The model was built by integrating and modifying two previously published models such that the model outputs for cyclins A and B fit cyclin expression measurements and the activation of B cyclin/Cdk1 coincided with phosphorylation of histone H3. (ebi.ac.uk)
The role of phosphorylation and the CDC28 protein kinase in cell cycle-regulated nuclear import of the S. cerevisiae transcription factor SWI5. (wikidata.org)
A protein-serine-threonine kinase that is activated by PHOSPHORYLATION in response to GROWTH FACTORS or INSULIN. (lookformedical.com)
CDC21
The kinase complex is able to phosphorylate CDK2 and CDC2 kinases, thus functions as a CDK-activating kinase (CAK). (novusbio.com)
Wee11
The model depends on Cdh1-regulated cyclin degradation during G1, regulation of B cyclin/Cdk1 activity by cyclin A/Cdk via Wee1, and transcriptional control of the mitotic cyclins that reflects some of the current literature. (ebi.ac.uk)
Protein8
The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. (novusbio.com)
This cyclin forms a complex with CDK7 kinase and ring finger protein MAT1. (novusbio.com)
This cyclin and its kinase partner are components of TFIIH, as well as RNA polymerase II protein complexes. (novusbio.com)
In addition, miR122 transfected cells decreased AKT2 kinase activation while decreased FOXO1 and FOXO3A protein inactivation. (oncotarget.com)
The mitotic inducer nim1+ functions in a regulatory network of protein kinase homologs controlling the initiation of mitosis. (wikidata.org)
Those coupled to membrane depolarization or intracellular release of calcium include the receptor-mediated activation of cytotoxic functions in granulocytes and the synaptic potentiation of protein kinase activation. (lookformedical.com)
for example, protein kinase activation is part of the platelet activation signal pathway. (lookformedical.com)
MRNA1
MicroRNAs (miRs) are regulators of gene expression by destabilizing and inducing degradation of messenger RNAs (mRNA) and/or repressing their translation [ 1 ]. (oncotarget.com)
Mitosis2
We introduced autocatalytic transcription of E2F, E2F regulated transcription of cyclin B, Cdc20/Cdh1 mediated E2F degradation, enhanced transcription of mitotic cyclins during late S/early G2 phase, and the sustained synthesis of cyclin B during mitosis. (ebi.ac.uk)
Cyclins function as regulators of CDK kinases. (novusbio.com)
Regulatory1
Dysregulation of CDK8 (Cyclin-Dependent Kinase 8) and its regulatory partner CycC (Cyclin C) , two subunits of the conserved Mediator (MED) complex, have been linked to diverse human diseases such as cancer. (sdbonline.org)
Functions1
cdc25+ functions as an inducer in the mitotic control of fission yeast. (wikidata.org)
Expression3
Western Blot: Cyclin H Antibody (1B8) [H00000902-M01] - CCNH monoclonal antibody (M01), clone 1B8 Analysis of CCNH expression in HeLa. (novusbio.com)
Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. (novusbio.com)
The mechanism, which is based on the synthesis and degradation of three ''master regulator'' proteins (CtrA, GcrA, and DnaA), is converted into a quantitative model, in order to study the temporal dynamics of these and other cell cycle proteins. (ebi.ac.uk)
It inhibits tubulin polymerization associated with an anti-Aurora A activity, leading to Cdk1 activation and mitotic arrest of the cell cycle that in turn induces Bcl-2 degradation and a subsequent caspase activation in HRPCs. (biomedcentral.com)
The regulation of Aurora A RNA, protein and kinase activity is dependent of cell cycle with peaking in the transition of G2 to mitotic phase [ 8 ]. (biomedcentral.com)
1996). Further details about cyclin E promoter regulation have recently been reported (Le Cam et al. (nih.gov)
The model depends on Cdh1-regulated cyclin degradation during G1, regulation of B cyclin/Cdk1 activity by cyclin A/Cdk via Wee1, and transcriptional control of the mitotic cyclins that reflects some of the current literature. (ebi.ac.uk)
Cdc22
1997). Hyperphosphorylation of the N-terminal domain of Cdc25 regulates activity toward cyclin B1/cdc2 but not cyclin A/cdk2. (sdbonline.org)
Signals relating to DNA damage and completeness of replication impact on balance of Wee1 (a Cdc2 inhibitory kinase) and Cdc25 activities to delay entry into M phase. (comprehensivephysiology.com)
Cdk11
1999). Cyclin B-cdk1 kinase stimulates ORC- and Cdc6-independent steps of semiconservative plasmid replication in yeast nuclear extracts. (sdbonline.org)
1999). Cyclin-dependent kinase and Cks/Suc1 interact with the proteasome in yeast to control proteolysis of M-phase targets. (sdbonline.org)
19971
1997) . c-Abl tyrosine kinase activity is stimulated in response to ionizing radiation, ara-C, camptothecin, or etoposide (Yuan et al. (nih.gov)
Regulates2
2000). Cyclin F regulates the nuclear localization of cyclin B1 through a cyclin-cyclin interaction. (sdbonline.org)
Cyclin-dependent kinases (CDKs) and cyclins represent an ancient molecular module that drives and regulates cell cycle progression. (prolekarniky.cz)
Checkpoint1
Activation/overexpression of Aurora A has been suggested to override mitotic spindle assembly checkpoint, leading to the resistance to taxol-induced apoptosis [ 3 , 15 ]. (biomedcentral.com)
Binds2
B3 Ku binds to the C-terminal region of DNA-PK (amino acids 3002-3850) near the protein kinase domain (Jin et al. (nih.gov)
P61959.1 MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY 1367453_at NP_446195 8.92 hsp90 co-chaperone Cdc37 Cdc37 Rattus norvegicus " Co-chaperone that binds to numerous kinases and promotes their interaction with the Hsp90 complex, resulting in stabilization and promotion of their activity. (nih.gov)
The mechanism, which is based on the synthesis and degradation of three ''master regulator'' proteins (CtrA, GcrA, and DnaA), is converted into a quantitative model, in order to study the temporal dynamics of these and other cell cycle proteins. (ebi.ac.uk)
Polymeric SUMO2 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins (By similarity). (nih.gov)
Gene2
C2 The Cyclin E and A genes (but not the Cyclin D gene) are strongly activated by E2F1 (DeGregori et al. (nih.gov)
The cyclin gene family has undergone a massive expansion in angiosperm plants, but only a few cyclins were thoroughly characterized. (prolekarniky.cz)
Transcription1
In addition to a constitutively occupied E2F1-Sp1 site immediately upstream of the cyclin E transcription start region, there is downstream a cell cycle-regulated site (termed CERM) that may function as a cyclin E-repressor module. (nih.gov)
Interaction1
this interaction does not require c-Abl kinase activity. (nih.gov)
Overexpression1
Overexpression of pRb can increase the expression Cyclin D1 by an unknown mechanism (Watanabe et al. (nih.gov)
Constitutively1
We further show that cyclin SDS does not contain a D-box and is constitutively expressed throughout meiosis. (prolekarniky.cz)
Arrest1
Accordingly, a novel approach that reduces toxic effect but reserves the activity to trigger mitotic arrest and cell death can be helpful in cancer chemotherapy. (biomedcentral.com)
Processes1
Mutant analysis revealed that these cyclins contribute to distinct meiosis-related processes. (prolekarniky.cz)
Replication1
Rum1 and Cdc18 link inhibition of cyclin-dependent kinase to the initiation of DNA replication in Schizosaccharomyces pombe . (sdbonline.org)
Discrete sequence elements control posterior pole accumulation and translational repression of maternal cyclin B RNA in Drosophila. (sdbonline.org)
2000). CPEB, Maskin, and Cyclin B1 mRNA at the mitotic apparatus: Implications for local translational control of cell division. (sdbonline.org)
Cells1
Meiosis takes place in pollen and megaspore mother cells that differentiate from archesporial cells through several rounds of mitotic divisions. (prolekarniky.cz)
Formation2
Aurora A participates in centrosomal separation, formation of bipolar spindle and attachment of chromosomal kinetochore to mitotic spindle [ 8 , 9 ]. (biomedcentral.com)
While A2 cyclins are important for chromosome segregation, CYCB3;1 prevents ectopic cell wall formation. (prolekarniky.cz)