- Adenosine A2 Receptor Agonists" is a descriptor in the National Library of Medicine's controlled vocabulary thesaurus, MeSH (Medical Subject Headings) . (harvard.edu)
- This graph shows the total number of publications written about "Adenosine A2 Receptor Agonists" by people in Harvard Catalyst Profiles by year, and whether "Adenosine A2 Receptor Agonists" was a major or minor topic of these publication. (harvard.edu)
- Below are the most recent publications written about "Adenosine A2 Receptor Agonists" by people in Profiles. (harvard.edu)
- Compounds that selectively bind to and activate ADENOSINE A2 RECEPTORS. (harvard.edu)
- We conclude that hypertonic stress regulates neutrophil function via a single molecule (ATP) and its metabolite (adenosine), using positive- and negative-feedback mechanisms through the activation of P2 and A2 receptors, respectively. (escholarship.org)
- Typically, so called stubborn fat is estrogenic by nature, however some people just have high numbers of A2 receptors. (juicedmuscle.com)
- The A2 receptor is highly influenced by oestrogen if you are a women, and if you have estrogenic fat patterns you most likely have large numbers of A2 receptors. (juicedmuscle.com)
- Thromboxane A2 (TXA2) receptor is a member of the family of G protein-coupled receptors and performs an essential role in hemostasis by interacting with TXA2 to induce platelet aggregation. (jci.org)
- Non-selective benzodiazepine (BZ) binding-site full agonists, exemplified by diazepam, act by enhancing the inhibitory effects of GABA at GABA(A) receptors containing either an alpha1, -2, -3 or -5 subunit. (hhs.gov)
- The relevance of A1 and A2 receptors to CNS function is certainly under active analysis. (thetechnoant.info)
- Nevertheless, the potencies of adenosine agonists in locomotor major depression were recently discovered to correlate towards the potencies from the analogs at A2 adenosine receptors rather than to potencies at A1 adenosine receptors (Durcan and Morgan, 1989a), resulting in the proposal that mainly A2 receptors get excited about these results. (thetechnoant.info)
- Spealman and Coffin (1986) also figured A2 receptors had been involved with disrupting schedule-controlled behavior in monkeys. (thetechnoant.info)
- Although A1-selective agonists have already been created, adenosine agonists or antagonists really selective for A2 adenosine receptors for make use of as physiological probes have already been difficult to recognize. (thetechnoant.info)
- Lately, we reported that APEC is normally a powerful locomotor depressant in mice which the pharmacological profile of the actions suggests activation of A2 adenosine receptors (Nikodijevic 1990). (thetechnoant.info)
- Modafinil has partial alpha 1B-adrenergic agonist effects by directly stimulating the receptors. (illnesshacker.com)
- Studies show CBG behaving as an agonist of 5-HT1A receptors. (cbdsafe.com)
- In its 5-HT1A-agonist role, Cannabigerol binds and activates G-protein-coupled a2-adrenergic receptors to influence the release of epinephrine and norepinephrine. (cbdsafe.com)
- Although LILRA3 function is unknown, its high structural homology to activating LILRA1 and A2 indicate that it may act as antagonist or agonist to these receptors. (aai.org)
- the respective roles of the A1-, A2-, A3-adenosine receptors as well as the involvement of the PI3-K/PKB/Akt and ERKp44/p42 signal transduction pathways, in the cardioprotective phenomemon of -adrenergic preconditioning and (iv) the contribution of the mitochondrial KATP channels (mKATP), reactive oxygen species and NO to the mechanism of -AR-induced cardioprotection. (sun.ac.za)
- Attenuation of adverse effects of noise induced hearing loss on adult neurogenesis and memory in rats by intervention with Adenosine A2A receptor agonist. (harvard.edu)
- Platelet-rich plasma (PRP) or isolated cells prepared from the blood of healthy, adult humans were treated with bedaquiline (0.625-10 μg/ml), followed by activation with adenosine 5'-diphosphate (ADP), thrombin or the thromboxane A2 receptor agonist (U46619). (up.ac.za)
- The locomotor effects in mice of selective A1 and A2 adenosine agonists, antagonists and combinations of agonists were investigated utilizing a computerized activity monitor. (thetechnoant.info)
- Hence, it would appear that A1- and A2-selective adenosine agonists possess different central depressant results, which may be potentiative. (thetechnoant.info)
- RESULTS: Fresh PLTs responded to the dual agonists arachidonic acid and adenosine diphosphate (ADP) to aggregate and produce thromboxane A2, and in both the PLT surface markers P-selectin and GPIIb-IIIa increased and GPIb decreased after stimulation. (umassmed.edu)
- the A2 receptor antagonists 8-(p-sulfophenyl)theophylline, 3,7-dimethyl-1-(2-propynyl)xanthine, 1,3,7-trimethyl-8-(3-chlorostyryl)xanthine, and 3-propylxanthine, but not A1 and A3 receptor antagonists, decreased the suppressive effect of HS, indicating that HS suppresses neutrophils via A2 receptor activation. (escholarship.org)
- Measurement of the Gibbs adsorption isotherm showed that the surface areas of SP and its agonist (240 +/- 5 A2 at biologically relevant concentrations) were distinctly larger than those of the antagonists (138 +/- 5 A2) [Seelig, A. (1990) Biochim. (unibas.ch)
- Arg60 to Leu mutation of the human thromboxane A2 receptor in a dominantly inherited bleeding disorder. (jci.org)
- U46619 is a stable synthetic analog of the endoperoxide prostaglandin PGH2 first prepared in 1975, and acts as a thromboxane A2 (TP) receptor agonist. (wikipedia.org)
- U46619 is a potent, and stable thromboxane A2 (TP) receptor agonist. (guidetopharmacology.org)
- In this study, we demonstrate that the 41-aa cleaved peptide, TR1-41 (MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPR) is a strong platelet agonist. (umassmed.edu)
- In summary, the cleaved peptide of the seven-transmembrane domain TR (TR1-41) is a strong platelet agonist. (umassmed.edu)
- The reason why 'Yohimbine hcl' is included in Helios is that it binds to the A2 receptor and blocks Norepinephrine(and other A2 agonist including oestrogen) from binding to, and antagonizing it (which inhibits the release of fatty acids). (juicedmuscle.com)
- It potently stimulates TP receptor-mediated, but not other prostaglandin receptor-mediated responses in various in vitro preparations and exhibits many properties similar to thromboxane A2, including shape change and aggregation of platelets and smooth muscle contraction. (wikipedia.org)
- Recently it was also shown that FTY720 can reduce prostaglandin synthesis through the direct inhibition of the cytosolic phospholipase A2 (cPLA2). (uni-frankfurt.de)
- Reverse the signs caused by the a2-adrenergic agonist imidazoline decongestant in the eye drops with a single dose of atipamezole and send the pet home. (aspcapro.org)
- Reverse the signs caused by the a2-adrenergic agonist imidazoline decongestant in the eye drops with atipamezole and keep Missy in hospital on fluids. (aspcapro.org)
- Atipamezole, being an a2-adrenergic antagonist, will reverse the signs, but the half-life of atipamezole is short, so additional doses may be indicated, based on the clinical signs that the pet is showing. (aspcapro.org)
- A and B ) HIV-1 NLYU2 replication in CD4+ T cells ( A ) or macrophages ( B ) treated with AhR agonist or antagonist. (elifesciences.org)
- I ) Comparison of HIV-1 supernatant reverse transcriptase levels, at four days after infection in infected macrophages, CD4+ T cells or PBMCs treated with AhR agonist or antagonist. (elifesciences.org)
- B ) Western blot analysis of STAT1 and phosphorylated STAT1 protein levels in macrophages treated with AhR agonist or antagonist and IFN-γ. (elifesciences.org)
- C ) FACS analysis of macrophages stained with propidium iodide to reveal DNA content distribution following treatment with the AhR agonist or antagonist. (elifesciences.org)
- A ) Quantitative PCR analysis of CDK1, cyclin A2, CDK2, cyclin E2 and CYP1B1 mRNA levels in macrophages treated with carrier (DMSO), AhR agonist or AhR antagonist. (elifesciences.org)
- B ) Western blot analysis of HSP90 (loading control) CDK1, cyclin A2, CDK2, cyclin E2 protein levels in macrophages treated with carrier (DMSO), AhR agonist or antagonist. (elifesciences.org)
- C ) Western blot analysis of HSP90 (loading control), total SAMHD1 levels, and phosphorylated SAMHD1 levels in macrophages treated with carrier (DMSO), AhR agonist or antagonist. (elifesciences.org)
- D ) Analysis of dNTP levels in macrophages treated with AhR agonist or antagonist. (elifesciences.org)
- A ) Levels of SAMHD1, phosphorylated SAMHD1, CDK1 and CDK2 proteins in activated or unsimulated, unfractionated PBMCs treated with carrier, AhR agonist or antagonist. (elifesciences.org)
- B ) Levels of SAMHD1, phosphorylated SAMHD1, CDK1 and CDK2 proteins in activated or unstimulated purified CD4+ T cells treated with carrier, AhR agonist or antagonist. (elifesciences.org)
- Other studies have explored the use of prophylactic benzodiazepines and a-2 agonists. (radiusanesthesia.com)
- U-73122 (10 microM), another phospholipase A2 inhibitor, decreased evoked overflow of DA, did not affect the action of N-0437 but also increased spontaneous outflow of DA. (aspetjournals.org)
- These data indicate that GLP-1R agonists down-regulate innate inflammatory responses to endotoxins or endogenous inflammatory mediators. (justia.com)
- However, no studies have reported the effect of GLP-1R agonists on lung IL-33 expression or release, the effect of GLP-1R agonists on the innate allergic inflammatory response that is mediated by ILC2, or the effect of GLP-1R agonists on respiratory syncytial virus (RSV) infection. (justia.com)
- Mini viral RNAs act as innate immune agonists during influenza virus infection. (cdc.gov)
- In its phosphorylated form FTY720 is a potent S1P receptor agonist. (uni-frankfurt.de)
- Their reduced intrinsic efficacy relative to full agonists such as diazepam resulted in an improved preclinical pharmacological profile in that there was a large window between anxiolytic and sedative doses and their dependence and abuse liabilities were much lower. (hhs.gov)
- however, modafinil is inactive in other in vitro assay systems known to be responsive to á-adrenergic agonists, such as the rat vas deferens preparation. (illnesshacker.com)
- The mutant receptor expressed in Chinese hamster ovary cells showed decreased agonist-induced second messenger formation despite its normal ligand binding affinities. (jci.org)
- In the late 1980s and early 1990s a number of non-selective partial agonists, exemplified by bretazenil, pazinaclone and abecarnil, were described. (hhs.gov)
- The fairly high strength of NECA could possibly be because of a synergism between central A1 and A2receptor activation by this non-selective agonist. (thetechnoant.info)
- They have differing effects on the endocannabinoid system, with both suppressing CB1 as indirect agonists preventing receptor access to other chemicals, but with CBD unable to bind to CB2 the way CBG does. (cbdsafe.com)
- STUDY DESIGN AND METHODS: In both human and baboon fresh and lyophilized PLTs, aggregation response and PLT production of thromboxane A2 were measured after stimulation, and PLT surface markers P-selectin, glycoprotein (GP) Ib, GPIIb-IIIa, and factor (F) V were measured before and after stimulation. (umassmed.edu)
- Several studies report that GLP-1R agonists had anti-inflammatory effects in multiple disorders including T2D. (justia.com)
- 10 microM) increased electrically evoked overflow of endogenous DA from rat striatal slices and appeared to partially block the modulatory effects of the D-2 DA receptor agonist N-0437 on this release. (aspetjournals.org)
- In addition, the GLP-1R agonist, exendin-4, reduced serum inflammatory cytokines during LPS-induced endotoxemia, liver inflammation, and aortic atherosclerosis in a rodent model. (justia.com)
- The inventors found that GLP-1R agonists inhibited IL-33 expression and release from the lungs of mice in response to an airway challenge the allergen extract of the aeroallergen Alternaria alternata , an aeroallergen which has protease activity and which is associated with severe asthma exacerbations. (justia.com)
- Microparticles are plasma membrane vesicle fragments (between 0.1 and 1 μm in size) released from various cell types during activation by agonists or physical or chemical stress, including apoptosis [ 6 , 7 ]. (ersjournals.com)
- E ) Microarray analysis of RNA extracted from macrophages treated with AhR agonist or control. (elifesciences.org)
- GLP-1 receptor (GLP-1R) agonists, such as liraglutide and exenatide are approved by the Food and Drug Administration (FDA) for treatment of type 2 diabetes (T2D). (justia.com)
- For instance, GLP-1R agonist administration decreased TNFα and IL-6 production by peripheral blood mononuclear cells (PBMC) of obese patients with T2D and diabetic mouse adipose tissue. (justia.com)
- Fasiglifam Utilizing a functionalized congener strategy, some long string derivatives of "type":"entrez-protein","attrs":"text message":"CGS21680″,"term_identification":"878113053″,"term_text message":"CGS21680″CGS21680 that maintain A2 strength and selectivity and don't support the carboxylic features was synthesized (Jacobson 1989). (thetechnoant.info)
- The agonist did not insert into neutral and negatively charged bilayers or into densely packed lipid monolayers (at surface pressures greater than 31 mN/m). (unibas.ch)