• Glucagon-like peptide-2 ( GLP-2 ) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid ) in humans. (wikipedia.org)
  • GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). (wikipedia.org)
  • Effects of boschnaloside from Boschniakia rossica on dysglycemia and islet dysfunction in severely diabetic mice through modulating the action of glucagon -like peptide-1. (nih.gov)
  • 1 Glucagon-like peptide-1 (GLP-1) and glucose dependent insulinotropic polypeptide are the two key enteroendocrine factors responsible for the incretin effect. (bmj.com)
  • The ability of glucagon-like peptide-1 (GLP-1) to reduce food intake involves activation of GLP-1 receptors (GLP-1R) in the nucleus of the solitary tract (NTS). (gu.se)
  • There's a semi-loud click, and the glucagon gets absorbed into the nose without any extra sniffing needed (since it's designed for those who may be having severe hypos and could be passed out or uncooperative). (healthline.com)
  • If the patient does not recover within 15 minutes, give a further dose of glucagon and call for an ambulance. (diabetes.co.uk)
  • And then, once I hit the 50 mg/dL mark, it was time to get the glucagon dose! (healthline.com)
  • Be sure you and your caregivers know how to give this medication in case of an emergency, because it's likely that a family member, caregiver, or friend will administer the dose of glucagon. (everydayhealth.com)
  • Glucagon should not be given with anticholinergic drugs due to increased risk of stomach and intestine-related side effects. (medicinenet.com)
  • Glucagon by itself does not raise blood sugar levels. (wisegeek.com)
  • As it says in the article, if someone has very low blood sugar levels they can go into shock or die very quickly and glucagon is used by the body to adjust for that (although not quickly enough, or we wouldn't need to use injections to help people). (wisegeek.com)
  • Glucagon raises low blood sugar. (anabolicminds.com)
  • It actually took about two hours to get my blood sugar down to about 70 where they would start closely monitoring my levels and prepping for glucagon. (healthline.com)
  • Glucagon should only be used to treat low blood sugar if you are not well enough to use food to raise your blood sugar, if you have passed out, or if you have a seizure. (everydayhealth.com)
  • After taking glucagon and regaining consciousness, you must contact your doctor, and your blood sugar levels should be checked hourly for three to four hours. (everydayhealth.com)
  • Quickly treating dangerously low blood sugar outweighs any risks glucagon may pose. (everydayhealth.com)
  • You should avoid drinking alcohol while taking or after taking glucagon because it can lower your blood sugar. (everydayhealth.com)
  • All people who take glucagon should have a household member who knows how to administer the drug and recognizes the symptoms of low blood sugar. (everydayhealth.com)
  • If someone is unconscious due to a low blood-sugar episode, glucagon should be given as soon as possible. (everydayhealth.com)
  • When blood sugar drops, insulin production drops and more glucagon is produced In rodents, the alpha cells are located in the outer rim of the islet. (wikipedia.org)
  • An injectable form of glucagon may be part of first aid in cases of low blood sugar when the person is unconscious or for other reasons cannot take glucose orally or by intravenous. (wikipedia.org)
  • Individuals who are hypoglycemic due to thyroid problems may also benefit from the use of glucagon injections. (wisegeek.com)
  • But this nasal form is pretty exciting, offering a super-fast and easy way to administer glucagon in case of emergency. (healthline.com)
  • Glucagon is a powder medicine that must be mixed with a liquid (diluent) before using it. (cigna.com)
  • Store glucagon powder and the diluent at cool room temperature away from moisture, heat, and light. (cigna.com)
  • Rare allergic -type reactions may occur with glucagon including itching , respiratory distress, or low blood pressure. (medicinenet.com)
  • These induced hypos were part of a clinical study investigating a new type of glucagon that would be a lot different than what we have now. (healthline.com)
  • The glucagon kit will usually consist of a syringe, a vial of powder and a vial of liquid. (diabetes.co.uk)
  • You'll just stick the tube into a nostril and press the bottom, making the dry powder glucagon shoot into your nose where it's absorbed into the system. (healthline.com)
  • It has a small "plunger" on the bottom that you just press to release the powder glucagon up one of our nostrils. (healthline.com)
  • Although the body produces glucagon, various types of health ailments can interfere with this process. (wisegeek.com)
  • Excising the eyestalk in young crayfish produces glucagon-induced hyperglycemia. (wikipedia.org)