- The model was built by integrating and modifying two previously published models such that the model outputs for cyclins A and B fit cyclin expression measurements and the activation of B cyclin/Cdk1 coincided with phosphorylation of histone H3. (ebi.ac.uk)
- The role of phosphorylation and the CDC28 protein kinase in cell cycle-regulated nuclear import of the S. cerevisiae transcription factor SWI5. (wikidata.org)
- A protein-serine-threonine kinase that is activated by PHOSPHORYLATION in response to GROWTH FACTORS or INSULIN. (lookformedical.com)
- The kinase complex is able to phosphorylate CDK2 and CDC2 kinases, thus functions as a CDK-activating kinase (CAK). (novusbio.com)
- The model depends on Cdh1-regulated cyclin degradation during G1, regulation of B cyclin/Cdk1 activity by cyclin A/Cdk via Wee1, and transcriptional control of the mitotic cyclins that reflects some of the current literature. (ebi.ac.uk)
- The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. (novusbio.com)
- This cyclin forms a complex with CDK7 kinase and ring finger protein MAT1. (novusbio.com)
- This cyclin and its kinase partner are components of TFIIH, as well as RNA polymerase II protein complexes. (novusbio.com)
- In addition, miR122 transfected cells decreased AKT2 kinase activation while decreased FOXO1 and FOXO3A protein inactivation. (oncotarget.com)
- The clam embryo protein cyclin A induces entry into M phase and the resumption of meiosis in Xenopus oocytes. (wikidata.org)
- The mitotic inducer nim1+ functions in a regulatory network of protein kinase homologs controlling the initiation of mitosis. (wikidata.org)
- Those coupled to membrane depolarization or intracellular release of calcium include the receptor-mediated activation of cytotoxic functions in granulocytes and the synaptic potentiation of protein kinase activation. (lookformedical.com)
- for example, protein kinase activation is part of the platelet activation signal pathway. (lookformedical.com)
- MicroRNAs (miRs) are regulators of gene expression by destabilizing and inducing degradation of messenger RNAs (mRNA) and/or repressing their translation [ 1 ]. (oncotarget.com)
- Cyclins function as regulators of CDK kinases. (novusbio.com)
- Dysregulation of CDK8 (Cyclin-Dependent Kinase 8) and its regulatory partner CycC (Cyclin C) , two subunits of the conserved Mediator (MED) complex, have been linked to diverse human diseases such as cancer. (sdbonline.org)
- cdc25+ functions as an inducer in the mitotic control of fission yeast. (wikidata.org)
- Western Blot: Cyclin H Antibody (1B8) [H00000902-M01] - CCNH monoclonal antibody (M01), clone 1B8 Analysis of CCNH expression in HeLa. (novusbio.com)
- Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. (novusbio.com)
- The approach provided expression profiles of cyclin A2, cyclin B1, and phospho-S10-histone H3. (ebi.ac.uk)
- The mechanism, which is based on the synthesis and degradation of three ''master regulator'' proteins (CtrA, GcrA, and DnaA), is converted into a quantitative model, in order to study the temporal dynamics of these and other cell cycle proteins. (ebi.ac.uk)
- 1997). Introduction of cyclin B induces activation of the maturation-promoting factor and breakdown of germinal vesicle in growing zebrafish oocytes unresponsive to the maturation-inducing hormone. (sdbonline.org)
- It inhibits tubulin polymerization associated with an anti-Aurora A activity, leading to Cdk1 activation and mitotic arrest of the cell cycle that in turn induces Bcl-2 degradation and a subsequent caspase activation in HRPCs. (biomedcentral.com)
- The data were substantiated by an up-regulation of cyclin B1 (a Cdk1 partner). (biomedcentral.com)
- The regulation of Aurora A RNA, protein and kinase activity is dependent of cell cycle with peaking in the transition of G2 to mitotic phase [ 8 ]. (biomedcentral.com)
- 1996). Further details about cyclin E promoter regulation have recently been reported (Le Cam et al. (nih.gov)
- The model depends on Cdh1-regulated cyclin degradation during G1, regulation of B cyclin/Cdk1 activity by cyclin A/Cdk via Wee1, and transcriptional control of the mitotic cyclins that reflects some of the current literature. (ebi.ac.uk)
- 1997). Hyperphosphorylation of the N-terminal domain of Cdc25 regulates activity toward cyclin B1/cdc2 but not cyclin A/cdk2. (sdbonline.org)
- Signals relating to DNA damage and completeness of replication impact on balance of Wee1 (a Cdc2 inhibitory kinase) and Cdc25 activities to delay entry into M phase. (comprehensivephysiology.com)
- 1999). Cyclin B-cdk1 kinase stimulates ORC- and Cdc6-independent steps of semiconservative plasmid replication in yeast nuclear extracts. (sdbonline.org)
- 1997) . c-Abl tyrosine kinase activity is stimulated in response to ionizing radiation, ara-C, camptothecin, or etoposide (Yuan et al. (nih.gov)
- Activation/overexpression of Aurora A has been suggested to override mitotic spindle assembly checkpoint, leading to the resistance to taxol-induced apoptosis [ 3 , 15 ]. (biomedcentral.com)
- B3 Ku binds to the C-terminal region of DNA-PK (amino acids 3002-3850) near the protein kinase domain (Jin et al. (nih.gov)
- P61959.1 MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY 1367453_at NP_446195 8.92 hsp90 co-chaperone Cdc37 Cdc37 Rattus norvegicus " Co-chaperone that binds to numerous kinases and promotes their interaction with the Hsp90 complex, resulting in stabilization and promotion of their activity. (nih.gov)
- Members of the NAP/SET family of proteins interact specifically with B-type cyclins. (sdbonline.org)
- The mechanism, which is based on the synthesis and degradation of three ''master regulator'' proteins (CtrA, GcrA, and DnaA), is converted into a quantitative model, in order to study the temporal dynamics of these and other cell cycle proteins. (ebi.ac.uk)
- Polymeric SUMO2 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins (By similarity). (nih.gov)
- C2 The Cyclin E and A genes (but not the Cyclin D gene) are strongly activated by E2F1 (DeGregori et al. (nih.gov)
- The cyclin gene family has undergone a massive expansion in angiosperm plants, but only a few cyclins were thoroughly characterized. (prolekarniky.cz)
- In addition to a constitutively occupied E2F1-Sp1 site immediately upstream of the cyclin E transcription start region, there is downstream a cell cycle-regulated site (termed CERM) that may function as a cyclin E-repressor module. (nih.gov)
- this interaction does not require c-Abl kinase activity. (nih.gov)
- Overexpression of pRb can increase the expression Cyclin D1 by an unknown mechanism (Watanabe et al. (nih.gov)
- We further show that cyclin SDS does not contain a D-box and is constitutively expressed throughout meiosis. (prolekarniky.cz)
- Accordingly, a novel approach that reduces toxic effect but reserves the activity to trigger mitotic arrest and cell death can be helpful in cancer chemotherapy. (biomedcentral.com)
- Mutant analysis revealed that these cyclins contribute to distinct meiosis-related processes. (prolekarniky.cz)
- Rum1 and Cdc18 link inhibition of cyclin-dependent kinase to the initiation of DNA replication in Schizosaccharomyces pombe . (sdbonline.org)
- The kinase assay demonstrated that KUD773 inhibited Aurora A activity. (biomedcentral.com)
- B10 HMG1 or 2 compete with Ku for binding to DNA-PK and stimulate DNA-dependent kinase activity in vitro in the absence of Ku (Yumoto et al. (nih.gov)
- Serine-threonine/tyrosine-protein kinase, catalytic domain [Interproscan]. (ntu.edu.sg)
- Meiosis takes place in pollen and megaspore mother cells that differentiate from archesporial cells through several rounds of mitotic divisions. (prolekarniky.cz)
- Aurora A participates in centrosomal separation, formation of bipolar spindle and attachment of chromosomal kinetochore to mitotic spindle [ 8 , 9 ]. (biomedcentral.com)
- While A2 cyclins are important for chromosome segregation, CYCB3;1 prevents ectopic cell wall formation. (prolekarniky.cz)