The phosphoinositide phosphatase Sac1p controls trafficking of the yeast Chs3p chitin synthase. (embl.de)
STP, serine/threonine protein phosphatase. (rupress.org)
EGFR1
In the context of non-small cell lung cancers (NSCLC) harboring EGFR-oncogenic mutations, augmented levels of AXL and GAS6 have been found to drive resistance to EGFR tyrosine kinase inhibitors such as Erlotinib and Osimertinib in certain tumors with mesenchymal-like features. (regenerativemedicine.net)
Serine1
The reversible phosphorylation of proteins on serine, threonine, and tyrosine residues represents a fundamental strategy used by eukaryotic organisms to regulate a host of biological functions, including DNA replication, cell cycle progression, energy metabolism, and cell growth and differentiation. (rupress.org)
Signal Transduction1
Phosphoinositide phosphatases play an essential but as yet not well-understood role in lipid-based signal transduction. (embl.de)
Although the importance of kinases in this process has long been recognized, an appreciation for the complex and fundamental role of phosphatases is more recent. (rupress.org)
Through extensive biochemical and genetic analysis, we now know that pathways are not simply switched on with kinases and off with phosphatases. (rupress.org)
Furthermore, kinases and phosphatases may work together to modulate the strength of a signal. (rupress.org)
Adding further complexity to this picture is the fact that both kinases and phosphatases can function in signaling networks where multiple kinases and phosphatases contribute to the outcome of a pathway. (rupress.org)
To fully understand this complex and essential regulatory process, the kinases and phosphatases mediating the changes in cellular phosphorylation must be identified and characterized. (rupress.org)
A variety of approaches, including biochemical purification, gene isolation by homology, and genetic screens, have been successfully used for the identification of putative protein kinases and phosphatases. (rupress.org)
MAPK2
To address the possibility that activation of phosphatidylinositol-3-kinase (PI3K) and the mammalian target of rapamycin (mTOR/FRAP), represents one of these pathways, we have examined the effect of simultaneous inhibition of the Ras-MAPK and PI3K-mTOR pathways on transformation of CEF by v-Src. (embl.de)
Inhibition of the Ras-MAPK pathway by expression of the dominant-negative Ras mutant HRasN17 or by addition of the MAPK kinase (MEK) inhibitor PD98059 reduced several of these parameters but failed to block transformation. (embl.de)
Phosphatidylinositol4
The recruitment of specific cytosolic proteins to intracellular membranes through binding phosphorylated derivatives of phosphatidylinositol (PtdIns) controls such processes as endocytosis, regulated exocytosis, cytoskeletal organization, and cell signaling. (embl.de)
We report here that Sac1p has a specific role in secretion and acts as an antagonist of the phosphatidylinositol 4-kinase Pik1p in Golgi trafficking. (embl.de)
Synthesis of new cyclitol compounds that influence the activity of phosphatidylinositol 4-kinase isoform, PI4K230. (embl.de)
The synthesis, chemical derivatization, and investigation of the inhibitory properties of novel cyclitol derivatives on the phosphatidylinositol 4-kinase enzymes PI4K55 and PI4K230 involved in the phosphatidylinositol cycle are reported. (embl.de)
Phosphorylation1
Protein phosphorylation can regulate enzyme function, mediate protein-protein interactions, alter subcellular localization, and control protein stability. (rupress.org)
Transmembrane1
Aspartate β-hydroxylase (ASPH) is a type II transmembrane protein and the member of α-ketoglutarate-dependent dioxygenase family, found to be overexpressed in different cancer types, including PC. (bjbms.org)
Pathways1
What pathways are this gene/protein implicaed in? (cancerindex.org)
Cellular1
Despite the detailed in vitro characterization of the enzymatic properties of yeast Sac1p, the exact cellular function of this protein has remained obscure. (embl.de)
Function2
In addition, the double mutant (Y42A/L48Q) of the PX domain of Vam7p, reported to cause vacuolar trafficking defects in yeast, has a dramatically decreased level of binding to PtdIns-3-P. These data reveal that the membrane targeting function of the Vam7p PX domain is based on its ability to associate with PtdIns-3-P, analogous to the function of FYVE domains. (embl.de)
He designed computer hardware, software, and algorithms that accelerate molecular dynamics simulations by orders of magnitude, and applied these simulations to the study of protein function, protein folding, and protein-drug interactions. (stanford.edu)
Growth1
Hydroxylation of aspartic acid in domains homologous to the epidermal growth factor precursor is catalyzed by a 2-oxoglutarate-dependent dioxygenase. (bjbms.org)
Small1
Metformin (MTF) has been reported to target NLK (Nemo-like kinase) to inhibit non-small lung cancer cells. (cancerindex.org)
Intracellular1
This process generates two second messengers, inositol 1,4,5-trisphosphate and diacylglycerol, which respectively regulate the intracellular Ca2+ levels and protein kinase C activation. (bvsalud.org)
Mediate1
These results suggest that MC delivery via microvesicles can mediate gene transfer to an extent that enables effective prodrug conversion and tumor cell death such that it comprises a promising approach to cancer therapy. (regenerativemedicine.net)
Enzymes2
Proteins and enzymes involved in cellular signaling are important players in determining the outcome of host-pathogen interactions. (bvsalud.org)
In this study, delivery vehicles comprised of microvesicles loaded with engineered minicircle (MC) DNA that encodes prodrug converting enzymes were developed as a cancer therapy in mammary carcinoma models. (regenerativemedicine.net)
Motifs2
HN - 2017 MH - ADAMTS1 Protein UI - D000071097 MN - D8.811.277.656.675.374.102.500.500 MN - D9.400.430.500.500.500 MN - D12.776.395.33.500.500 MN - D12.776.860.300.85.500 MS - An ADAMTS protease that contains two disintegrin loops and three C-terminal thrombospondin (TS) motifs. (nih.gov)
HN - 2017 MH - ADAMTS13 Protein UI - D000071120 MN - D8.811.277.656.675.374.102.500.813 MN - D9.400.430.500.500.813 MN - D12.776.395.33.500.813 MN - D12.776.860.300.85.813 MS - An ADAMTS protease that contains eight thrombospondin (TS) motifs. (nih.gov)
Residues1
This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. (nih.gov)
Degradation2
Polymeric SUMO2 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins (By similarity). (nih.gov)
Progression through the cell cycle critically relies upon post-translational mechanisms including changes in activity of cell cycle kinases and phosphatases, and ubiquitin-mediated degradation of specific components once their function is complete. (elifesciences.org)
Regulate1
HN - 2017 MH - ADAM12 Protein UI - D000072199 MN - D8.811.277.656.675.374.102.125 MN - D9.400.430.500.125 MN - D12.776.395.33.125 MS - A disintegrin and metalloproteinase domain-containing protein that is expressed as two alternatively-spliced forms: a long transmembrane form (ADAM12-L) and a short soluble form (ADAM12-S). It modulates the cleavage of INSULIN-LIKE GROWTH FACTOR BINDING PROTEINS and may also regulate CELL FUSION during MYOGENESIS. (nih.gov)
Tumor4
Hyperactivation of these pathways drives tumorigenesis and supports tumor growth.2 Signaling pathway proteins that are commonly activated by physiological responses include growth factor receptor (e.g. (technologynetworks.com)
It cleaves the membrane-bound precursor of TUMOR NECROSIS FACTOR-ALPHA between ALANINE 76 and VALINE 77 to its functional form, as well as several other CELL SURFACE PROTEINS to their soluble forms, including AMYLOID BETA-PROTEIN PRECURSOR and PRION PROTEIN. (nih.gov)
HN - 2017 (1997) MH - ADAM17 Protein UI - D000072198 MN - D8.811.277.656.675.374.102.375 MN - D9.400.430.500.375 MN - D12.776.395.33.375 MN - D23.50.301.264.35.57 MN - D23.101.100.110.57 MS - A disintegrin and metalloproteinase domain-containing protein that cleaves the membrane-bound precursor of TUMOR NECROSIS FACTOR-ALPHA to its mature form. (nih.gov)
In vivo evaluation of the bystander effect in mouse models demonstrated that for effective therapy, at least 1% of tumor cells need to be delivered with TK-NTR-encoding MCs. (regenerativemedicine.net)
Nuclear1
Src and Abl), lipid kinases (e.g. phosphoinositide 3-kinases, PI3Ks), as well as nuclear receptors (e.g. the estrogen receptor). (technologynetworks.com)
Tissue1
Tissue and gene enrichment assays showed that the genes that were over-expressed in the CNS were related to functions including neurodevelopment, histone methylation, neurogenesis and synaptic modification. (pharmaceuticalintelligence.com)
Our results provide evidence that during Plasmodium male gametogony, this divergent cyclin/CDK pair fills the functional space of other eukaryotic cell-cycle kinases controlling DNA replication. (elifesciences.org)
Diseases1
An efficient strategy to control diseases caused by pathogens is to disable susceptibility genes that facilitate infection. (bvsalud.org)
Precursor1
Probe Set ID Ref Seq Protein ID Signal Strength Name Gene Symbol Species Function Swiss-Prot ID Amino Acid Sequence 1367452_at NP_598278 16.8 small ubiquitin-related modifier 2 precursor Sumo2 Rattus norvegicus " Ubiquitin-like protein that can be covalently attached to proteins as a monomer or as a lysine-linked polymer. (nih.gov)
Expression1
Microvesicles loaded with MCs encoding a thymidine kinase (TK)/nitroreductase (NTR) fusion protein produced prolonged TK-NTR expression in mammary carcinoma cells. (regenerativemedicine.net)
Evidence from previous research suggests that MDD is heritable, but the details of the specific gene correlates are unclear. (pharmaceuticalintelligence.com)
Activity2
P61959.1 MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY 1367453_at NP_446195 6.64 hsp90 co-chaperone Cdc37 Cdc37 Rattus norvegicus " Co-chaperone that binds to numerous kinases and promotes their interaction with the Hsp9N/A complex, resulting in stabilization and promotion of their activity. (nih.gov)
Regulates E3 ubiquitin-protein ligase activity of RNF19A (By similarity). (nih.gov)
Form1
PEP was converted to acetate and CO2 (via pyruvate kinase, pyruvate dehydrogenase, and acetate kinase) or carboxylated to form succinate (via PEP carboxykinase, malate dehydrogenase, fumarase, and fumarate reductase). (nih.gov)
Family1
The tomato (Solanum lycopersicum) PLC gene family has six members, named from SlPLC1 to SlPLC6. (bvsalud.org)
RESULTS1
RESULTS: Bupivacaine, in a concentration-dependent manner (10-300 microM), tonically inhibited the peak amplitude of ICa,L. The inhibition was characterized by an increase in the time of recovery from inactivation and a negative-voltage shift of the steady-state inactivation curve. (nih.gov)