• His research focused on circadian rhythmicity of vertebrates, including contributing to an understanding of light input pathways on extra-retinal photoreceptors of non-mammalian vertebrates, discovering a mammalian mutation for circadian rhythmicity (tau mutation in golden hamsters), and locating a circadian oscillator in the pineal gland of bird. (wikipedia.org)
  • A ubiquitously expressed G-protein-coupled receptor kinase subtype that has specificity for the agonist-occupied form of BETA-ADRENERGIC RECEPTORS and a variety of other G-PROTEIN-COUPLED RECEPTORS. (lookformedical.com)
  • Although it is highly homologous to G-PROTEIN-COUPLED RECEPTOR KINASE 2, it is not considered to play an essential role in regulating myocardial contractile response. (lookformedical.com)
  • A G-protein-coupled receptor kinase subtype that is primarily expressed in the MYOCARDIUM and may play a role in the regulation of cardiac functions. (lookformedical.com)
  • RNA-Seq analysis revealed 105 flowering time-related differentially expressed genes (DEGs) that play roles in the circadian clock/photoperiod, autonomous pathway, and hormone and vernalization pathways. (biomedcentral.com)
  • Here we identify CSNK1E , the gene encoding casein kinase 1 epsilon (CK1ε) as required specifically for the proliferation of breast cancer cells with activated β-catenin and confirm its role as a positive regulator of β-catenin-driven transcription. (plos.org)
  • In fact, their reestablished circadian oscillations resembled the circadian oscillation pattern for locomotor activity of the donor sparrows. (wikipedia.org)
  • Son, K. Kim, Effect of Mefloquine, a Gap Junction Blocker, on Circadian Period2 Gene Oscillation in the Mouse Suprachiasmatic Nucleus Ex Vivo . (atto.co.jp)
  • In the course of investigating metabolic defects in Sik3 -deficient mice ( Sik3 -/- ), we observed that circadian rhythmicity of the metabolisms was phase-delayed. (elifesciences.org)
  • Casein kinase 1 (CK1) is a family of serine/threonine protein kinases that play essential regulatory functions in numerous cellular processes. (pasteur.fr)
  • Previous reports have suggested that protein kinases play important roles in the regulation of circadian clocks ( Reischl and Kramer, 2011 ). (elifesciences.org)
  • A family of serine-threonine kinases that are specific for G-PROTEIN-COUPLED RECEPTORS. (lookformedical.com)
  • In the lab of Colin Pittendrigh, the father of research on biological clocks, Menaker studied the endogenous circadian rhythm of bats (Myotis lucifugus). (wikipedia.org)
  • Casein kinase-1-Delta(CK1d) is an enzyme known to phosphorylate several key proteins in the circadian rhythm cycle, and in particular to phosphorylate Per to induce its movement back into the nucleus to regulate the circadian period. (wpi.edu)
  • Other phenology genes are associated with circadian rhythm such as the barley gene (and (with the barley genes, and [34], and the ((((((and and for detecting SNP in and by high-resolution melting curve method were 32780-64-6 IC50 provided in supplementary file of [36]. (mindunwindart.com)
  • As he continued to study bats, his interest shifted from circadian rhythms to hibernation patterns. (wikipedia.org)
  • When Menaker joined faculty at University of Texas at Austin in 1962, he transitioned to studying circadian rhythms in the house sparrow (Passer domesticus) and the golden hamster (Mesocricetus auratus). (wikipedia.org)
  • To study the effects of temperature on circadian rhythms, Menaker exposed the enucleated sparrows to an electroluminescent panel. (wikipedia.org)
  • In 1979, Menaker and Natille Headrick Zimmerman expanded on Menaker's previous work with house sparrows, by exploring the influence of the pineal gland and hypothalamus on circadian rhythms. (wikipedia.org)
  • Sik3 -/- mice also exhibited other circadian abnormalities, including lengthening of the period, impaired entrainment to the light-dark cycle, phase variation in locomotor activities, and aberrant physiological rhythms. (elifesciences.org)
  • Collectively, SIK3 plays key roles in circadian rhythms by facilitating phosphorylation-dependent PER2 destabilization, either directly or indirectly. (elifesciences.org)
  • Circadian rhythms in mammals are governed by the master oscillator located in the hypothalamic suprachiasmatic nucleus (SCN). (elifesciences.org)
  • D. Ono, S. Honma and K. Honma, Cryptochromes are critical for the development of coherent circadian rhythms in the mouse suprachiasmatic nucleus. (atto.co.jp)
  • In 1968, Menaker provided evidence for the existence of extra-retinal photoreceptors that were sufficient for photoentrainment by measuring rhythmic locomotor behavior as the output signal of the house sparrows (Passer domesticus) circadian clock. (wikipedia.org)
  • He demonstrated that photoentrainment could occur in the absence of optic neurons, evidence for the presence of an extra-retinal photoreceptor(s) coupled to the House Sparrow circadian clock. (wikipedia.org)
  • These lines of evidence suggest that the transcriptional-translational feedback loop mediated by the clock genes, and the post-translational modification of their products, are indispensable to the circadian clock machinery. (elifesciences.org)
  • Suh and K. Kim, Identification and Validation of Cryptochrome Inhibitors That Modulate the Molecular Circadian Clock. (atto.co.jp)
  • A c-jun amino-terminal kinase that is found predominantly within NEURONS of the BRAIN, suggesting a role in stress-induced neuronal APOPTOSIS. (lookformedical.com)
  • Casein Kinase-1𝛿 Delta is. (wpi.edu)
  • These factors and their modulators contribute to determination and fine-tuning of the circadian period and the phase. (elifesciences.org)
  • However, the molecular mechanisms underlying the determination or stabilization of the circadian period and phase remain to be investigated in mammals. (elifesciences.org)
  • The genomic sequence of was retrieved from morex_contig_274284 identified by BLASTn analysis of "type":"entrez-nucleotide","attrs":"text":"JX648176″,"term_id":"410442692″JX648176 sequence from [30] versus the whole genome sequence assembly 3 of cv Morex [44]. (mindunwindart.com)
  • ClC-1: Primers 5CTGCATTTGGAAGGCTGGTAGGAG-3 and 5AATGACGGCTGTGGAGACTGTGTG-3 Accession quantity "type":"entrez-nucleotide","attrs":"text":"XM_149848″,"term_id":"28523426″,"term_text":"XM_149848″XM_149848, amplicon = 161 bp, consists of 48740 RP region from the molecule from 1557 to 1717. (tam-receptor.com)
  • ClC-2: Primers 5-CGGGGAGTGGTGCTGAAAGAATA-3 and 5TCCGGGACTCATGCTCATAGATACC-3 Accession quantity "type":"entrez-nucleotide","attrs":"text":"NM_009900″,"term_id":"164698431″,"term_text":"NM_009900″NM_009900, amplicon = 193 bp, consists of region from the molecule from 657 to 849. (tam-receptor.com)
  • ClC-3: Primers 5-CCCGAGGTGGAGAGAGACTGCT-3 and 5CCGGCTTTCAGAGAGGTTACG-3 Accession quantity "type":"entrez-nucleotide","attrs":"text":"X78874″,"term_id":"854275″,"term_text":"X78874″X78874, amplicon = 174 bp, consists of region from the molecule from 41 to 214. (tam-receptor.com)
  • ClC-4: Primers 48740 RP 5-TTATTGCTTGAGGACAGACGGGC-3 and 5-GGGGCAAGTGTTCAGCGTCAT-3 Accession quantity "type":"entrez-nucleotide","attrs":"text":"Z49916″,"term_id":"929679″,"term_text":"Z49916″Z49916, amplicon = 174 bp, consists of region from the molecule from 36 to 193. (tam-receptor.com)
  • The medical records of the 78 patients show a significant difference between the disease-free survival times of the 37 non-distant- and the 41 distant-metastasis patients. (biomedcentral.com)
  • KASP assays of and and from LGC genomics were found monomorphic in the populations (data not shown). (mindunwindart.com)
  • Click Gene ID to show a list of GSM assays in which the gene are specifically expressed. (or.jp)
  • This study was to investigate the expression of Id-1 in bladder cancer and its association with EMT. (chksignal.com)
  • Results and Discussion: The results showed that a lack of time was reported by 80% of the participants as a barrier to PA, including 63% inactive and 17% of the active participants. (westminster.ac.uk)
  • MAT-LAB simulations of the algorithm on an EEG dataset containing 982 expert marked events in 4 days of data show that 90% of events can be correctly recorded while achieving a 50% data reduction. (chksignal.com)
  • A meta-analysis of randomized controlled trials showed reductions in systolic blood pressure (SBP) and diastolic blood pressure (DBP) of ≈1 mmHg for each kilogram of weight loss (8). (researchgate.net)
  • This study aimed to investigate whether Ang II mediates the proliferation of vascular smooth muscle cells (VSMCs) through the interaction between the clock system and the mitogen-activated protein kinase (MAPK) signaling pathway. (bvsalud.org)
  • Importantly, silencing Per1 or Per2 in VSMCs led to decreased expression of key MAPK pathway proteins, including RAS, phosphorylated mitogen-activated protein kinase (P-MEK), and phosphorylated extracellular signal-regulated protein kinase (P-ERK). (bvsalud.org)
  • 19. 3,4-Diaryl-isoxazoles and -imidazoles as potent dual inhibitors of p38alpha mitogen activated protein kinase and casein kinase 1delta. (nih.gov)
  • Our current study aims to investigate a possible interconnection between the circadian clock and the mTORC1 signaling pathway in folliculogenesis and oocyte maturation. (bvsalud.org)
  • This study reports the identification of Drosophila Activated cdc42 kinase as a growth promoter and a novel Hippo signaling pathway regulator. (sdbonline.org)
  • Here, we used phospho-specific antibodies to show that PER2 is phosphorylated on Ser-662 and flanking casein kinase (CK) sites in vivo. (nih.gov)
  • The phosphorylation of PER2 was carried out by the combined activities of casein kinase 1δ (CK1 δ) and casein kinase 1ε (CK1ε) and was antagonized by protein phosphatase 1. (nih.gov)
  • PER2 phosphorylation was rapidly induced in response to circadian entrainment of mammalian cell lines and occurred in both cytosolic and nuclear compartments. (nih.gov)
  • PER2, an essential circadian molecule, regulates various physiological processes. (bvsalud.org)
  • Mitochondrial metabolic evaluation aimed to investigate the mechanism of PER2-mediated hDPSC odontoblastic/osteogenic differentiation, which showed that PER2 increased ATP synthesis, elevated mitochondrial membrane potential and changed expression of proteins regulating mitochondrial dynamics. (bvsalud.org)
  • Here we demonstrate that the circadian system regulates mTORC1 signaling via Per2 dependent mechanism in the mouse ovary. (bvsalud.org)
  • 5. Site-specific phosphorylation of casein kinase 1 δ (CK1δ) regulates its activity towards the circadian regulator PER2. (nih.gov)
  • Thus, this study identifies Drosophila Activated cdc42 kinase as a Hippo pathway regulator. (sdbonline.org)
  • 15. Casein kinase 1 regulates human hypoxia-inducible factor HIF-1. (nih.gov)
  • A model is proposed that activated cdc42 kinase negatively regulates Expanded by changing its phosphorylation status to promote tissue growth. (sdbonline.org)
  • 9. Structure, regulation, and (patho-)physiological functions of the stress-induced protein kinase CK1 delta (CSNK1D). (nih.gov)
  • The enzyme plays a key role in sleep-wake cycles, or circadian rhythms, of species ranging from fruit flies to mice to people. (nih.gov)
  • At the molecular level, the circadian clock is regulated by a time delayed transcriptional-translational feedback loop in which the core proteins interact with each other rhythmically to drive daily biological rhythms. (nih.gov)
  • As he continued to study bats, his interest shifted from circadian rhythms to hibernation patterns. (wikipedia.org)
  • When Menaker joined faculty at University of Texas at Austin in 1962, he transitioned to studying circadian rhythms in the house sparrow (Passer domesticus) and the golden hamster (Mesocricetus auratus). (wikipedia.org)
  • To study the effects of temperature on circadian rhythms, Menaker exposed the enucleated sparrows to an electroluminescent panel. (wikipedia.org)
  • In 1979, Menaker and Natille Headrick Zimmerman expanded on Menaker's previous work with house sparrows, by exploring the influence of the pineal gland and hypothalamus on circadian rhythms. (wikipedia.org)
  • This Funding Opportunity Announcement (FOA) encourages applications that propose to conduct mechanistic studies of the circadian rhythms involved in alcohol-induced organ damage. (nih.gov)
  • The objective of this FOA is to understand the molecular mechanisms of alcohol-induced tissue damage that involve central and peripheral circadian rhythms, particularly their connection with metabolism and metabolic disorders. (nih.gov)
  • In the past two decades, major progress has been made to understand the molecular mechanisms of circadian rhythms. (nih.gov)
  • 18. Structural basis for the potent and selective inhibition of casein kinase 1 epsilon. (nih.gov)
  • 17. Casein kinase 1 delta (CK1delta) interacts with the SNARE associated protein snapin. (nih.gov)
  • This regulation is controlled by the expression of circadian clock genes involved in the cell cycle. (bvsalud.org)
  • 14. Molecular basis for the regulation of the circadian clock kinases CK1δ and CK1ε. (nih.gov)
  • Recent studies have also revealed that circadian system affects metabolic homeostasis while metabolic pathways feed back into the regulation of circadian system and modulate many physiological processes and behavior. (nih.gov)
  • Further in vivo analysis shows that ExC2 is important for Ex to control Drosophila tissue growth. (sdbonline.org)
  • Genome-wide ChIP-Seq mapping of STAT3- and IRF4-binding sites showed that most regions with IL-21-induced STAT3 binding also bound IRF4 in vivo, and furthermore, revealed that the noncanonical TTCnnnTAA GAS motif critical in Prdm1 was broadly used for STAT3 binding. (gsea-msigdb.org)
  • Correspondingly, ChIP-Seq analysis of Irf4_/_ T cells showed greatly diminished STAT3 binding after IL-21 treatment, and Irf4_/_ mice showed impaired IL- 21-induced Tfh cell differentiation in vivo. (gsea-msigdb.org)
  • We have shown that the 3beta-hydroxypregnane steroid UC1011 can inhibit allopregnanolone-induced learning impairment and chloride uptake potentiation in vitro and in vivo. (researchgate.net)
  • P61959.1 MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY 1367453_at NP_446195 6.42 hsp90 co-chaperone Cdc37 Cdc37 Rattus norvegicus " Co-chaperone that binds to numerous kinases and promotes their interaction with the Hsp90 complex, resulting in stabilization and promotion of their activity. (nih.gov)
  • 16. Newly Developed CK1-Specific Inhibitors Show Specifically Stronger Effects on CK1 Mutants and Colon Cancer Cell Lines. (nih.gov)
  • 12-h) cycles of activity and gene expression predominated in aposymbiotic morphs, circadian (approx. (biomedcentral.com)
  • The bar shown representes the lower 25% and upper 25% of the expression distribution. (uth.edu)
  • Activated cdc42 kinase promotes tissue growth through modulating Yorkie activity. (sdbonline.org)
  • This is the first gene in which mutations have been shown to cause a very typical form of migraine," says Ptácek. (nih.gov)
  • However, the nature of the relationship between the circadian and circatidal clocks (specifically, whether common components are involved or they operate independently), and the question of whether this mechanism is unique to Eurydice , is not yet clear. (biomedcentral.com)
  • SCF-Slimb is critical for Glycogen synthase kinase-3beta-mediated suppression of TAF15-induced neurotoxicity in Drosophila. (nih.gov)
  • Non-receptor tyrosine kinase Activated cdc42 kinase (see Drosophila Ack ) was reported to participate in several types of cancers in mammals. (sdbonline.org)
  • When treated with a migraine-triggering compound, the mice showed increased sensitivity to pain. (nih.gov)
  • Previous circular dichroism (CD) spectroscopic studies have shown that mouse PER2c (mPER2c) is less structured in solution by itself but folded into stable secondary structures upon interaction with mouse CRYs. (nih.gov)
  • The Hippo kinase cascade represses the growth-promoting transcription co-activator Yorkie. (sdbonline.org)
  • A Novel HER2-Selective Kinase Inhibitor Is Effective in HER2 Mutant and Amplified Non-Small Cell Lung Cancer. (ufl.edu)
  • The circadian system comprises of a complex feedback network that involves interactions between the central nervous system and peripheral tissues. (nih.gov)
  • Nearly a decade ago, Ptácek's team showed that affected family members had mutations in an enzyme called casein kinase Iδ (CKIδ). (nih.gov)
  • Imaging and electrophysiological studies showed waves of brain activity and brain artery dilation believed to be similar to what occurs during migraine auras in humans. (nih.gov)
  • In our experiments, pyrolyzed components of cigarettes have been shown to induce a strong stress response in cultured cells. (ijpsr.com)
  • In further analysis, the researchers showed that the CKIδ mutations in both families reduce the enzyme's activity. (nih.gov)
  • These results demonstrate that retinal light receptors are not necessary for photoentrainment, indicating there is an extra-retinal photoreceptor(s) contributing to circadian locomotor activity. (wikipedia.org)
  • In fact, their reestablished circadian oscillations resembled the circadian oscillation pattern for locomotor activity of the donor sparrows. (wikipedia.org)
  • 7. The kinase domain of CK1δ can be phosphorylated by Chk1. (nih.gov)
  • This search feature obtains best-matches with the terms you choose, and shows an overall score based on the scientific rankings. (nih.gov)
  • These results show that fj RNAi reduces adult wing size and that silencing f results in abnormal wing folding in T. castaneum. (sdbonline.org)