• Tissue injury caused by pancreatitis toxins leads to the release of DAMPs - nuclear proteins (such as histones and HMGB1), nuclear and mitochondrial DNA, heat shock proteins, and ATP (60, 134). (pancreapedia.org)
  • Nuclear proteins in particular can be measured as early as 4 h after induction of experimental acute pancreatitis (88, 111). (pancreapedia.org)
  • This process is characteristically slow and persistent, and is regulated in a strict and complex manner through the activity of a variety of proteins. (xiahepublishing.com)
  • AMPK was identified as the core upstream regulatory protein for JH-mediated ILD regulation. (bvsalud.org)
  • Hepatocyte growth factor receptor (c-Met), a member of tyrosine protein kinase receptors (TPKR), is phosphorylated during LPLI-induced proliferation, but tumor necrosis factor alpha (TNF-alpha) receptor has not been affected. (biomedcentral.com)
  • The latter pair inherits the state of its upstream master genes and further reinforces the decision due to several feedback loops, thereby leading to irreversible commitment. (lu.se)
  • In the cell, T3 binds to a nuclear receptor, resulting in transcription of specific thyroid hormone response genes. (pharmaceuticalintelligence.com)
  • Maternal THs acted upstream of pax2a, pax7 and pax8 genes but downstream of shha and fgf8a signalling. (pharmaceuticalintelligence.com)
  • Mechanically, circIKBKB activated NF-κB pathway via promoting IKKβ-mediated IκBα phosphorylation, inhibiting IκBα feedback loop and facilitating NF-κB to the promoters of multiple bone remodeling factors. (biomedcentral.com)
  • Thus, targeting JAK1-2 with ruxolitinib blocks a final pathway that is common to multiple pro-angiogenic factors, suppresses EC-mediated PCC proliferation, and may be useful in PDACs with a strong pro-angiogenic signature. (oncotarget.com)
  • This gene encodes a member of the basic helix-loop-helix leucine zipper family, and can function as a cellular transcription factor. (cancerindex.org)
  • Biochemical studies suggest that in one case this transcription factors to implement particular genetic programs. (lu.se)
  • In occurs through the inhibition of DNA binding of cognate cis- hematopoiesis there exist several lineage branch points with regulatory motif while in the other case DNA binding is unaffected identified key transcription factors and external signals [3-5]. (lu.se)
  • Currently, the clinical interventions for patients with BC-bone metastasis (BC-BM) are bisphosphonates (BPs) or denosumab (an anti-receptor activator of nuclear factor kappa B ligand (RANKL) monoclonal antibody), which disrupt the vicious cycle by targeting osteoclasts [ 6 ]. (biomedcentral.com)
  • Human-derived hepatic cell lines are a valuable alternative to primary hepatocytes for drug metabolism, transport and toxicity studies. (cancerindex.org)
  • Proliferating cell nuclear antigen (PCNA) expression in CNV mice without or with YAP siRNA intravitreal injection and the colocalization of PCNA and CD31 were measured with western blotting and immunofluorescent double staining, respectively. (molvis.org)
  • Pancreatic ductal adenocarcinomas (PDACs) overexpress pro-angiogenic factors but are not viewed as vascular. (oncotarget.com)
  • YAP expression increased following laser exposure, in accordance with vascular endothelial growth factor (VEGF) expression. (molvis.org)
  • The T2DM is a genetically heterogeneous disease, with several relatively rare monogenic forms and a number of more common forms resulting from a complex interaction of genetic and environmental factors. (scialert.net)
  • T2DM is a complex trait where common genetic variants having modest individual effects act together and interact with environmental factors to modulate the risk of the disease. (scialert.net)
  • In resting cells, the binding of members of the IκB family, such as the prototypical IκB member IκBα, to classical NF-κB complexes, particularly NF-κB1 p50-RelA and NF-κB1 p50-c-Rel dimers, inhibit the nuclear translocation of NF-κB complexes. (xiahepublishing.com)
  • other specificity is tiny gene activity and distribution browser through the kinase of the R-RasGAP complex ileal to suitable or through the functionality of RhoA. (evakoch.com)
  • Type 2 Diabetes Mellitus (T2DM) is a complex heterogeneous group of metabolic condition characterized by elevated levels of serum glucose, caused mainly by impairment in both insulin action and insulin secretion. (scialert.net)
  • 3 In resting cells, the NF-κB dimer is inactive and is sequestered in the cytoplasm by binding to members of the κB inhibitory factor (IκB) family. (xiahepublishing.com)
  • 4. Potential role of upstream stimulatory factor 1 gene variant in familial combined hyperlipidemia and related disorders. (nih.gov)
  • Genetic studies implicated upstream stimulatory factor 1 (USF1) in familial combined hyperlipidemia because the rs2073658 minor allele was associated with reduced risk of familial combined hyperlipidemia and related disorders. (nih.gov)
  • 9. Transcriptional regulation of the distal promoter of the rat pyruvate carboxylase gene by hepatocyte nuclear factor 3beta/Foxa2 and upstream stimulatory factors in insulinoma cells. (nih.gov)
  • 11. Characterization of a novel Foxa (hepatocyte nuclear factor-3) site in the glucagon promoter that is conserved between rodents and humans. (nih.gov)
  • 13. Cooperative activation of lipocalin-type prostaglandin D synthase gene expression by activator protein-2beta in proximal promoter and upstream stimulatory factor 1 within intron 4 in human brain-derived TE671 cells. (nih.gov)
  • Second, an L1 transposon element, which is absent in the human promoter, is found 480 bp upstream of the transcription start site in mouse. (aspetjournals.org)
  • Using the electromobility shift and DNase I footprinting experiments, we have identified a hepatocyte nuclear factor 1-binding site in the mouse UGT1A1 promoter that confers responsiveness to both factors HNF1α and HNF1β in HEK293 cells. (aspetjournals.org)
  • 5. Loss of Interdependent Binding by the FoxO1 and FoxA1/A2 Forkhead Transcription Factors Culminates in Perturbation of Active Chromatin Marks and Binding of Transcriptional Regulators at Insulin-sensitive Genes. (nih.gov)
  • 6. Forkhead box transcription factors Foxa1 and Foxa2 are important regulators of Muc2 mucin expression in intestinal epithelial cells. (nih.gov)
  • A family of DNA-binding transcription factors that contain a basic HELIX-LOOP-HELIX MOTIF . (nih.gov)
  • 2007). Finally, TRIF recruitment results in stimulation of the transcription factors IRF3 (interferon regulatory transcription factor 3), NF-κβ (nuclear factor-κβ) and AP-1 (activator protein 1) thought two different branches (Alexopoulou et al. (datexis.com)
  • Basic Helix-Loop-Helix Transcription Factors" is a descriptor in the National Library of Medicine's controlled vocabulary thesaurus, MeSH (Medical Subject Headings) . (wakehealth.edu)
  • This graph shows the total number of publications written about "Basic Helix-Loop-Helix Transcription Factors" by people in this website by year, and whether "Basic Helix-Loop-Helix Transcription Factors" was a major or minor topic of these publications. (wakehealth.edu)
  • Below are the most recent publications written about "Basic Helix-Loop-Helix Transcription Factors" by people in Profiles. (wakehealth.edu)
  • Basic helix-loop-helix transcription factors encoded by the c-myc genes. (nih.gov)
  • Nevertheless, the reported effects of Cd on tumor angiogenesis appear to be either stimulatory or inhibitory, depending on the concentrations. (oncotarget.com)
  • In contrast, low-lose Cd (1-10 μM) up-regulates vascular endothelial growth factor (VEGF)-mediated tumor angiogenesis by exerting sub-apoptotic levels of oxidative stress on both tumor cells and endothelial cells (ECs). (oncotarget.com)
  • The consequent activation of protein kinase B/Akt, nuclear factor-κB, and mitogen-activated protein kinase signaling cascades mediate the increased secretion of VEGF by tumor cells and the up-regulated VEGF receptor-2 expression in ECs. (oncotarget.com)
  • Final common mediators of disease, including tumor necrosis factor-α (TNF-α) and interleukin (IL)-6, are well studied and have yielded breakthrough therapeutics. (frontiersin.org)
  • Proinflammtory cytokine tumor necrosis factor alpha (TNF-α) promoted ATX expression and secretion selectively in Hep3B and Huh7 cells, which led to a corresponding increase in lysophospholipase-D activity. (biomedcentral.com)
  • 10. Hepatocyte nuclear factors 1α/4α and forkhead box A2 regulate the solute carrier 2A2 (Slc2a2) gene expression in the liver and kidney of diabetic rats. (nih.gov)
  • Together, these results provide evidence for a major regulatory function of this liver-enriched transcription factor in UGT1A1 activity in both rodents and human. (aspetjournals.org)
  • In addition, ATX expression was examined in normal human hepatocytes and liver cancer cell lines. (biomedcentral.com)
  • Reticuloendothelial cells (macrophages in the bone marrow and spleen, Kupffer cells in the liver) and hepatocytes are two major areas of iron storage in humans. (ashpublications.org)
  • METHODS AND RESULTS: Endothelium-dependent relaxations to acetylcholine were reduced in aortae of two tumour necrosis factor alpha (TNFα) transgenic mouse lines with either mild (Tg3647) or severe (Tg197) forms of RA in a time- and severity-dependent fashion as assessed by organ chamber myograph. (bvsalud.org)
  • Proteolysis-inducing factor (PIF), isolated from a cachexia-inducing murine tumour, has been shown to stimulate protein breakdown in C 2 C 12 myotubes. (nature.com)
  • By contrast, when groups of mice that had received P. acnes were given endotoxin and bled, higher titres of tumour necrosis factor were found in the sera of L mice. (nih.gov)
  • The NPLOC4-UFD1L-VCP complex regulates spindle disassembly at the end of mitosis and is necessary for the formation of a closed nuclear envelope. (nih.gov)
  • HN - 2006(1998) MH - Activating Transcription Factor 1 UI - D051697 MN - D12.776.260.108.61.500 MN - D12.776.930.127.61.500 MS - An activating transcription factor that regulates expression of a variety of genes including C-JUN GENES and TRANSFORMING GROWTH FACTOR BETA2. (nih.gov)
  • [ 9 ] suggested that high calcium intake might increase prostate carcinogenesis by lowering serum concentrations of 1,25-dihydroxyvitamin D [1,25(OH) 2 D], they could not exclude a role of "additional cancer-promoting factors in the nonfat component" of dairy products. (medscape.com)
  • At concentrations between 2 and 8 n M , PIF stimulated an increased nuclear migration of NF- κ B, which was not seen in myotubes pretreated with EPA. (nature.com)
  • Moreover, we explored the mechanism governing the expression of ATX in hepatoma cells and established a critical role of nuclear factor-kappa B (NF-κB) in basal and TNF-α induced ATX expression. (biomedcentral.com)
  • P61959.1 MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY 1367453_at NP_446195 6.42 hsp90 co-chaperone Cdc37 Cdc37 Rattus norvegicus " Co-chaperone that binds to numerous kinases and promotes their interaction with the Hsp90 complex, resulting in stabilization and promotion of their activity. (nih.gov)
  • Arp2-3 complex binds WASP PROTEIN and existing ACTIN FILAMENTS, and it nucleates the formation of new branch point filaments. (nih.gov)
  • HN - 2006 BX - Arp2-3 Complex MH - Actin-Related Protein 3 UI - D051378 MN - D5.750.78.730.246.750 MN - D12.776.220.525.246.750 MS - A component of the Arp2-3 complex that is related in sequence and structure to ACTIN and that binds ATP. (nih.gov)
  • 15. Novel mechanism of transcriptional repression of the human ATP binding cassette transporter A1 gene in hepatic cells by the winged helix/forkhead box transcription factor A2. (nih.gov)
  • Epidemiological evidence points to increased dairy protein consumption as a major dietary risk factor for the development of PCa. (medscape.com)
  • They are normally involved in nucleic acid metabolism and in mediating the cellular response to growth factors. (nih.gov)
  • Recent advances in adipogenesis had provided insights into understanding of the complex cues for influencing the cytoarchitecture, epigenomic remodeling, signaling pathways and transcription regulators on gene actions for both white and brown adipogenic progression from mesenchymal stem cells to matured committed adipocytes. (scirp.org)
  • The reaction catalyzed by glucokinase is: ATP participates in the reaction in a form complexed to magnesium (Mg) as a cofactor. (wikipedia.org)
  • Hepatoma Hep3B and Huh7 cells displayed stronger ATX expression than hepatoblastoma HepG2 cells and normal hepatocytes did. (biomedcentral.com)
  • 2) The effect of main constituents on downstream targets in nuclear need more further investigation. (frontiersin.org)
  • These complex effects require a diverse approach for screening, evaluation, and risk assessment of potential antithyroid compounds. (nih.gov)
  • The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. (cusabio.com)
  • Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4. (nih.gov)
  • Inroads into effective therapies have been thwarted by a gap in our understanding of the molecular mechanisms involved in cancer development and progression within its complex microenvironment. (biomedcentral.com)