- Cloning, mapping, and characterization of activated leukocyte-cell adhesion molecule (ALCAM), a CD6 ligand. (hcdm.org)
- CD166 antigen (Protein name ) , CD166_CANFA from NCBI database. (eiaab.com)
- ALCAM (CD166) is involved in extravasation of monocytes rather than T cells across the blood-brain barrier. (unibas.ch)
- Spatial patterns of gene expression manifest at scales ranging from local (e.g., cell-cell interactions) to global (e.g., body axis patterning). (bvsalud.org)
- BST2 bone marrow stromal cell antigen 2 (Tetherin): Candida albicans enhanced the production of the CCR5-interacting chemokines CCL3, CCL4, and CCL5, and stimulates the production of interferon-a and the restriction factors APOBEC3G, APOBEC3F, and tetherin (BST2) in macrophages Rodriguez et al, 2013 . (polygenicpathways.co.uk)
- For antibodies, ELISA/CLIA, proteins. (eiaab.com)
- A mass spectrometry based independent analysis of circulating immunoglobulin (Ig)-bound proteins in ovarian cancer and of ovarian cancer cell surface MHC-II bound peptides also revealed a TP53-MYC related network of antigens. (bvsalud.org)
- The self-association property of Nab3 adds to the previously documented interactions between these hnRNP-like proteins, RNA polymerase II, and the nascent transcript, Selleck Entinostat leading to a network of nucleoprotein interactions that define a higher order Nrd1-Nab3 complex. (chksignal.com)
- Hem CD, Ekornhol M, Granum S, Sundvold-Gjerstad V, Spurkland A. CD6 and Linker of Activated T Cells are Potential Interaction Partners for T Cell-Specific Adaptor Protein. (hcdm.org)
- We conducted an initial screen of antigens associated with an autoantibody response in serous ovarian cancer using recombinant protein arrays. (bvsalud.org)
- is to generate an antibody-like molecule by combining framework sequences from a human mAb with sequences from a human protein that carries a target-recognition function. (coek.info)
- Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. (medchemexpress.com)
- Clustered regularly interspaced short palindromic repeats (CRISPR) has greatly expanded the ability to genetically probe virus-host interactions. (mdpi.com)
- Monoclonal antibodies (mAbs) have proved to be extremely useful not only as research tools, but also as diagnostic tools and therapeutic agents. (coek.info)
- Antibody-drug conjugate (ADC) is a new generation of therapeutic drugs, consisting of antibodies, small molecule drugs (payloads), and linkers connecting antibodies and payloads. (genemedi.com)
- The efficacy of a therapeutic antibody depends on the Fab fragment and its binding activity to the target antigen, but also depends on the Fc fragment and its interaction with key Fc receptors.Therefore, candidates must be tested against a panel of receptors during antibody engineering. (acrobiosystems.com.cn)
- The DAR of our sample is almost the same as that of the standard sample, but the integrity of the antibody result is not as good as that of the standard sample. (genemedi.com)
- Figure C and figure D: LC-MS to detect the DAR(drug-to-antibody ratio) of ADC. (genemedi.com)
- Setting the corresponding isotype control antibody to detect non-specific binding can reduce the generation of false positive results and evaluate the possible influencing factors accurately in the drug development process. (acrobiosystems.com.cn)
- However, knowledge about the direct interactions of bacteriophages with mammalian organisms and their other, i.e. non-antibacterial, activities in mammalian systems is quite scarce. (biomedcentral.com)
- citation needed] According to one of the researchers involved in the original research, "Two patterns (I and II) showed close similarities to T-cell-mediated or T-cell plus antibody-mediated autoimmune encephalomyelitis, respectively. (wikipedia.org)
- 1 2 Cell surface antigens CD38 and CD138 can be used to distinguish normal cells from clonal plasma cells, but more extensive use of immunophenotyping has been limited by a lack of universally accepted markers of MM. 3-5 Once diagnosed, the current standard-of-care for MM includes immunomodulatory drugs, proteasome inhibitors, steroids, and antibody therapies. (bmj.com)
- However, it has been difficult to obtain human mAbs, especially those directed at human antigens, for at least two reasons. (coek.info)
- One approach is to minimize the amount of nonhuman sequences by combining framework sequences from a human mAb with antigenbinding sequences from a nonhuman mAb, for exanple, in chimerici or humanized' antibodies. (coek.info)
- Conclusion: A large network of molecular interactions is needed for termination. (chksignal.com)
- Our findings support the occurrence of a humoral immune response to antigens linked to ovarian cancer driver genes that may have utility for early detection applications. (bvsalud.org)
- These data strengthen the idea that a multiplicity of interactions is needed to assemble a higher order Nrd1-Nab3 complex that coats specific nascent RNAs in preparation for termination. (chksignal.com)
- May play a role in the binding of T- and B-cells to activated leukocytes, as well as in interactions between cells of the nervous system. (eiaab.com)
- Cocapture of cognate and bystander antigens can activate autoreactive B cells. (unibas.ch)
- We conducted an initial screen of antigens associated with an autoantibody response in serous ovarian cancer using recombinant protein arrays. (bvsalud.org)
- By applying an integrative bioinformatics pipeline combining public information on a wealth of biological layers of complexity (from genetic polymorphisms to protein interactions), this study identified a module of co-expressed genes highly correlated with tumor stage and statistically linked to several genomic regions (module Quantitative Trait Loci, mQTLs). (neurorgs.net)
- [ 20 ] Among the many candidates that could represent such a soluble factor, members of the transforming growth factor superfamily (transforming growth factor-β), hepatic growth factors, prostaglandin E2, and IL-10 secreted by MSCs have all been found to suppress T-cell-mediated antigen responses in vitro. (medscape.com)
- A mass spectrometry based independent analysis of circulating immunoglobulin (Ig)-bound proteins in ovarian cancer and of ovarian cancer cell surface MHC-II bound peptides also revealed a TP53-MYC related network of antigens. (bvsalud.org)
- [ 25 ] In addition to antigen recognition through the T-cell receptor, T-cell activation requires costimulatory signals involving specific molecules on the surface of both T-cells and dendritic cells. (medscape.com)
- Promotes T-cell activation and proliferation via its interactions with CD6 (PubMed:15048703, PubMed:16352806, PubMed:24945728). (nih.gov)
- Inhibits endothelial cell migration and promotes endothelial tube formation via homotypic interactions (PubMed:15496415, PubMed:23169771). (nih.gov)
- P61959.1 MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY 1367453_at NP_446195 8.92 hsp90 co-chaperone Cdc37 Cdc37 Rattus norvegicus " Co-chaperone that binds to numerous kinases and promotes their interaction with the Hsp90 complex, resulting in stabilization and promotion of their activity. (nih.gov)
- The efficacy of a therapeutic antibody depends on the Fab fragment and its binding activity to the target antigen, but also depends on the Fc fragment and its interaction with key Fc receptors.Therefore, candidates must be tested against a panel of receptors during antibody engineering. (acrobiosystems.com)
- Setting the corresponding isotype control antibody to detect non-specific binding can reduce the generation of false positive results and evaluate the possible influencing factors accurately in the drug development process. (acrobiosystems.com)
- Harnessing the immune response to tumor antigens in the form of autoantibodies, which occurs early during tumor development, has relevance to the detection of cancer at early stages. (bvsalud.org)
- Cell adhesion molecule that mediates both heterotypic cell-cell contacts via its interaction with CD6, as well as homotypic cell-cell contacts (PubMed:7760007, PubMed:15496415, PubMed:15048703, PubMed:16352806, PubMed:23169771, PubMed:24945728). (nih.gov)
- Spatial patterns of gene expression manifest at scales ranging from local (e.g., cell-cell interactions) to global (e.g., body axis patterning). (bvsalud.org)
- Proteolytic cleavage, interaction with integrins, or pH changes in the local environment activate latent TGF-β [ 4 ]. (springer.com)