral Therapy6
- Phenotypic Coreceptor Tropism in Perinatally HIV-infected Youth Failing Antiretroviral Therapy. (harvard.edu)
- Emphasize that rapid antiretroviral therapy (ART) initiation is the standard of care for all individuals diagnosed with HIV. (hivguidelines.org)
- This was a multicenter, double-blind, placebo-controlled clinical trial of safety, and dose selection of "DNA-4" in HIV-1 infected people receiving antiretroviral therapy (ART). (mdpi.com)
- The widespread use of highly active antiretroviral therapy (HAART) has dramatically improved the clinical course for many individuals infected with HIV (Berrey et al. (justia.com)
- In a study of HIV-1-infected, highly active antiretroviral therapy (HAART)-naive children, Yin et al found that beginning HAART at younger ages and healthier CD4 levels results in better immune recovery. (medscape.com)
- Prior to the advent of highly active antiretroviral therapy (HAART), dementia was a common source of morbidity and mortality in HIV-infected patients. (medscape.com)
Gene10
- Transmembrane envelope protein of the HUMAN IMMUNODEFICIENCY VIRUS which is encoded by the HIV env gene. (musc.edu)
- This gene encodes a G protein-coupled receptor cell surface protein that binds and is activated by N-Formylmethionine-containing oligopeptides, particularly N-Formylmethionine-leucyl-phenylalanine (FMLP). (wikipedia.org)
- The env genes contain a cis-acting RNA target sequence for the rev protein (= GENE PRODUCTS, REV ), termed the rev-responsive element (RRE). (lookformedical.com)
- Retroviral proteins, often glycosylated, coded by the envelope (env) gene. (lookformedical.com)
- External envelope protein of the human immunodeficiency virus which is encoded by the HIV env gene. (lookformedical.com)
- Proteins coded by the retroviral gag gene. (lookformedical.com)
- These immune assays will be advanced by the development of standardized viral stocks, such as HIV-1 infectious molecular clones (IMC), that i) express a reporter gene, ii) are representative of globally diverse subtypes and iii) are engineered to easily exchange envelope (env) genes for expression of sequences of interest. (plos.org)
- Among the unresolved questions on HIV-1, a particularly intriguing aspect is the case of the asp gene. (cfatg.org)
- Indeed, this gene is positioned on the complementary reverse strand of the proviral genome, overlapping of the env gene and allows, thanks to an antisense transcription initiated from the 3'-LTR, the production of the protein ASP (AntiSense Protein). (cfatg.org)
- Through evolutionary approaches and the analysis of more than 23,000 virus sequences, we have demonstrated that this 10th HIV gene (M group) appeared concomitantly with the emergence of the AIDS pandemic in the early 20th century. (cfatg.org)
Strains5
- The Evolving HIV-1 Epidemic in Warao Amerindians Is Dominated by an Extremely High Frequency of CXCR4-Utilizing Strains. (harvard.edu)
- The researchers were able to study proteins from two different strains of HIV, which contained beacons that did not alter the biology of the particles. (sciencedaily.com)
- This advanced electrotherapy is painless if not comfortable for all persons, non-invasive, and appears to be well tolerated and without toxic side effects or the potential for the rapid development of resistant mutational strains of HIV. (electroherbalism.com)
- Developed in 2007, the chemokine receptor antagonist blocks entry of certain specific strains of HIV, which attach to a particular protein on the immune cell's surface known as chemokine receptor 5 (CCR5). (hdkino.org)
- The Company is in the final development of the recombinant of the parent antibody (identified as "Clone 3"), which has been shown in in vitro tests conduction in 5 international laboratories to fully neutralized over 95% of all strains and viral subtypes of HIV-1 against which it was tested. (advfn.com)
Trimers1
- There are 10-20 such envelope trimers on the surface of each HIV particle, and they mutate rapidly, thereby evading typical immune responses. (sciencedaily.com)
Binds1
- It is disclosed herein that the HIV-1 envelope protein gp120 binds to α4β7 integrin on CD4+ T-cells, natural killer (NK) cells and CD8+ T-cells. (justia.com)
Mutations4
- Despite binding HIV envelope protein and having a high number of somatic amino acid mutations, these Abs had poor neutralizing activity. (nih.gov)
- 2C6 binding is influenced by amino acid mutations across two separate gp41 sections of the envelope trimer. (nih.gov)
- have unique characteristics which include high levels of somatic mutations and unusually very long variable loops that penetrate through the glycan shield of HIV-1 Env to Dovitinib Dilactic acid contact the protein surface. (ecolowood.com)
- The inclination of HIV-1 to rapidly accumulate mutations to escape sponsor immune reactions represents a major hurdle to the development of effective vaccines. (ecolowood.com)
Conformational changes4
- PDI is capable of mediating thio-disulfide interchange reactions and could enable the reduction of gp120 disulfide bonds, which triggers the major conformational changes in gp120 and gp41 required for virus entry. (biomedcentral.com)
- Receptor conformational changes induced GPCR engagement with an agonist are detected by intracellular proteins, such G proteins and β-arrestins, which then initiate distinct signaling processes. (wisc.edu)
- Further conformational changes ensue in which the type 1 envelope protein forms a typical six-helix bundle structure, shortening the distance between viral and cell membranes so that fusion can occur. (bvsalud.org)
- Like additional Type 1 fusion proteins, these trimetric constructions undergo receptor- induced conformational changes to increase the exposure of the gp 41 ectodomain for the fusion of viral and cellular membranes ( Fig. 1 ). (ecolowood.com)
Virus's outer2
- His group developed fluorescent molecules (fluorophores) -- which he dubs "beacons" -- and the team inserted them into the virus's outer covering, known as the envelope. (sciencedaily.com)
- These initial, ineffective antibodies target regions of the virus's outer envelope called gp41 that quickly mutates, and the virus escapes being neutralized. (hivandhepatitis.com)
Bind3
- CD4 receptor proteins help HIV bind to a cell. (sciencedaily.com)
- The anti-viral example illustrates how polypeptides with modified backbones can bind to specific recognition sites on target proteins and thereby block pathogenic protein-protein interactions while resisting proteolytic destruction. (wisc.edu)
- As microbicides, studies have revealed that retrocyclins bind to both HIV-1 and host cell glycoproteins to block HIV entrance. (articlemarketingnews.com)
Capsid3
- Layers of protein which surround the capsid in animal viruses with tubular nucleocapsids. (lookformedical.com)
- The RNA is covered in an envelope known as capsid which has two glycoproteins (a kind of protein molecule that incorporates a sugar molecule), gp120 and gp41, embedded in its surface. (hdkino.org)
- Like any other virus, it is made up of a central icosahedral capsid core containing the genetic material surrounded by a protein envelope. (padeepz.net)
Immune14
- Studies on other pattern recognition receptors, include peptidoglycan recognition protein (PGRP), TREM-1, Toll-like receptors (TLR) have revealed how unique pathogen-associated molecules are recognized by the immune system. (scripps.edu)
- Humoral Immune Pressure Selects for HIV-1 CXC-chemokine Receptor 4-using Variants. (harvard.edu)
- Technologies that allow investigators, for the first time, to watch what they call the 'dance' of HIV proteins on the virus' surface, which may contribute to how the virus infects human immune cells, have been developed by scientists. (sciencedaily.com)
- Making the movements of HIV visible so that we can follow, in real time, how surface proteins on the virus behave will hopefully tell us what we need to know to prevent fusion with human cells -- if you can prevent viral entry of HIV into immune cells, you have won," says Dr. Blanchard, who is also associate director of Weill Cornell's chemical biology program. (sciencedaily.com)
- The team used the technology to study motions of proteins on the surface of the HIV virus (called envelope proteins) that are key to the virus's ability to infect human immune cells carrying CD4 receptor proteins. (sciencedaily.com)
- This is why it is so difficult for humans to mount an effective immune response and why it is challenging for researchers to develop vaccines targeting the HIV envelope proteins," Dr. Blanchard says. (sciencedaily.com)
- Pulsed high potential HIV electrotherapy technology appears to be an effective method for the treatment of HIV disease, reducing viral load to low levels and significantly improving the immune panel in preliminary experimental trials conducted over the past 30 months. (electroherbalism.com)
- IMPORTANCE The ability of HIV-1 to move directly between contacting immune cells allows efficient viral dissemination with the potential to evade antibody attack. (ox.ac.uk)
- What ART Drugs Prevent HIV Entry into the Human Immune Cell? (hdkino.org)
- What ART drug classes prevent entry of human immunodeficiency virus (HIV) into the human immune cell? (hdkino.org)
- Durham, N.C. -- August 13, 2014 -- Normal microorganisms in the intestines appear to play a pivotal role in how the HIV virus foils a successful attack from the body's immune system, according to new research from Duke Medicine. (hivandhepatitis.com)
- The human immunodeficiency virus-1 (HIV-1) has the ability to evade the adaptive immune response due to high mutation rates. (ecolowood.com)
- The type 1 Human Immunodeficiency Virus (HIV-1) infects mainly cells from the immune system expressing the CD4 receptor and the CXCR4 and/or CCR5 co-receptors. (cfatg.org)
- Our work, and that of other teams, has also demonstrated that ASP is well expressed in vivo since an anti-ASP immune response can be detected in HIV-infected patients. (cfatg.org)
Amino Acids1
- gp 41 is an unusually long protein with over 100 amino acids. (padeepz.net)
Receptors6
- Receptors, HIV" is a descriptor in the National Library of Medicine's controlled vocabulary thesaurus, MeSH (Medical Subject Headings) . (harvard.edu)
- This graph shows the total number of publications written about "Receptors, HIV" by people in Harvard Catalyst Profiles by year, and whether "Receptors, HIV" was a major or minor topic of these publication. (harvard.edu)
- Below are the most recent publications written about "Receptors, HIV" by people in Profiles. (harvard.edu)
- Proteins containing protein transduction domains (PTD) have been shown to rapidly traverse biological membranes in a relatively nonspecific fashion without the aid of protein receptors. (uic.edu)
- Engagement … HIV-1 infects cells through connection with CD4 and chemokine receptors via transmembrane domains, such as CCR5 or CXCR4. (ecolowood.com)
- Binding of gp120 to target cell receptors induces a conformational change in gp41, which then mediates the fusion of viral and cellular membranes. (proteopedia.org)
Recombinant2
- Here, we constructed a novel fusion inhibitor-based recombinant protein, denoted as 5-Helix, consisting of three heptad repeat 1 (HR1) and two heptad repeat 2 (HR2) fragments. (bvsalud.org)
- HIV-1 has now been classified into 9 unique subtypes and their recombinant forms [3]. (ecolowood.com)
Viruses3
- Much of our recent work is focused on HIV-1 and influenza viruses. (scripps.edu)
- Proteins synthesized by HUMAN IMMUNODEFICIENCY VIRUSES such as the HIV-1 and HIV-2 . (lookformedical.com)
- This review focuses on entry inhibitors that target the six-helical bundle core against highly pathogenic enveloped viruses with class I fusion proteins, including retroviruses, coronaviruses, influenza A viruses, paramyxoviruses, and filoviruses. (bvsalud.org)
Antibody response2
- Delayed maturation of the antibody response to HIV may increase the time to detection for antibody-based tests. (cdc.gov)
- Even though mechanisms by which the humoral response is definitely induced and managed remain elusive, new insight into broadly neutralizing HIV-1 antibodies (bNAbs) offers expanded our understanding of the antibody response. (ecolowood.com)
4E101
AIDS6
- The development of sensitive and specific tests for antibody to human immunodeficiency virus type 1 (HIV-1) progressed rapidly after this retrovirus was identified as the cause of acquired immunodeficiency syndrome (AIDS). (cdc.gov)
- It is therefore a potentially universal treatment for HIV disease and AIDS. (electroherbalism.com)
- An informal clinical trial has been concluded by the Director of a holistic medical clinic in Newport Beach, California with extensive experience in the treatment of HIV disease and AIDS. (electroherbalism.com)
- Therefore, drugs targeting HIV-1 entry are an exiting prospect in terms of prevention of AIDS. (biomedcentral.com)
- Acquired Immunodeficiency Syndrome (AIDS) is caused by the human immunodeficiency virus (HIV). (articlemarketingnews.com)
- The human being immunodeficiency disease type 1 (HIV-1), which causes the acquired immunodeficiency syndrome (AIDS), was found out over 30 years ago. (ecolowood.com)
MPER1
- As such, the MPER trimer should inform the design of new HIV-1 immunogens to elicit broadly neutralizing antibodies. (cornell.edu)
Macrophages2
- Here, we show that HIV-1 spreads from infected macrophages to T cells via a structure called a virological synapse that maintains extended contact between the two cell types, allowing transfer of multiple infectious events to the T cell. (ox.ac.uk)
- HIV is thought to enter the brain via HIV-infected macrophages and lymphocytes. (medscape.com)
Vaccines1
Influenza1
Interactions4
- The general interests of our laboratory concern biochemical and NMR studies of protein-protein interactions. (uic.edu)
- We have asked how backbone modification affects the informational properties of polypeptides, i.e., how this type of modification affects interactions with partner proteins. (wisc.edu)
- both intensive Env intracellular interactions and trafficking with numerous cellular and viral proteins optimizing viral infectivity. (biosemiotics2013.org)
- Axis 2: Characterization of the interactions between ASP (HIV-1 antisense protein) and the autophagy pathway (Antoine Gross, Nathalie Chazal and Lucile Espert). (cfatg.org)
Receptor proteins1
- Pulsed high potential electrotherapy is thought to denature and disrupt the fragile gp120 and gp41 receptor proteins found on the surface of the HIV virion, disabling the gp41 mechanism and thereby inhibiting the ability of the virus to infect CD4 cells in vivo. (electroherbalism.com)
Virus19
- The heptad repeat 2 domain is a major determinant for enhanced human immunodeficiency virus type 1 (HIV-1) fusion and pathogenicity of a highly pathogenic HIV-1 Env. (musc.edu)
- Fusion-induced apoptosis contributes to thymocyte depletion by a pathogenic human immunodeficiency virus type 1 envelope in the human thymus. (musc.edu)
- Characterization of Human Immunodeficiency Virus (HIV-1) Envelope Glycoprotein Variants Selected for Resistance to a CD4-Mimetic Compound. (harvard.edu)
- They saw that the gp120 proteins' virus particles changed shape constantly and that the timing and nature of their movements were both similar and distinct. (sciencedaily.com)
- It should be noted that all current FDA approved pharmaceutical industry HIV drug therapies only inhibit the ability of the HIV virus to replicate once it has infected the cell. (electroherbalism.com)
- In the event of HIV-1 entry, the viral glycoprotein gp120 attaches the virus to the cell by binding to its receptor CD4 which also contains disulfide bonds. (biomedcentral.com)
- Human immunodeficiency virus type 1 (HIV-1) or type 2 (HIV- derives from infected monkeys, and a comparable number of 2) (1,2). (cdc.gov)
- But when the HIV virus invades and begins replicating in the gastrointestinal tract, no such naive B cells are dispatched. (hivandhepatitis.com)
- The B cells see the virus and take off -- they make all these antibodies, but they aren't protective, because they are targeted to non-protective regions of the virus envelope,' Haynes explained. (hivandhepatitis.com)
- With the recent acquisition of the technology created by BioClonetics Immunotherapeutics, Inc., the Company has additional and complementary technology for producing fully human monoclonal antibodies (mAbs) that neutralize the HIV virus. (advfn.com)
- Nestes fluídos corporais, o VIH está presente como partículas de virus libres ou como virus inserido en células inmunitarias ( glóbulos brancos ) infectados. (wikipedia.org)
- Despois de entraren na célula diana, o xenoma de ARN viral convértese (por reversotranscrición ) en ADN bicatenario pola acción do encima codificado no virus transcriptase inversa que se transporta en forma de encima xa formado dentro da partícula vírica, xunto co propio xenoma. (wikipedia.org)
- In 1986, the committee on taxonomy of virus coined the term HIV or Human Immunodeficiency Virus to avoid confusion due to different names being given by different reasearchers. (padeepz.net)
- Some have been used clinically, such as T20 and Maraviroc for human immunodeficiency virus 1 (HIV-1) or Myrcludex B for hepatitis D virus (HDV). (bvsalud.org)
- Co-evolution of a broadly neutralizing HIV-1 antibody and founder virus. (duke.edu)
- SAAS:SAAS000328_004_020447][RuleBase:RU004292] The gp120-gp41 heterodimer allows rapid transcytosis of the virus through CD4 negative cells such as simple epithelial monolayers of the intestinal, rectal and endocervical epithelial barriers. (proteopedia.org)
- The mutant envelope glycoprotein expressed in 293T cells and incorporated within pseudotyped virions displayed only a moderate reduction in syncytium-inducing capacity and virus infectivity, respectively. (proteopedia.org)
- Peran Protein p24 pada Infeksi Human Immunodeficiency Virus 1 (HIV1) Peran Protein p24 pada Infeksi Human Immunodeficiency Virus 1 (HIV1) Ety Apriliana Bagian Mikrobiologi, Fakultas Kedokteran, Universitas Lampung Abstrak Infeksi Human Immunodeficiency Virus1 (HIV1) merupakan masalah kesehatan masyarakat yang penting terutama pada negara berkembang. (studylibid.com)
- Genome layout of human immunodeficiency virus (HIV)-1 and HIV-2. (medscape.com)
Molecular1
- Conclusions: The extensive analysis of the protein with essential roles hasn't been easy, and in case there is E2 envelope glycoprotein of HGV, there is absolutely no very much data on its immunological and molecular features, clinical significance and its own pathogenic potential in hepatitis or any various other GBV-C related illnesses. (mdm2-inhibitors.com)
Characterization1
- The structural and useful characterization from the HIV and SIV gp41-CTs provides received much less attention and even you'll find so many contradictory outcomes. (biosemiotics2013.org)
Retroviruses4
- Lentiviruses have unusually long envelope (Env) cytoplasmic tails much longer than those of other retroviruses. (biosemiotics2013.org)
- Structural determinants and topology from the gp41-CT Framework from the gp41-CTThe gp41-CT of lentiviruses is normally unusually lengthy (~150 proteins) and significantly longer compared to the tails of various other retroviruses ( (biosemiotics2013.org)
- HIV is new member of the Lentivirinae subfamily of human retroviruses. (padeepz.net)
- The protein envelope is attached several spicules of glycoprotein, Like other retroviruses the glycoprotein sticks out on both sides (inside and outside) of its protein coat. (padeepz.net)
Targets2
- I also directed the Joint Center for Structural Genomics (2000-2016) that pioneers new high throughput methodologies and technologies for protein production, structure determination and functional analysis in order to investigate the Expanding Protein Universe and the human gut microbiome and other high-value targets in the regulation of stem cells and T cells. (scripps.edu)
- consequently, it is of interest to search for new viral targets such as the envelope proteins. (uic.edu)
Cellular1
- Cellular reservoirs of HIV-1 in the central nervous system of infected individuals: identification by the combination of in situ polymerase chain reaction and immunohistochemistry. (microbiologyresearch.org)
Neutralize2
- Among the problems inherent to sCD4 was its inability to efficiently neutralize primary isolates of HIV. (justia.com)
- In the 90s, it was found that sera of HIV-1-infected individuals contained antibodies that could recognize and neutralize different subtypes of HIV-1. (ecolowood.com)